WorldWideScience

Sample records for restored ssi eligibility

  1. Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010

    Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...

  2. Federally Administered SSI Payments, Recipients by State and Other Area, Eligibility Category, and Age, Table 10, December 2008

    Social Security Administration — A statistical table of the number of recipients entitled to receive payments under Title 16 of the Social Security Act (Supplemental Security Income) by eligibility...

  3. The TANF/SSI connection.

    Wamhoff, Steve; Wiseman, Michael

    Interactions and overlap of social assistance programs across clients interest policymakers because such interactions affect both the clients' well-being and the programs' efficiency. This article investigates the connections between Supplemental Security Income (SSI) and Temporary Assistance for Needy Families (TANF) and TANF's predecessor, the Aid to Families with Dependent Children (AFDC) program. Connections between receipt of TANF and SSI are widely discussed in both disability policy and poverty research literatures because many families receiving TANF report disabilities. For both states and the individuals involved, it is generally financially advantageous for adults and children with disabilities to transfer from TANF to SSI. States gain because the federal government pays for the SSI benefit, and states can then use the TANF savings for other purposes. The families gain because the SSI benefits they acquire are greater than the TANF benefits they lose. The payoff to states from transferring welfare recipients to SSI was substantially increased when Congress replaced AFDC with TANF in 1996. States retained less than half of any savings achieved through such transfers under AFDC, but they retain all of the savings under TANF. Also, the work participation requirements under TANF have obligated states to address the work support needs of adults with disabilities who remain in TANF, and states can avoid these costs if adults have disabilities that satisfy SSI eligibility requirements. The incentive for TANF recipients to apply for SSI has increased over time as inflation has caused real TANF benefits to fall relative to payments received by SSI recipients. Trends in the financial incentives for transfer to SSI have not been studied in detail, and reliable general data on the extent of the interaction between TANF and SSI are scarce. In addition, some estimates of the prevalence of TANF receipt among SSI awardees are flawed because they fail to include adults

  4. 20 CFR 416.266 - Continuation of SSI status for Medicaid

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...

  5. SSI and structural benchmarks

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1987-01-01

    This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described

  6. 49 CFR 15.13 - Marking SSI.

    2010-10-01

    ... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...

  7. From the American Academy of Pediatrics: Policy statements--Supplemental Security Income (SSI) for children and youth with disabilities.

    2009-12-01

    The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.

  8. 49 CFR 1520.13 - Marking SSI.

    2010-10-01

    ... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...

  9. SSI's review of ASAR Oskarshamn 1

    Godaas, T.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  10. SSI's Review of RD and D Programme 98

    1999-06-01

    The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues

  11. Dicty_cDB: SSI473 [Dicty_cDB

    Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU

  12. Dicty_cDB: SSI339 [Dicty_cDB

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  13. Development of a surgical site infection (SSI) surveillance system, calculation of SSI rates and specification of important factors affecting SSI in a digestive organ surgical department.

    Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji

    2007-06-01

    We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.

  14. Preoperative antiseptic skin preparations and reducing SSI.

    Al Maqbali, Mohammed Abdullah

    Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.

  15. SSI's review of ASAR Ringhals 2, 1994

    Hofvander, P.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  16. "Jazz Ruuler" toob dzhässi Rock Cafesse

    2008-01-01

    Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés

  17. Dicty_cDB: SSI468 [Dicty_cDB

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  18. Dicty_cDB: SSI527 [Dicty_cDB

    Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict

  19. Dicty_cDB: SSI485 [Dicty_cDB

    Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056

  20. SSI's review of SKB's RDandD Program 2007

    Wiebert, Anders

    2008-05-01

    In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented

  1. The SSI reviews of the SKB research programs 1992

    Jensen, Mikael.

    1993-02-01

    The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs

  2. Science teachers teaching socioscientific issues (SSI): Four case studies

    Lee, Hyunju

    Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they

  3. Multi-equilibrium property of metabolic networks: SSI module

    Chen Luonan

    2011-06-01

    Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.

  4. Eligibility Requirements

    ... explore a list of eligibility information, Search by Keyword or Browse All . Whole Blood Donation Donation frequency: ... Travel Deferrals Still have eligibility questions? Search by Keyword Other Ways to Help Even if you aren' ...

  5. Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010

    Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...

  6. Influence of different boundary conditions on analysis of SSI

    Wang Jiachun

    2005-01-01

    In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)

  7. ssi plaat saab 30aastaseks / Gerli Romanovitsh

    Romanovitš, Gerli, 1977-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas

  8. Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor

    Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten

    2008-01-01

    The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...

  9. 20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...

  10. A Persian-version of the stuttering severity instrument-version four (SSI-4): How the new additions to SSI-4 complement its stuttering severity score?

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.

  11. SSI's International Development Co-operation (SIUS). Annual report 1998

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  12. Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io

    Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.

    2005-01-01

    Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.

  13. ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI

    Rohini Murlidhar Gajbhiye

    2017-02-01

    Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20

  14. The Center for Vein Restoration Study on presenting symptoms, treatment modalities, and outcomes in Medicare-eligible patients with chronic venous disorders.

    Pappas, Peter J; Lakhanpal, Sanjiv; Nguyen, Khanh Q; Vanjara, Rohan

    2018-01-01

    Chronic venous disorders (CVDs) have been estimated to affect up to 20 million Americans. Despite this huge prevalence, the signs, symptoms, and treatment outcomes in patients 65 years of age and older are not well defined. Our goal was to determine the presentation and treatment outcomes in elderly patients compared with a cohort of patients younger than 65 years. From January 2015 to December 2016, we retrospectively reviewed prospectively collected data from 38,750 patients with CVD from the Center for Vein Restoration's electronic medical record (NextGen Healthcare Information Systems, Irvine, Calif). We divided patients into two groups; group A patients were younger than 65 years, and group B patients were 65 years of age or older. Medical and surgical history, presenting symptoms, treatment modalities, and revised Venous Clinical Severity Score before and after intervention were evaluated. A multivariate logistic regression analysis was performed to determine the predictive value of presenting and associated symptoms. Groups A and B were subdivided by Clinical, Etiology, Anatomy, and Pathophysiology class for subgroup analysis. Data were analyzed with GraphPad Prism (GraphPad Software Inc, La Jolla, Calif) or SAS version 9.4 statistical software package (SAS Institute, Cary, NC). There were 27,536 patients in group A and 11,214 in group B. Women constituted 78% of all patients. Group B demonstrated a higher incidence of chronic diseases compared with group A (P ≤ .003). As initial presenting symptoms, pain, heaviness, fatigue, and aching were more common in group A than in group B (61% vs 55%, 30% vs 27%, 27% vs 24%, and 17% vs 12%, respectively; P ≤ .001). Swelling, skin discoloration, and venous ulceration were more common in group B than in group A (29% vs 23%, 12% vs 6%, and 5% vs 2%; P ≤ .001). Ablations were more commonly performed in group B patients with C4 to C6 disease (P ≤ .004). The revised Venous Clinical Severity Scores before and 1

  15. FT4 Data Analysis Summary (SSI-ARC)

    Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor

    2016-01-01

    Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.

  16. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents

    Ruuttu Titta

    2005-02-01

    Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  17. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI) in adolescents.

    Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri

    2005-02-03

    Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  18. SSI response of a typical shear wall structure. Volume 1

    Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.

    1984-04-01

    The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables

  19. SSI's review of SKB's RD and D programme 2001

    Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others

    2002-08-01

    In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.

  20. Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.

    Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F

    2012-10-01

    Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  1. 49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...

  2. 76 FR 446 - Supplemental Security Income (SSI) for the Aged, Blind, and Disabled; Dedicated Accounts and...

    2011-01-05

    ... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...

  3. Effective Strategies To Improve the Employment of SSI/SSDI Participants.

    Radtke, Jean, Ed.

    This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…

  4. SSI response of a typical shear wall structure

    Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.

    1985-01-01

    The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)

  5. Active Volcanism on Io as Seen by Galileo SSI

    McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.

    1998-01-01

    Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50

  6. Cl@ssi 2.0: experience in Emilia Romagna

    Elena Pacetti

    2013-06-01

    Full Text Available This article presents some of the results of the Ministerial Initiative Cl@ssi 2.0 in the Emilia Romagna Region. Having described the reference field in which the scaffolding action of the research group of the University of Bologna, coordinated by Prof. Luigi Guerra, is positioned, the paper presents the coaching model through which the design and documentation of the teaching practices adopted in schools was supported. Analysing the experiences of the ER classes, we have identified eight project themes, subsequently modelled on two levels: the didactic modelling of the experiences (construction of interpretation hypotheses; and the construction of a themes/models map (checking/adapting the hypotheses, experimentation through which each school was able to describe and publish processes, products, etc. which characterised their specific project experience. The paper concludes with a series of general reflections on the three years' work.

  7. Supplemental Security Income (SSI) / Internal Revenue Service (IRS) 1099

    Social Security Administration — A finder file from SSA's Title XVI database is provided to the IRS. The IRS discloses 1099 information to SSA for use in verifying eligibility, amount, and benefits...

  8. DoSSiER: Database of Scientific Simulation and Experimental Results

    Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea

    2017-01-01

    The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.

  9. NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2

    National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...

  10. Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area, December 2010

    Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...

  11. 20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.

    2010-04-01

    ... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...

  12. SSI analysis of a massive concrete structure based on a novel ...

    1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...

  13. SSI [soil-structure interactions] and structural benchmarks

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1986-01-01

    This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils

  14. A Persian-version of the stuttering severity instrument-version four (SSI-4) : How the new additions to SSI-4 complement its stuttering severity score?

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    2018-01-01

    Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to

  15. Seismic Response of Steel Braced Building Frame Considering Soil Structure Interaction (SSI): An Experimental Study

    Hirave, Vivek; Kalyanshetti, Mahesh

    2018-02-01

    Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.

  16. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel; Utgaangspunkter foer SSI:s granskning av ansoekan foer en inkapslingsanlaeggning och ett slutfoervar foer anvaent kaernbraensle

    Oehlen, Elisabeth

    2006-09-15

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.

  17. Secondary signal imaging (SSI) electron tomography (SSI-ET): A new three-dimensional metrology for mesoscale specimens in transmission electron microscope.

    Han, Chang Wan; Ortalan, Volkan

    2015-09-01

    We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.

  18. Validation of seismic soil structure interaction (SSI) methodology for a UK PWR nuclear power station

    Llambias, J.M.

    1993-01-01

    The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation

  19. Using Social Media to Promote Pre-Service Science Teachers' Practices of Socio-Scientific Issue (SSI) - Based Teaching

    Pitiporntapin, Sasithep; Lankford, Deanna Marie

    2015-01-01

    This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…

  20. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel

    Oehlen, Elisabeth

    2006-09-01

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect

  1. 20 CFR 416.1835 - Information we need about separation or end of marriage after you become eligible for SSI.

    2010-04-01

    ...) Divorce or annulment. If your marriage ends by divorce or annulment, you must show us the decree of divorce or annulment if you can. If you cannot, you must tell us why not and give us whatever evidence you can. (3) Other reason. If your marriage ends for reasons other than death, divorce, or annulment, you...

  2. 75 FR 1271 - Technical Revisions to the Supplemental Security Income (SSI) Regulations on Income and Resources

    2010-01-11

    ... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...

  3. Galileo SSI Observations of Io During Orbits C30 I33

    Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.

    2002-01-01

    New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.

  4. 20 CFR 416.1826 - Showing that you are not married when you apply for SSI.

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...

  5. Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter

    Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann

    2010-01-01

    There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…

  6. Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model

    Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi

    2013-01-01

    The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.

  7. Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses

    Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee

    2016-01-01

    The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45

  8. 73. Surgical site infection after CABG: Root cause analysis and quality measures recommendation SSI quality improvement project

    A. Arifi

    2016-07-01

    Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the

  9. National Survey of Child and Adolescent Well-Being, No. 12: Estimates of Supplemental Security Income Eligibility for Children in Out-of-Home Placements. Research Brief: Findings from the NSCAW Study

    US Department of Health and Human Services, 2008

    2008-01-01

    Children who have been placed in foster care have been found to be at a high risk of having a medical, social or behavioral disability. This brief, one in a series of briefs addressing access to services for children in the child welfare system, examines Supplemental Security Income (SSI) eligibility among children living in out-of-home placements…

  10. Interim restorations.

    Gratton, David G; Aquilino, Steven A

    2004-04-01

    Interim restorations are a critical component of fixed prosthodontic treatment, biologically and biomechanically. Interim restoration serves an important diagnostic role as a functional and esthetic try-in and as a blueprint for the design of the definitive prosthesis. When selecting materials for any interim restoration, clinicians must consider physical properties, handling properties, patient acceptance, and material cost. Although no single material meets all the requirements and material classification alone of a given product is not a predictor of clinical performance, bis-acryl materials are typically best suited to single-unit restorations, and poly(methylmethacrylate) interim materials are generally ideal for multi-unit, complex, long-term, interim fixed prostheses. As with most dental procedures, the technique used for fabrication has a greater effect on the final result than the specific material chosen.

  11. Restoring forests

    Jacobs, Douglass F.; Oliet, Juan A.; Aronson, James

    2015-01-01

    of land requiring restoration implies the need for spatial prioritization of restoration efforts according to cost-benefit analyses that include ecological risks. To design resistant and resilient ecosystems that can adapt to emerging circumstances, an adaptive management approach is needed. Global change......, in particular, imparts a high degree of uncertainty about the future ecological and societal conditions of forest ecosystems to be restored, as well as their desired goods and services. We must also reconsider the suite of species incorporated into restoration with the aim of moving toward more stress resistant...... and competitive combinations in the longer term. Non-native species may serve an important role under some circumstances, e.g., to facilitate reintroduction of native species. Propagation and field establishment techniques must promote survival through seedling stress resistance and site preparation. An improved...

  12. SSI's Review of the RDandD Program 2004 of the Swedish Nuclear Fuel and Waste Management Co; SSI:s granskning av SKB:s Fud-program 2004

    Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others

    2005-06-01

    In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.

  13. Effects of different SSI parameters on the floor response spectra of a nuclear reactor building

    Kabir, A.F.; Bolourchi, S.; Maryak, M.E.

    1991-01-01

    The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth

  14. The SSI TOOLBOX Source Term Model SOSIM - Screening for important radionuclides and parameter sensitivity analysis

    Avila Moreno, R.; Barrdahl, R.; Haegg, C.

    1995-05-01

    The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.

  15. Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model

    Kang, Joo-Hyung; Lee, Sang-Hoon

    2008-01-01

    Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated

  16. ramic restorations

    Ashish R Jain

    2013-01-01

    Full Text Available Rehabilitation of a patient with severely worn dentition after restoring the vertical dimension is a complex procedure and assessment of the vertical dimension is an important aspect in these cases. This clinical report describes the full mouth rehabilitation of a patient who was clinically monitored to evaluate the adaptation to a removable occlusal splint to restore vertical dimension for a period 1 month and provisional restorations to determine esthetic and functional outcome for a period of 3 months. It is necessary to recognizing that form follows function and that anterior teeth play a vital role in the maintenance of oral health. Confirmation of tolerance to changes in the vertical dimension of occlusion (VDO is of paramount importance. Articulated study casts and a diagnostic wax-up can provide important information for the evaluation of treatment options. Alteration of the VDO should be conservative and should not be changed without careful consideration.

  17. Hair restoration.

    Rawnsley, Jeffrey D

    2008-08-01

    The impact of male hair loss as a personal and social marker of aging is tremendous and its persistence as a human concern throughout recorded history places it in the forefront of male concern about the physical signs of aging. Restoration of the frontal hairline has the visual effect of re-establishing facial symmetry and turning back time. Follicular unit transplantation has revolutionized hair restoration, with its focus on redistributing large numbers of genetically stable hair to balding scalp in a natural distribution. Follicular unit hair restoration surgery is a powerful tool for the facial plastic surgeon in male aesthetic facial rejuvenation because it offers high-impact, natural-appearing results with minimal downtime and risk for adverse outcome.

  18. Adaptive Roles of SSY1 and SIR3 During Cycles of Growth and Starvation in Saccharomyces cerevisiae Populations Enriched for Quiescent or Nonquiescent Cells.

    Wloch-Salamon, Dominika M; Tomala, Katarzyna; Aggeli, Dimitra; Dunn, Barbara

    2017-06-07

    Over its evolutionary history, Saccharomyces cerevisiae has evolved to be well-adapted to fluctuating nutrient availability. In the presence of sufficient nutrients, yeast cells continue to proliferate, but upon starvation haploid yeast cells enter stationary phase and differentiate into nonquiescent (NQ) and quiescent (Q) cells. Q cells survive stress better than NQ cells and show greater viability when nutrient-rich conditions are restored. To investigate the genes that may be involved in the differentiation of Q and NQ cells, we serially propagated yeast populations that were enriched for either only Q or only NQ cell types over many repeated growth-starvation cycles. After 30 cycles (equivalent to 300 generations), each enriched population produced a higher proportion of the enriched cell type compared to the starting population, suggestive of adaptive change. We also observed differences in each population's fitness suggesting possible tradeoffs: clones from NQ lines were better adapted to logarithmic growth, while clones from Q lines were better adapted to starvation. Whole-genome sequencing of clones from Q- and NQ-enriched lines revealed mutations in genes involved in the stress response and survival in limiting nutrients ( ECM21 , RSP5 , MSN1 , SIR4 , and IRA2 ) in both Q and NQ lines, but also differences between the two lines: NQ line clones had recurrent independent mutations affecting the Ssy1p-Ptr3p-Ssy5p (SPS) amino acid sensing pathway, while Q line clones had recurrent, independent mutations in SIR3 and FAS1 Our results suggest that both sets of enriched-cell type lines responded to common, as well as distinct, selective pressures. Copyright © 2017 Wloch-Salamon et al.

  19. Transparent Restoration

    Barou, L.; Bristogianni, T.; Oikonomopoulou, F.

    2017-01-01

    This paper investigates the application of structural glass in restoration and conservation practices in order to highlight and safeguard our built heritage. Cast glass masonry is introduced in order to consolidate a half-ruined historic tower in Greece, by replacing the original parts of the façade

  20. Site Restoration

    Noynaert, L.; Bruggeman, A.; Cornelissen, R.; Massaut, V.; Rahier, A

    2001-04-01

    The objectives, the programme, and the achievements of the Site Restoration Department of SCK-CEN in 2000 are summarised. Main activities include the decommissioning of the BR3 PWR-reactor as well as other clean-up activities, projects on waste minimisation and activities related to the management of decommissioning projects. The department provides consultancy and services to external organisations.

  1. Site Restoration

    Noynaert, L.; Bruggeman, A.; Cornelissen, R.; Massaut, V.; Rahier, A.

    2001-01-01

    The objectives, the programme, and the achievements of the Site Restoration Department of SCK-CEN in 2000 are summarised. Main activities include the decommissioning of the BR3 PWR-reactor as well as other clean-up activities, projects on waste minimisation and activities related to the management of decommissioning projects. The department provides consultancy and services to external organisations

  2. Restorative neuroscience

    Andres, Robert H; Meyer, Morten; Ducray, Angélique D

    2008-01-01

    There is increasing interest in the search for therapeutic options for diseases and injuries of the central nervous system (CNS), for which currently no effective treatment strategies are available. Replacement of damaged cells and restoration of function can be accomplished by transplantation of...

  3. Environmental Restoration

    Zeevaert, T.; Vanmarcke, H

    1998-07-01

    The objectives of SCK-CEN's programme on environmental restoration are (1) to optimize and validate models for the impact assessment from environmental, radioactive contaminations, including waste disposal or discharge; (2) to support the policy of national authorities for public health and radioactive waste management. Progress and achievements in 1997 are reported.

  4. 75 FR 4006 - Emergency Restoration Plan (ERP)

    2010-01-26

    ... Agency (FEMA) for public assistance grant eligibility in the event of a declared disaster. This amendment... they incur costs for disaster related system repair and restoration by including FEMA requirements in... comments, and viewing the docket after the close of the comment period, is available through the site's...

  5. Effect of the gate scaling on the analogue performance of s-Si CMOS devices

    Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E

    2011-01-01

    In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts

  6. SSI`s International Development Co-operation (SIUS). Annual report 1998

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  7. THE EFFECT OF 5E LEARNING CYCLE INSTRUCTIONAL MODEL USING SOCIOSCIENTIFIC ISSUES (SSI LEARNING CONTEXT ON STUDENTS’ CRITICAL THINKING

    A. Cahyarini

    2016-11-01

    Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills (  = 74,95 than both the student who learned using 5E LC model (  = 74,17 and  the student who learned using conventional method (  = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However,  there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.

  8. The role of the cerebellum in auditory processing using the SSI test A participação do cerebelo no processamento auditivo com o uso do teste SSI

    Patricia Maria Sens

    2011-10-01

    Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte

  9. Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI

    MOHD AFIFI BAHURUDIN SETAMBAH

    2018-05-01

    Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.

  10. Development of generic soil profiles and soil data development for SSI analyses

    Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)

    2014-04-01

    This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.

  11. Nonlinear Time Domain Seismic Soil-Structure Interaction (SSI) Deep Soil Site Methodology Development

    Spears, Robert Edward; Coleman, Justin Leigh

    2015-01-01

    Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This

  12. Resistance to Dialogic Discourse in SSI Teaching: The Effects of an Argumentation-Based Workshop, Teaching Practicum, and Induction on a Preservice Science Teacher

    Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan

    2017-01-01

    Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…

  13. Site Restoration

    Noynaert, L.; Bruggeman, A.; Cornelissen, R.; Massaut, V.; Rahier, A

    2002-04-01

    The objectives, the programme, and the achievements of SCK-CEN's Site Restoration Department for 2001 are described. Main activities include the decommissioning of the BR3 PWR-reactor as well as other clean-up activities, projects on waste minimisation and the management of spent fuel and the flow of dismantled materials and the recycling of materials from decommissioning activities based on the smelting of metallic materials in specialised foundries. The department provides consultancy and services to external organisations and performs R and D on new techniques including processes for the treatment of various waste components including the reprocessing of spent fuel, the treatment of tritium, the treatment of liquid alkali metals into cabonates through oxidation, the treatment of radioactive organic waste and the reconditioning of bituminised waste products.

  14. Earth-based and Galileo SSI multispectral observations of eastern mare serenitatis and the Apollo 17 landing site

    Hiesinger, H.; Jaumann, R.; Neukum, G.

    1993-01-01

    Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.

  15. Incorporating higher order WINKLER springs with 3-D finite element model of a reactor building for seismic SSI analysis

    Ermutlu, H.E.

    1993-01-01

    In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained

  16. Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC

    Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)

    2000-07-01

    The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)

  17. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.

  18. Framing student dialogue and argumentation: Content knowledge development and procedural knowing in SSI inquiry group work

    Anne Kristine Byhring

    2014-10-01

    Full Text Available In this article, we discuss the negotiation of the situated common ground in classroom conversations. Decision making on socioscientific issues (SSI includes norms of diverse funds of knowledge and interests. Arguments and justification may include warrants that cannot necessarily be weighed on the same scale. We discuss Roberts’ Visions 1 and 2 of scientific literacy as framing the common ground of classroom discussions. Two teacher–student dialogue sequences with 11th grade students from the Norwegian research project ElevForsk exemplify the negotiation of the situated common ground and the students’ deliberations. Our analysis examines what goes on in the thematic content, as well as at the interpersonal level of language use. Further, we suggest that different framings may complement each other and provide a space for the students’ emerging scientific conceptual development as well as for deliberation as a form of emerging procedural knowing.

  19. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches

  20. The final Galileo SSI observations of Io: Orbits G28-I33

    Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.

    2004-01-01

    We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.

  1. 5 CFR 330.1203 - Eligibility.

    2010-01-01

    ... Employees § 330.1203 Eligibility. (a) In order to be eligible for special selection priority, an eligible...) Eligibility for special selection priority as an eligible displaced employee of the former Panama Canal Zone...) Eligibility for special selection priority as an eligible displaced employee of the former Panama Canal Zone...

  2. Health care utilization among Medicare-Medicaid dual eligibles: a count data analysis

    Shin Jaeun

    2006-04-01

    Full Text Available Abstract Background Medicare-Medicaid dual eligibles are the beneficiaries of both Medicare and Medicaid. Dual eligibles satisfy the eligibility conditions for Medicare benefit. Dual eligibles also qualify for Medicaid because they are aged, blind, or disabled and meet the income and asset requirements for receiving Supplement Security Income (SSI assistance. The objective of this study is to explore the relationship between dual eligibility and health care utilization among Medicare beneficiaries. Methods The household component of the nationally representative Medical Expenditure Panel Survey (MEPS 1996–2000 is used for the analysis. Total 8,262 Medicare beneficiaries are selected from the MEPS data. The Medicare beneficiary sample includes individuals who are covered by Medicare and do not have private health insurance during a given year. Zero-inflated negative binomial (ZINB regression model is used to analyse the count data regarding health care utilization: office-based physician visits, hospital inpatient nights, agency-sponsored home health provider days, and total dental visits. Results Dual eligibility is positively correlated with the likelihood of using hospital inpatient care and agency-sponsored home health services and the frequency of agency-sponsored home health days. Frequency of dental visits is inversely associated with dual eligibility. With respect to racial differences, dually eligible Afro-Americans use more office-based physician and dental services than white duals. Asian duals use more home health services than white duals at the 5% statistical significance level. The dual eligibility programs seem particularly beneficial to Afro-American duals. Conclusion Dual eligibility has varied impact on health care utilization across service types. More utilization of home healthcare among dual eligibles appears to be the result of delayed realization of their unmet healthcare needs under the traditional Medicare-only program

  3. Eligibility for renal denervation

    Persu, Alexandre; Jin, Yu; Baelen, Marie

    2014-01-01

    -resistant hypertension (ENCOReD). The analysis included 731 patients. Age averaged 61.6 years, office blood pressure at screening was 177/96 mm Hg, and the number of blood pressure-lowering drugs taken was 4.1. Specialists referred 75.6% of patients. The proportion of patients eligible for renal denervation according...... undetected secondary causes of hypertension (11.1%). In conclusion, after careful screening and treatment adjustment at hypertension expert centers, only ≈40% of patients referred for renal denervation, mostly by specialists, were eligible for the procedure. The most frequent cause of ineligibility...... (approximately half of cases) was blood pressure normalization after treatment adjustment by a hypertension specialist. Our findings highlight that hypertension centers with a record in clinical experience and research should remain the gatekeepers before renal denervation is considered....

  4. 38 CFR 21.3302 - Special restorative training agreements and reports.

    2010-07-01

    ... make agreements with public or private educational institutions or others to provide suitable and necessary special restorative training for an eligible person. (b) Tuition charge. When a customary tuition...

  5. SKI's and SSI's review of SKB's safety report SR-Can

    Dverstorp, Bjoern; Stroemberg, Bo

    2008-03-01

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality

  6. Factors affecting re-vegetation dynamics of experimentally restored extracted peatland in Estonia.

    Karofeld, Edgar; Müür, Mari; Vellak, Kai

    2016-07-01

    Increasing human activity continues to threaten peatlands, and as the area of natural mires declines, our obligation is to restore their ecosystem functions. Several restoration strategies have been developed for restoration of extracted peatlands, including "The moss layer transfer method", which was initiated on the Tässi extracted peatland in central Estonia in May 2012. Three-year study shows that despite the fluctuating water table, rainfall events can compensate for the insufficient moisture for mosses. Total plant cover on the restoration area attained 70 %, of which ~60 % is comprised of target species-Sphagnum mosses. From restoration treatments, spreading of plant fragments had a significant positive effect on the cover of bryophyte and vascular plants. Higher water table combined with higher plant fragments spreading density and stripping of oxidised peat layer affected positively the cover of targeted Sphagnum species. The species composition in the restoration area became similar to that in the donor site in a natural bog. Based on results, it was concluded that the method approved for restoration in North America gives good results also in the restoration of extracted peatland towards re-establishment of bog vegetation under northern European conditions.

  7. Análise da versão espanhola do Sport Satisfaction Instrument (SSI adaptado à Educação Física Analysis of the Spanish version of the Sport Satisfaction Instrument (SSI adapted to Physical Education

    Antonio Granero-Gallegos

    2013-03-01

    Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.

  8. SKI's and SSI's experiences from their participation in the siting of a final repository for spent nuclear fuel

    Westerlind, M.; Hedberg, B.

    2000-01-01

    This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)

  9. The systemic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho's report for project RISCOM

    Espejo, R.; Gill, A.

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions

  10. SSI and SKI's Review of SKB's Updated Final Safety Report for SFR 1. Review Report

    2003-10-01

    The Repository for Radioactive Operational Waste (SFR 1) is now the object of a new review by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). One of the stipulations for operating SFR 1 was that a new assessment of the long-term performance and environmental consequences of the repository should be conducted once every 10 years by the licensee, the Swedish Nuclear Fuel and Waste Management Co (SKB). During the time that SFR 1 has been in operation, experience has been gained of operating the facility and new knowledge of long-term performance of SFR 1 has been obtained. New regulations for nuclear facilities have been promulgated since SFR 1 was taken into operation (1988). A review committee comprising employees from SKI and SSI has conducted the review of SSR 2001. This review report has resulted in the committee's evaluation of the safety of SFR 1 and is the basis of the regulatory authorities' decision concerning any amendments to the stipulations for the operation of SFR 1. However, the review has found deficiencies in the follow up of the development of design basis norms since the facility was constructed as well as deficiencies in learning from operating experience. However, the overall evaluation is that the facility is being operated in an acceptable manner from the standpoint of safety. With respect to the long-term performance of the repository, it is a deficiency that SSR 2001 does not describe how compliance with the stipulated radiation protection requirements on optimisation and use of the best available technology (BAT) is achieved during operation. In the opinion of the review committee, issues relating to occupational radiation protection are being handled satisfactorily and the operational releases of radioactive substances are very small. Safety and Radiation Protection after Closure SKB's long-term repository performance assessment contains essential updates and improvements compared with the

  11. SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results

    Francesca Ceroni

    2014-11-01

    Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.

  12. [Spanish adaptation of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM)].

    Escobar Espejo, Milagros; Blanca, María J; Fernández-Baena, F Javier; Trianes Torres, María Victoria

    2011-08-01

    The aim of the present study was to translate into Spanish and to describe the psychometric properties of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM), developed by Fimian, Fastenau, Tashner and Cross to identify the main manifestations of stress in adolescents. The scale was applied to a sample of 1,002 pupils from years one and two of Secondary Education. The paper reports the factor structure, an item analysis, the internal consistency, differences by sex and academic year, external evidence of validity, and norms for scoring the scale. The results reveal a factor structure based on three first-order factors (emotional manifestations, physiological manifestations and behavioural manifestations) and one second-order factor (indicative of stress manifestations). In terms of external validity, there was a positive association with measures of perceived stress, aggressiveness, internalized/externalized symptoms, and a negative association with life satisfaction. The results show that the scale is an adequate tool for evaluating stress manifestations in adolescents.

  13. The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions

    Li, Q.

    2016-12-01

    The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study

  14. Long-term housing subsidies and SSI/SSDI income: Creating health-promoting contexts for families experiencing housing instability with disabilities.

    Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R

    2018-04-01

    Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Conservation and restoration of forested wetlands: new techniques and perspectives

    James Johnston; Steve Hartley; Antonio Martucci

    2000-01-01

    A partnership of state and federal agencies and private organizations is developing advanced spatial analysis techniques applied for conservation and restoration of forested wetlands. The project goal is to develop an application to assist decisionmakers in defining the eligibility of land sites for entry in the Wetland Reserve Program (WRP) of the U.S. Department of...

  16. Restoration of Gooseberry Creek

    Jonathan W. Long

    2000-01-01

    Grazing exclusion and channel modifications were used to restore wet meadows along a stream on the Fort Apache Indian Reservation. The efforts are reestablishing functional processes to promote long-term restoration of wetland health and species conservation.

  17. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    Wilmot, R.D.; Galson, D.A.; Hora, S.C.

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to

  18. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session

  19. Occupational noise exposure in small scale hand tools manufacturing (forging) industry (SSI) in Northern India.

    Singh, Lakhwinder Pal; Bhardwaj, Arvind; Deepak, K K; Bedi, Raman

    2009-08-01

    Occupational noise has been recognized as hazardous for the human beings. A high noise level in forging shops is considered to lower the labour productivity and cause illness however occupational noise is being accepted as an integral part of the job. The present study has been carried out in 5 small scale hand tool forging units (SSI) of different sizes in Northern India in Punjab. Noise levels at various sections were measured. OSHA norms for hearing conservation has been incorporated which includes an exchange rate of 5 dB (A), criterion level at 90 dB (A), criterion time of 8 h, threshold level=80 dB (A), upper limit=140 dB (A) and with F/S response rate. Equivalent sound pressure level (L(eq)) has been measured in various sections of these plants. Noise at various sections like hammer section, cutting presses, punching, grinding and barrelling process was found to be >90 dB (A), which is greater than OSHA norms. A cross-sectional study on the basis of questionnaire has been carried out. The results of which revealed that 68% of the workers are not wearing ear protective equipments out of these 50% were not provided with PPE by the company. About 95% of the workers were suffering speech interference though high noise annoyance was reported by only 20%. It has been established that the maximum noise exposure is being taken by the workers as they are working more than 8h a day for six days per week. More than 90% workers are working 12 to 24 h over time per week which lead to very high noise exposure i.e. 50 to 80% per week higher than exposure time/week in USA or European countries(15, 16)).

  20. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64); SSI:s granskning av SKB:s storregionala grundvattenmodellering foer oestra Smaaland (SKB Rapport 06-64)

    Dverstorp, Bjorrn

    2007-09-15

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.

  1. Global Ecosystem Restoration Index

    Fernandez, Miguel; Garcia, Monica; Fernandez, Nestor

    2015-01-01

    The Global ecosystem restoration index (GERI) is a composite index that integrates structural and functional aspects of the ecosystem restoration process. These elements are evaluated through a window that looks into a baseline for degraded ecosystems with the objective to assess restoration...

  2. Linking restoration ecology with coastal dune restoration

    Lithgow, D.; Martínez, M. L.; Gallego-Fernández, J. B.; Hesp, P. A.; Flores, P.; Gachuz, S.; Rodríguez-Revelo, N.; Jiménez-Orocio, O.; Mendoza-González, G.; Álvarez-Molina, L. L.

    2013-10-01

    Restoration and preservation of coastal dunes is urgently needed because of the increasingly rapid loss and degradation of these ecosystems because of many human activities. These activities alter natural processes and coastal dynamics, eliminate topographic variability, fragment, degrade or eliminate habitats, reduce diversity and threaten endemic species. The actions of coastal dune restoration that are already taking place span contrasting activities that range from revegetating and stabilizing the mobile substrate, to removing plant cover and increasing substrate mobility. Our goal was to review how the relative progress of the actions of coastal dune restoration has been assessed, according to the ecosystem attributes outlined by the Society of Ecological Restoration: namely, integrity, health and sustainability and that are derived from the ecological theory of succession. We reviewed the peer reviewed literature published since 1988 that is listed in the ISI Web of Science journals as well as additional references, such as key books. We exclusively focused on large coastal dune systems (such as transgressive and parabolic dunefields) located on natural or seminatural coasts. We found 150 articles that included "coastal dune", "restoration" and "revegetation" in areas such as title, keywords and abstract. From these, 67 dealt specifically with coastal dune restoration. Most of the studies were performed in the USA, The Netherlands and South Africa, during the last two decades. Restoration success has been assessed directly and indirectly by measuring one or a few ecosystem variables. Some ecosystem attributes have been monitored more frequently (ecosystem integrity) than others (ecosystem health and sustainability). Finally, it is important to consider that ecological succession is a desirable approach in restoration actions. Natural dynamics and disturbances should be considered as part of the restored system, to improve ecosystem integrity, health and

  3. Athletic Eligibility: Right or Privilege?

    Reeves, Kimberly

    1998-01-01

    Berkeley High School, with the nation's largest sports program, had numerous student eligibility violations in 1997. Many districts are defending the validity of their eligibility practices, as parents push harder for their children's right to compete on school teams. This article covers legal battles, competitive environments, legislative…

  4. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64)

    Dverstorp, Bjorrn

    2007-09-01

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009

  5. SSI sensitivity studies and model improvements for the US NRC Seismic Safety Margins Research Program. Rev. 1

    Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.

    1984-10-01

    The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables

  6. Small, simple but useful: the SSI approach to a real-time system for decision making support

    Baeverstam, U.

    1993-01-01

    In case of a nuclear accident or a threat of a release, the Swedish Radiation Protection Institute (SSI) is responsible for advising and informing the Government, other authorities and the public. The institute's experts are supported by a newly developed, small computerised system. Some components of the system are: a simple model for atmospheric dispersion and dose predictions; databases including maps, nuclides, instruments and facilities to store and handle measured values; on-line connection to nationwide system of automatic measuring stations; a number of data display facilities; and computer based handbooks. Most software for the system is written for the MS Windows environment. (author)

  7. 7 CFR 1738.16 - Eligible entities.

    2010-01-01

    ... cooperative, nonprofit, limited dividend or mutual associations, limited liability companies, commercial... or partnerships of individuals are not eligible entities. (2) An entity is not eligible if it serves...

  8. Green Power Partnership Eligible Organizations

    The U.S. EPA's Green Power Partnership is a voluntary partnership program designed to reduce the environmental impact of electricity generation by promoting renewable energy. Many different types of organizations are eligible to become Partners.

  9. Restorative dentistry for children.

    Donly, Kevin J

    2013-01-01

    This article discusses contemporary pediatric restorative dentistry. Indications and contraindications for the choice of different restorative materials in different clinical situations, including the risk assessment of the patient, are presented. The specific use of glass ionomer cement or resin-modified glass ionomer cement, resin-based composite, and stainless steel crowns is discussed so that preparation design and restoration placement is understood. Copyright © 2013 Elsevier Inc. All rights reserved.

  10. Pengaruh Learning Cycle–5E Berkonteks SSI Terhadap Pemahaman Hakikat Sains Pada Materi Larutan Penyangga Dan Hidrolisis Garam Siswa SMA

    Eris Ratnawati

    2017-03-01

    Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis   Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam

  11. SKI's and SSI's joint review of SKB's safety assessment report, SR 97. Summary

    2001-01-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) has a programme for the siting of a repository for spent nuclear fuel in Swedish bedrock. In 1996, the Swedish Government decided that SKB must perform an assessment of the repository's long-term safety before undertaking the next step of the programme which entails drilling in a minimum of two municipalities (site investigations). SKB has presented such a safety assessment in SR 97 Post-closure Safety (henceforth referred to as SR 97). SR 97 is one of the documents in the comprehensive reporting that SKB must provide when it proposes sites for investigation. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) have evaluated SR 97 in terms of its purposes which are to demonstrate a methodology for safety assessment, to show that Swedish bedrock can provide a safe repository using SKB's method, to provide a basis for specifying the factors that are important for site selection and to derive preliminary requirements on the function of the engineered barriers. The authorities have reached the following conclusions: SR 97 does not indicate any conditions that would mean that geological final disposal in accordance with SKB's method would have significant deficiencies in relation to the safety and radiation protection requirements of the authorities. SR 97 contains the elements required for a comprehensive assessment of safety and radiation protection. SKB's safety assessment methodology has improved within several important areas, such as the documentation of processes and properties that can affect repository performance and the development of models for safety assessment calculations. The methodology used in SR 97 has some deficiencies, for example, the specification of future events to be described in the safety assessment. SR 97 has not, to an adequate extent, dealt with unfavourable conditions that can affect the future safety of a repository. SKB states that the

  12. The role of Swedish Radiation Protection Authority in the field of public health; SSI:s roll i folkhaelsoarbetet - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna

    2004-09-01

    The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.

  13. The role of Swedish Radiation Protection Authority in the field of public health 2008; SSI:s roll i folkhaelsoarbetet 2008 - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf

    2008-04-15

    The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures

  14. First-in-human safety and immunogenicity investigations of three adjuvanted reduced dose inactivated poliovirus vaccines (IPV-Al SSI) compared to full dose IPV Vaccine SSI when given as a booster vaccination to adolescents with a history of IPV vaccination at 3, 5, 12months and 5years of age.

    Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit

    2017-01-23

    There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.

  15. Ecological restoration [book review

    Eric J. Gustafson

    2010-01-01

    Ecological restoration has increased in prominence in recent years as environmental policies have slowed the rate of environmental degradation in many parts of the world and practitioners have looked for active ways to reverse the damage. Because of the vast number of types and contexts of degraded ecological systems, the field of ecological restoration is still very...

  16. 24 CFR 330.10 - Eligible collateral.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligible collateral. 330.10 Section... SECURITIES § 330.10 Eligible collateral. The Association, in its discretion, shall determine what collateral is eligible for inclusion in the Multiclass Securities program. Eligible collateral may include GNMA...

  17. 7 CFR 1160.114 - Eligible organization.

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Eligible organization. 1160.114 Section 1160.114... Order Definitions § 1160.114 Eligible organization. Eligible organization means an organization eligible... organization pursuant to section 501(c) (3), (5), or (6) of the Internal Revenue Code (26 U.S.C. 501(c) (3), (5...

  18. 7 CFR 1260.114 - Eligible organization.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible organization. 1260.114 Section 1260.114... Promotion and Research Order Definitions § 1260.114 Eligible organization. Eligible organization means any organization which has been certified by the Secretary pursuant to the Act and this part as being eligible to...

  19. 5 CFR 330.605 - Eligibility.

    2010-01-01

    ... Employees § 330.605 Eligibility. (a) To be eligible for the special selection priority, an individual must... selection priority when there are no eligible surplus and displaced agency employees within the local...) Eligibility for special selection priority begins on the date the agency issues the employee a reduction in...

  20. Challenges of ecological restoration

    Halme, Panu; Allen, Katherine A.; Aunins, Ainars

    2013-01-01

    we introduce northern forests as an ecosystem, discuss the historical and recent human impact and provide a brief status report on the ecological restoration projects and research already conducted there. Based on this discussion, we argue that before any restoration actions commence, the ecology......The alarming rate of ecosystem degradation has raised the need for ecological restoration throughout different biomes and continents. North European forests may appear as one of the least vulnerable ecosystems from a global perspective, since forest cover is not rapidly decreasing and many...... on Biological Diversity. Several northern countries are now taking up this challenge by restoring forest biodiversity with increasing intensity. The ecology and biodiversity of boreal forests are relatively well understood making them a good model for restoration activities in many other forest ecosystems. Here...

  1. Retributive and restorative justice.

    Wenzel, Michael; Okimoto, Tyler G; Feather, Norman T; Platow, Michael J

    2008-10-01

    The emergence of restorative justice as an alternative model to Western, court-based criminal justice may have important implications for the psychology of justice. It is proposed that two different notions of justice affect responses to rule-breaking: restorative and retributive justice. Retributive justice essentially refers to the repair of justice through unilateral imposition of punishment, whereas restorative justice means the repair of justice through reaffirming a shared value-consensus in a bilateral process. Among the symbolic implications of transgressions, concerns about status and power are primarily related to retributive justice and concerns about shared values are primarily related to restorative justice. At the core of these processes, however, lies the parties' construal of their identity relation, specifically whether or not respondents perceive to share an identity with the offender. The specific case of intergroup transgressions is discussed, as are implications for future research on restoring a sense of justice after rule-breaking.

  2. Translation, Assessment and Deployment of Stuttering Instruments into Different Languages: Comments Arising from Bakhtiar et al., "Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter" ["J. Fluency Disord." 35 (2010) 87-91

    Karimi, Hamid; Nilipour, Reza; Shafiei, Bijan; Howell, Peter

    2011-01-01

    Bakhtiar, Seifpanahi, Ansari, Ghanadzade and Packman (2010) reported high inter-, and intra-judge agreement of a translation of the Stuttering Severity Instrument (SSI-3) for preschool Persian-speaking children who stutter. Translation of SSI-3 into Persian is desirable as there is no standardised stuttering severity test for that language.…

  3. Bearing restoration by grinding

    Hanau, H.; Parker, R. J.; Zaretsky, E. V.; Chen, S. M.; Bull, H. L.

    1976-01-01

    A joint program was undertaken by the NASA Lewis Research Center and the Army Aviation Systems Command to restore by grinding those rolling-element bearings which are currently being discarded at aircraft engine and transmission overhaul. Three bearing types were selected from the UH-1 helicopter engine (T-53) and transmission for the pilot program. No bearing failures occurred related to the restoration by grinding process. The risk and cost of a bearing restoration by grinding programs was analyzed. A microeconomic impact analysis was performed.

  4. Restoration of landfill sites

    Jones, A K; Chamley, M E

    1986-10-01

    Many excavated quarries are subsequently used for waste disposal operations and frequently imported landfill provides the only means of restoring a former quarry to some beneficial afteruse. Concentrating solely on the final surface cover, this paper sets out some of the principles, which should be considered by those involved in landfill operations to ensure the long term success of restoration schemes. With the emphasis on restoration to agriculture, factors such as availability of cover materials and depths necessary are discussed in terms of requirements to support plant growth, protect clay capping layers and prevent damage to agricultural implements. Soil handling and appropriate after care management are considered. 4 refs.

  5. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs

  6. The association between Bacillus Calmette-Guérin vaccination (1331 SSI) skin reaction and subsequent scar development in infants

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Ladekarl, Monica

    2017-01-01

    BACKGROUND: The Bacillus Calmette-Guérin vaccine (BCG) against tuberculosis is administered intradermally, and vaccination is often followed by a scar at the injection site. Among BCG-vaccinated individuals, having a scar has been associated with lower mortality. We aimed to examine the impact...... of vaccination technique for scarring in a high income setting, by assessing the associations between the post injection reaction, the wheal size, and the probability of developing a scar, and scar size. METHODS: This study was nested within a clinical multicenter study randomizing 4262 infants to either BCG...... vaccination (BCG 1331 SSI) or no intervention. In this substudy, including 492 vaccinated infants, the immediate post BCG vaccination reaction was registered as either wheal (a raised, blanched papule at the injection site), bulge (a palpable element at the injection site), or no reaction. The presence...

  7. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    2008-03-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  8. Coastal Wetland Restoration Bibliography

    Yozzo, David

    1997-01-01

    This bibliography was compiled to provide biologists, engineers, and planners at Corps Districts and other agencies/ institutions with a guide to the diverse body of literature on coastal wetland restoration...

  9. Restoration of ailing wetlands.

    Oswald J Schmitz

    2012-01-01

    Full Text Available It is widely held that humankind's destructive tendencies when exploiting natural resources leads to irreparable harm to the environment. Yet, this thinking runs counter to evidence that many ecological systems damaged by severe natural environmental disturbances (e.g., hurricanes can restore themselves via processes of natural recovery. The emerging field of restoration ecology is capitalizing on the natural restorative tendencies of ecological systems to build a science of repairing the harm inflicted by humans on natural environment. Evidence for this, for example, comes from a new meta-analysis of 124 studies that synthesizes recovery of impacted wetlands worldwide. While it may take up to two human generations to see full recovery, there is promise, given human will, to restore many damaged wetlands worldwide.

  10. Principles of Wetland Restoration

    the return of a degraded ecosystem to a close approximation of its remaining natural potential - is experiencing a groundswell of support across the United States. The number of stream, river, lake, wetland and estuary restoration projects grows yearly

  11. Skjern River Restoration Counterfactual

    Clemmensen, Thomas Juel

    2014-01-01

    In 2003 the Skjern River Restoration Project in Denmark was awarded the prestigious Europa Nostra Prize for ‘conserving the European cultural heritage’ (Danish Nature Agency 2005). In this case, however, it seems that the conservation of one cultural heritage came at the expense of another cultural...... this massive reconstruction work, which involved moving more than 2,7 million cubic meters of earth, cause a lot of ‘dissonance’ among the local population, the resulting ‘nature’ and its dynamic processes are also constantly compromising the preferred image of the restored landscape (Clemmensen 2014......). The presentation offers insight into an on-going research and development project - Skjern River Restoration Counterfactual, which question existing trends and logics within nature restoration. The project explores how the Skjern River Delta could have been ‘restored’ with a greater sensibility for its cultural...

  12. based dynamic voltage restorer

    HOD

    operation due to presence of increased use of nonlinear loads (computers, microcontrollers ... simulations of a dynamic voltage restorer (DVR) was achieved using MATLAB/Simulink. ..... using Discrete PWM generator, then the IGBT inverter.

  13. 20 CFR 628.702 - Eligibility.

    2010-04-01

    ... THE JOB TRAINING PARTNERSHIP ACT The Summer Youth Employment and Training Program § 628.702 Eligibility. (a) Age and economic disadvantage. An individual is eligible to participate in programs funded...

  14. 20 CFR 628.605 - Eligibility.

    2010-04-01

    ... THE JOB TRAINING PARTNERSHIP ACT The Adult Program § 628.605 Eligibility. (a) Age and economic disadvantage. Except as provided in paragraph (b) of this section, an individual shall be eligible to...

  15. Technical framework for groundwater restoration

    1991-04-01

    This document provides the technical framework for groundwater restoration under Phase II of the Uranium Mill Tailings Remedial Action (UMTRA) Project. A preliminary management plan for Phase II has been set forth in a companion document titled ''Preplanning Guidance Document for Groundwater Restoration''. General principles of site characterization for groundwater restoration, restoration methods, and treatment are discussed in this document to provide an overview of standard technical approaches to groundwater restoration

  16. 7 CFR 1739.11 - Eligible project.

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Eligible project. 1739.11 Section 1739.11 Agriculture... BROADBAND GRANT PROGRAM Community Connect Grant Program § 1739.11 Eligible project. To be eligible for a grant, the Project must: (a) Serve a Rural Area where Broadband Transmission Service does not currently...

  17. 31 CFR 321.2 - Eligible organizations.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Eligible organizations. 321.2 Section... § 321.2 Eligible organizations. (a) Organizations eligible to apply for qualification and to serve as.... (b)(1) An organization that desires to redeem securities must first qualify as a paying agent. An...

  18. 23 CFR 650.405 - Eligible projects.

    2010-04-01

    ... FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS BRIDGES, STRUCTURES, AND HYDRAULICS Highway Bridge Replacement and Rehabilitation Program § 650.405 Eligible projects... rehabilitation. (b) Types of projects which are eligible. The following types of work are eligible for...

  19. 24 CFR 35.1135 - Eligible costs.

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Eligible costs. 35.1135 Section 35....1135 Eligible costs. A PHA may use financial assistance received under the modernization program (CIAP....112 of this title. Eligible costs include: (a) Evaluation and insurance costs. Evaluation and hazard...

  20. 7 CFR 1220.109 - Eligible organization.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible organization. 1220.109 Section 1220.109... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.109 Eligible organization. The term eligible organization means any organization which has been certified by the Secretary pursuant to...

  1. 7 CFR 1250.313 - Eligible organization.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible organization. 1250.313 Section 1250.313... Research and Promotion Order Definitions § 1250.313 Eligible organization. Eligible organization means any organization, association, or cooperative which represents egg producers of any egg producing area of the...

  2. 7 CFR 1150.108 - Eligible organization.

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Eligible organization. 1150.108 Section 1150.108 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Order Definitions § 1150.108 Eligible organization. Eligible organization means any organization which...

  3. 7 CFR 1709.109 - Eligible projects.

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Eligible projects. 1709.109 Section 1709.109... projects. Eligible projects are those that acquire, construct, extend, repair, upgrade or otherwise improve... are eligible. Projects providing or improving service to communities with extremely high energy costs...

  4. 23 CFR 810.302 - Eligible projects.

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.302 Section 810.302 Highways... SPECIAL USE HIGHWAY PROJECTS Federal-Aid Urban System Nonhighway Public Mass Transit Projects § 810.302 Eligible projects. (a) Eligible projects are those defined as nonhighway public mass transit projects in...

  5. 20 CFR 628.505 - Eligibility.

    2010-04-01

    ... THE JOB TRAINING PARTNERSHIP ACT Program Design Requirements for Programs Under Title II of the Job Training Partnership Act § 628.505 Eligibility. (a) Eligibility criteria. (1) Individuals who apply to... disadvantage. Specific eligibility criteria for programs under title II, parts A, B, and C are described in...

  6. 38 CFR 21.3040 - Eligibility; child.

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Eligibility; child. 21.3040 Section 21.3040 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED.... Chapter 35 Eligibility and Entitlement § 21.3040 Eligibility; child. (a) Commencement. A program of...

  7. 12 CFR 615.5140 - Eligible investments.

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Eligible investments. 615.5140 Section 615.5140... POLICIES AND OPERATIONS, AND FUNDING OPERATIONS Investment Management § 615.5140 Eligible investments. (a) You may hold only the following types of investments listed in the Investment Eligibility Criteria...

  8. Survey and Restoration

    Mileto, C.; Vegas, F.

    2017-05-01

    In addition to the technological evolution over the last two centuries, survey has experienced two main conceptual leaps: the introduction of photography as a tool for an indiscriminate register for reality, and the shift from autographic to allographic survey, phenomena which can generate a distancing effect within the restoration process. Besides, this text presents the relationship between survey in its numerous forms and technologies (manual and semi-manual to more complex ones like scanner-laser) and the restoration of the building, either for establishing a diagnosis, operating or valorizating, illustrating it with examples developed by the authors, as well as the criteria to be applied when documenting a building to be restored, irrespective of the means and technology available in each case.

  9. SURVEY AND RESTORATION

    C. Mileto

    2017-05-01

    Full Text Available In addition to the technological evolution over the last two centuries, survey has experienced two main conceptual leaps: the introduction of photography as a tool for an indiscriminate register for reality, and the shift from autographic to allographic survey, phenomena which can generate a distancing effect within the restoration process. Besides, this text presents the relationship between survey in its numerous forms and technologies (manual and semi-manual to more complex ones like scanner-laser and the restoration of the building, either for establishing a diagnosis, operating or valorizating, illustrating it with examples developed by the authors, as well as the criteria to be applied when documenting a building to be restored, irrespective of the means and technology available in each case.

  10. Eligibility

    Potential research-users include a wide variety of private sector and non- ... important to show that the project is covering those expenses through external, non- ... no requirement that the applicant organizations and/or companies make a cash.

  11. Simulation of boreal Summer Monsoon Rainfall using CFSV2_SSiB model: sensitivity to Land Use Land Cover (LULC)

    Chilukoti, N.; Xue, Y.

    2016-12-01

    The land surface play a vital role in determining the surface energy budget, accurate representation of land use and land cover (LULC) is necessary to improve forecast. In this study, we have investigated the influence of surface vegetation maps with different LULC on simulating the boreal summer monsoon rainfall. Using a National Centres for Environmental Prediction (NCEP) Coupled Forecast System version 2(CFSv2) model coupled with Simplified Simple Biosphere (SSiB) model, two experiments were conducted: one with old vegetation map and one with new vegetation map. The significant differences between new and old vegetation map were in semi-arid and arid areas. For example, in old map Tibetan plateau classified as desert, which is not appropriate, while in new map it was classified as grasslands or shrubs with bare soil. Old map classified the Sahara desert as a bare soil and shrubs with bare soil, whereas in new map it was classified as bare ground. In addition to central Asia and the Sahara desert, in new vegetation map, Europe had more cropped area and India's vegetation cover was changed from crops and forests to wooded grassland and small areas of grassland and shrubs. The simulated surface air temperature with new map shows a significant improvement over Asia, South Africa, and northern America by some 1 to 2ºC and 2 to 3ºC over north east China and these are consistent with the reduced rainfall biases over Africa, near Somali coast, north east India, Bangladesh, east China sea, eastern Pacific and northern USA. Over Indian continent and bay of Bengal dry rainfall anomalies that is the only area showing large dry rainfall bias, however, they were unchanged with new map simulation. Overall the CFSv2(coupled with SSiB) model with new vegetation map show a promising result in improving the monsoon forecast by improving the Land -Atmosphere interactions. To compare with the LULC forcing, experiment was conducted using the Global Forecast System (GFS) simulations

  12. SKI's and SSI's review of SKB's safety report SR-Can

    Dverstorp, Bjoern; Stroemberg, Bo (and others)

    2008-03-15

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be

  13. Restorative justice and victimology

    The growth of restorative justice has sparked debate over the future of the criminal justice system, which has historically adopted a retributive, punitive philosophy and advocated for an individualistic, treatment-orientated approach. This approach has over time failed to address the needs of crime victims, communities and.

  14. Restoration of contaminated soils

    Miranda J, Jose Eduardo

    2009-01-01

    A great variety of techniques are used for the restoration of contaminated soils. The contamination is present by both organic and inorganic pollutants. Environmental conditions and soil characteristics should take into account in order to implement a remedial technique. The bioremediation technologies are showed as help to remove a variety of soil contaminants. (author) [es

  15. Restoration in South Africa

    Blignaut, J

    2010-01-01

    Full Text Available Restoration can provide a wide range of direct and indirect benefits to society. However, there are very few projects that have attempted to properly quantify those benefits and present them in such a way that society is motivated to invest...

  16. SSI 2D/3D soil structure interaction: A program system for the calculation of structure-soil interactions using the boundary element method. Project C1

    Schmid, G.; Willms, G.; Huh, Y.; Gibhardt, M.

    1988-12-01

    SSI 2D/3D is a computer programm to calculate dynamic stiffness matrices for soil-structure-interaction problems in frequency domain. It is applicable to two- or three-dimensional situations. The present report is a detailed manual for the use of the computer code written in FORTRAN 77. In addition it gives a survey of the possibilities of the Boundary Element Method applied to dynamic problems in infinite domains. (orig.) [de

  17. The systematic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho`s report for project RISCOM

    Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.

  18. Long-term competence restoration.

    Morris, Douglas R; DeYoung, Nathaniel J

    2014-01-01

    While the United States Supreme Court's Jackson v. Indiana decision and most state statutes mandate determinations of incompetent defendants' restoration probabilities, courts and forensic clinicians continue to lack empirical evidence to guide these determinations and do not yet have a consensus regarding whether and under what circumstances incompetent defendants are restorable. The evidence base concerning the restoration likelihood of those defendants who fail initial restoration efforts is even further diminished and has largely gone unstudied. In this study, we examined the disposition of a cohort of defendants who underwent long-term competence restoration efforts (greater than six months) and identified factors related to whether these defendants were able to attain restoration and adjudicative success. Approximately two-thirds (n = 52) of the 81 individuals undergoing extended restoration efforts were eventually deemed restored to competence. Lengths of hospitalization until successful restoration are presented with implications for the reasonable length of time that restoration efforts should persist. Older individuals were less likely to be restored and successfully adjudicated, and individuals with more severe charges and greater factual legal understanding were more likely to be restored and adjudicated. The significance of these findings for courts and forensic clinicians is discussed.

  19. Ecosystem Restoration: Fact or Fancy?

    John A. Stanturf; Callie J. Schweitzer; Stephen H. Schoenholtz; James P. Barnett; Charles K. McMahon; Donald J. Tomszak

    1998-01-01

    Ecological restoration is generally accepted as the reestablishment of natural ecological processes that produce certain dynamic ecosystem properties of structure, function, and processes. But restore to what? The most frequently used conceptual model for the restoration process is the shift of conditions from some current (degraded) dynamic state to some past dynamic...

  20. Ecological Restoration: Guidance from Theory

    Joy Zedler

    2005-09-01

    Full Text Available A review of the science and practice of ecosystem restoration led me to identify key ecological theories and concepts that are relevant to planning, implementing, and sustaining restoration efforts. From experience with actual restoration projects, I provide guidance for improving the restoration process. Despite an abundance of theory and guidance, restoration goals are not always achieved, and pathways toward targets are not highly predictable. This is understandable, since each restoration project has many constraints and unique challenges. To improve restoration progress, I advise that sites be designed as experiments to allow learning while doing. At least the larger projects can be restored in phases, each designed as experimental treatments to test alternative restoration approaches. Subsequent phases can then adopt one or more of the treatments that best achieved goals in earlier phases while applying new tests of other restoration measures. Both science and restoration can progress simultaneously. This phased, experimental approach (called “adaptive restoration” is an effective tool for improving restoration when monitoring, assessment, interpretation and research are integrated into the process.

  1. Ecological restoration: Biodiversity and conservation

    Vargas Rios, Orlando

    2011-01-01

    In this essay the principal concepts and methods applied on projects aimed at ecological restoration are reviewed, with emphasis on the relationship between conservation, biodiversity and restoration. The most common definitions are provided and the steps to take into account to develop projects on ecological restoration, which will be determined by the level of degradation of the ecosystem to be intervened.

  2. Clinical decisions for anterior restorations: the concept of restorative volume.

    Cardoso, Jorge André; Almeida, Paulo Júlio; Fischer, Alex; Phaxay, Somano Luang

    2012-12-01

    The choice of the most appropriate restoration for anterior teeth is often a difficult decision. Numerous clinical and technical factors play an important role in selecting the treatment option that best suits the patient and the restorative team. Experienced clinicians have developed decision processes that are often more complex than may seem. Less experienced professionals may find difficulties making treatment decisions because of the widely varied restorative materials available and often numerous similar products offered by different manufacturers. The authors reviewed available evidence and integrated their clinical experience to select relevant factors that could provide a logical and practical guideline for restorative decisions in anterior teeth. The presented concept of restorative volume is based on structural, optical, and periodontal factors. Each of these factors will influence the short- and long-term behavior of restorations in terms of esthetics, biology, and function. Despite the marked evolution of esthetic restorative techniques and materials, significant limitations still exist, which should be addressed by researchers. The presented guidelines must be regarded as a mere orientation for risk analysis. A comprehensive individual approach should always be the core of restorative esthetic treatments. The complex decision process for anterior esthetic restorations can be clarified by a systematized examination of structural, optical, and periodontal factors. The basis for the proposed thought process is the concept of restorative volume that is a contemporary interpretation of restoration categories and their application. © 2012 Wiley Periodicals, Inc.

  3. Restoring proximal caries lesions conservatively with tunnel restorations

    Chu CH

    2013-07-01

    Full Text Available Chun-Hung Chu1, May L Mei,1 Chloe Cheung,1 Romesh P Nalliah2 1Faculty of Dentistry, The University of Hong Kong, Hong Kong, People's Republic of China; 2Department of Restorative Dentistry and Biomaterials Sciences, Harvard School of Dental Medicine, Boston, MA, USA Abstract: The tunnel restoration has been suggested as a conservative alternative to the conventional box preparation for treating proximal caries. The main advantage of tunnel restoration over the conventional box or slot preparation includes being more conservative and increasing tooth integrity and strength by preserving the marginal ridge. However, tunnel restoration is technique-sensitive and can be particularly challenging for inexperienced restorative dentists. Recent advances in technology, such as the contemporary design of dental handpieces with advanced light-emitting diode (LED and handheld comfort, offer operative dentists better vision, illumination, and maneuverability. The use of magnifying loupes also enhances the visibility of the preparation. The advent of digital radiographic imaging has improved dental imaging and reduced radiation. The new generation of restorative materials has improved mechanical properties. Tunnel restoration can be an option to restore proximal caries if the dentist performs proper case selection and pays attention to the details of the restorative procedures. This paper describes the clinical technique of tunnel restoration and reviews the studies of tunnel restorations. Keywords: operative, practice, tunnel preparation, composite, amalgam, glass ionomer

  4. Restoration of longitudinal images.

    Hu, Y; Frieden, B R

    1988-01-15

    In this paper, a method of restoring longitudinal images is developed. By using the transfer function for longitudinal objects, and inverse filtering, a longitudinal image may be restored. The Fourier theory and sampling theorems for transverse images cannot be used directly in the longitudinal case. A modification and reasonable approximation are introduced. We have numerically established a necessary relationship between just-resolved longitudinal separation (after inverse filtering), noise level, and the taking conditions of object distance and lens diameter. An empirical formula is also found to well-fit the computed results. This formula may be of use for designing optical systems which are to image longitudinal details, such as in robotics or microscopy.

  5. Relativistic Linear Restoring Force

    Clark, D.; Franklin, J.; Mann, N.

    2012-01-01

    We consider two different forms for a relativistic version of a linear restoring force. The pair comes from taking Hooke's law to be the force appearing on the right-hand side of the relativistic expressions: d"p"/d"t" or d"p"/d["tau"]. Either formulation recovers Hooke's law in the non-relativistic limit. In addition to these two forces, we…

  6. A Hoseus Banjo Restoration

    Politzer, David

    2016-01-01

    Intrigued by the sound of another recently restored example, I attempted to bring a sadly abused, bottom-of-the-line, Hoseus-equipped banjo up to playable condition. Reminders, lessons learned, and the joy of (albeit crude) handiwork made it well- worth the purchase price. The actual sound and physics of the Hoseus contraption remain hidden in the complex interaction of the various parts, as demonstrated by the accompanying sound samples.

  7. The eligibility of the natural gas consumers

    2004-07-01

    The eligible consumers are allowed to chose freely their natural gas producers and negotiate the prices and the supply modalities. In this context this information paper presents the legislative and regulation framework of the natural gas consumers eligibility, a definition of the possible eligible consumers and a list at the 30 january 2004. It provides also recommendations and answers to the more often asked questions on the administrative procedures and the contracts. (A.L.B.)

  8. 7 CFR 623.4 - Eligible land.

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF... a fair market value that is less than the estimated costs of restoring the land to productive... restored on the land under a CRP contract, or under a Federal or State wetland restoration program with an...

  9. Setting standards of restorative justice

    Kostić Miomira

    2007-01-01

    Full Text Available In the article the author deals with the basic theoretical statements and discussions about the practical use of restorative justice. She discusses the questions of introducing and application of restorative justice in order to reach the balance of interests between a victim, society and a delinquent. There is no unique statement about the restorative justice concept, so the authors make this concept by listing certain activities with rispect of standards and principles. Also she emphasizes the values of restorative justice process. A part of the article is dedicated to the standards for restorative justice that are harmonized with the international documents of human rights. .

  10. An Assessment of the SST Simulation Using the Climate Forecast System Coupled to the SSiB Surface Model

    Wang, Y.; Xue, Y.; Huang, B.; Lee, J.; De Sales, F.

    2016-12-01

    A long term simulation has been conducted using the Climate Forecast System (CFSv2) coupled to the SSiB-2 land model, which consists of the Global Forecast System atmospheric model (GFS) and the Modular Ocean model - version 4 (MOM4) as the ocean component. This study evaluates the model's performance in simulating sea surface temperature (SST) mean state, trend, and inter-annual and decadal variabilities. The model is able to produce the reasonable spatial distribution of the SST climatology; however, it has prominent large scale biases. In the middle latitude of the Northern Hemisphere, major cold biases is close to the warm side of the large SST gradients, which may be associated with the weaker Kuroshio and Gulf Stream extensions that diffuse the SST gradient. IN addition, warm biases extend along the west coast of the North America continent to the high latitude, which may be related with excessive Ekman down-welling and solar radiation fluxes reaching to the surface due to the lack of cloud there. Warm biases also exist over the tropical cold tough areas in the Pacific and Atlantic. The global SST trend and interannual variations are well captured except for that in the south Hemisphere after year 2000, which is mainly contributed by the bias from the southern Pacific Ocean. Although the model fails to accurately produce ENSO events in proper years, it does reproduce the ENSO frequency well; they are skewed toward more warm events after 1990. The model also shows ability in SST decadal variation, such as the so-called inter-decadal Pacific oscillation (IPO); however, its phases seem to go reversely compared with the observation.

  11. Image restoration, uncertainty, and information.

    Yu, F T

    1969-01-01

    Some of the physical interpretations about image restoration are discussed. From the theory of information the unrealizability of an inverse filter can be explained by degradation of information, which is due to distortion on the recorded image. The image restoration is a time and space problem, which can be recognized from the theory of relativity (the problem of image restoration is related to Heisenberg's uncertainty principle in quantum mechanics). A detailed discussion of the relationship between information and energy is given. Two general results may be stated: (1) the restoration of the image from the distorted signal is possible only if it satisfies the detectability condition. However, the restored image, at the best, can only approach to the maximum allowable time criterion. (2) The restoration of an image by superimposing the distorted signal (due to smearing) is a physically unrealizable method. However, this restoration procedure may be achieved by the expenditure of an infinite amount of energy.

  12. Restoring proximal caries lesions conservatively with tunnel restorations.

    Chu, Chun-Hung; Mei, May L; Cheung, Chloe; Nalliah, Romesh P

    2013-07-30

    The tunnel restoration has been suggested as a conservative alternative to the conventional box preparation for treating proximal caries. The main advantage of tunnel restoration over the conventional box or slot preparation includes being more conservative and increasing tooth integrity and strength by preserving the marginal ridge. However, tunnel restoration is technique-sensitive and can be particularly challenging for inexperienced restorative dentists. Recent advances in technology, such as the contemporary design of dental handpieces with advanced light-emitting diode (LED) and handheld comfort, offer operative dentists better vision, illumination, and maneuverability. The use of magnifying loupes also enhances the visibility of the preparation. The advent of digital radiographic imaging has improved dental imaging and reduced radiation. The new generation of restorative materials has improved mechanical properties. Tunnel restoration can be an option to restore proximal caries if the dentist performs proper case selection and pays attention to the details of the restorative procedures. This paper describes the clinical technique of tunnel restoration and reviews the studies of tunnel restorations.

  13. 77 FR 12522 - Tentative Eligibility Determinations; Presumptive Eligibility for Psychosis and Other Mental Illness

    2012-03-01

    ...; Presumptive Eligibility for Psychosis and Other Mental Illness AGENCY: Department of Veterans Affairs. ACTION... psychosis within specified time periods and for Persian Gulf War veterans who developed a mental illness... eligibility determinations; Presumptive eligibility for psychosis and other mental illness.'' Copies of...

  14. River Restoration and Meanders

    G. Mathias Kondolf

    2006-12-01

    Full Text Available Among the most visually striking river restoration projects are those that involve the creation of a new channel, often in a new alignment and generally with a form and dimensions that are different from those of the preproject channel. These channel reconstruction projects often have the objective of creating a stable, single-thread, meandering channel, even on rivers that were not historically meandering, on rivers whose sediment load and flow regime would not be consistent with such stable channels, or on already sinuous channels whose bends are not symmetrical. Such meandering channels are often specified by the Rosgen classification system, a popular restoration design approach. Although most projects of this type have not been subject to objective evaluation, completed postproject appraisals show that many of these projects failed within months or years of construction. Despite its, at best, mixed results, this classification and form-based approach continues to be popular because it is easy to apply, because it is accessible to those without formal training in fluvial geomorphology, and probably because it satisfies a deep-seated, although unrecognized, cultural preference for single-thread meandering channels. This preference is consistent with 18th-century English landscape theories, which held the serpentine form to be ideal and led to widespread construction of meandering channels on the country estates of the era. The preference for stability in restored channels seems to be widely accepted by practitioners and funders despite the fact that it is antithetical to research showing that dynamically migrating channels have the greatest ecological richness.

  15. Baseline restoration using current conveyors

    Morgado, A.M.L.S.; Simoes, J.B.; Correia, C.M.

    1996-01-01

    A good performance of high resolution nuclear spectrometry systems, at high pulse rates, demands restoration of baseline between pulses, in order to remove rate dependent baseline shifts. This restoration is performed by circuits named baseline restorers (BLRs) which also remove low frequency noise, such as power supply hum and detector microphonics. This paper presents simple circuits for baseline restoration based on a commercial current conveyor (CCII01). Tests were performed, on two circuits, with periodic trapezoidal shaped pulses in order to measure the baseline restoration for several pulse rates and restorer duty cycles. For the current conveyor based Robinson restorer, the peak shift was less than 10 mV, for duty cycles up to 60%, at high pulse rates. Duty cycles up to 80% were also tested, being the maximum peak shift 21 mV. The peak shift for the current conveyor based Grubic restorer was also measured. The maximum value found was 30 mV at 82% duty cycle. Keeping the duty cycle below 60% improves greatly the restorer performance. The ability of both baseline restorer architectures to reject low frequency modulation is also measured, with good results on both circuits

  16. 10 CFR 455.71 - Eligibility.

    2010-01-01

    ... ENERGY ENERGY CONSERVATION GRANT PROGRAMS FOR SCHOOLS AND HOSPITALS AND BUILDINGS OWNED BY UNITS OF LOCAL GOVERNMENT AND PUBLIC CARE INSTITUTIONS Energy Conservation Measures for Schools and Hospitals § 455.71 Eligibility. (a) To be eligible to receive financial assistance for an energy conservation measure, including...

  17. 10 CFR 455.81 - Eligibility.

    2010-01-01

    ... ENERGY ENERGY CONSERVATION GRANT PROGRAMS FOR SCHOOLS AND HOSPITALS AND BUILDINGS OWNED BY UNITS OF LOCAL GOVERNMENT AND PUBLIC CARE INSTITUTIONS State Administrative Expenses § 455.81 Eligibility. To be eligible to receive financial assistance for administrative expenses, a State must: (a) Have in place a State Plan...

  18. 7 CFR 4280.122 - Project eligibility.

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Project eligibility. 4280.122 Section 4280.122 Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND... Efficiency Improvements Program Section B. Guaranteed Loans § 4280.122 Project eligibility. For a project to...

  19. 12 CFR 618.8005 - Eligibility.

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Eligibility. 618.8005 Section 618.8005 Banks and Banking FARM CREDIT ADMINISTRATION FARM CREDIT SYSTEM GENERAL PROVISIONS Related Services § 618.8005 Eligibility. (a) Farm Credit Banks and associations may offer related services appropriate to on...

  20. 7 CFR 249.6 - Participant eligibility.

    2010-01-01

    ... participation in the SFMNP in a language other than English, reasonable steps must be taken to provide this... have provided for my eligibility determination is correct, to the best of my knowledge. This... solely because of lack of sufficient funding to provide SFMNP benefits to all eligible applicants. (5...

  1. 28 CFR 104.32 - Eligibility review.

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Eligibility review. 104.32 Section 104.32 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) SEPTEMBER 11TH VICTIM COMPENSATION FUND OF 2001 Claim Intake, Assistance, and Review Procedures § 104.32 Eligibility review. Any claimant deemed...

  2. 29 CFR 825.110 - Eligible employee.

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Eligible employee. 825.110 Section 825.110 Labor... employee. (a) An “eligible employee” is an employee of a covered employer who: (1) Has been employed by the... worksite where 50 or more employees are employed by the employer within 75 miles of that worksite. (See...

  3. 7 CFR 1499.3 - Eligibility determination.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligibility determination. 1499.3 Section 1499.3 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... determination. (a) An entity will be eligible to become a participant only after FAS determines that the entity...

  4. 47 CFR 54.601 - Eligibility.

    2010-10-01

    ... teaching hospital or medical school; (ii) Community health center or health center providing health care to migrants; (iii) Local health department or agency; (iv) Community mental health center; (v) Not-for-profit... eligible health care providers; with schools, libraries, and library consortia eligible under Subpart F...

  5. 36 CFR 64.5 - Eligible projects.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Eligible projects. 64.5... Eligible projects. (a) Abandoned railroad projects will be for recreation and/or conservation purposes including the acquisition of the rights-of-way involved and will be sponsored by a project applicant who has...

  6. 23 CFR 650.703 - Eligible projects.

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 650.703 Section 650.703 Highways..., STRUCTURES, AND HYDRAULICS Discretionary Bridge Candidate Rating Factor § 650.703 Eligible projects. (a..., provided that the total project cost for a discretionary bridge candidate is at least $10 million or twice...

  7. 23 CFR 810.102 - Eligible projects.

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...

  8. 28 CFR 92.13 - Program eligibility.

    2010-07-01

    ... (COPS) Police Recruitment Program Guidelines § 92.13 Program eligibility. (a) Eligible organizations for the Police Recruitment program grant are certified nonprofit organizations that have training and/or... encounter problems throughout the application process; and (4) The program provides retention services to...

  9. 10 CFR 455.91 - Eligibility.

    2010-01-01

    ... Marketing § 455.91 Eligibility. To be eligible to receive financial assistance for technical assistance, program assistance, and marketing, a State must: (a) Have in place a State Plan approved by DOE which... assistance, and marketing, pursuant to § 455.20(j)(1); (b) Have established a program consistent with this...

  10. 24 CFR 954.102 - Eligible applicants.

    2010-04-01

    ... eligible recipient under Title I of the Indian Self-Determination and Education Assistance Act (25 U.S.C. 450). Eligible recipients under the Indian Self-Determination and Education Assistance Act are... Indian Self-Determination and Education Assistance Act may apply for funds on behalf of any Indian Tribe...

  11. 12 CFR 1805.301 - Eligible activities.

    2010-01-01

    ... Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS PROGRAM Use of Funds/Eligible Activities § 1805.301 Eligible... liquidity, or other means of finance: (a) Commercial facilities that promote revitalization, community...

  12. 30 CFR 875.20 - Contractor eligibility.

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Contractor eligibility. 875.20 Section 875.20 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR ABANDONED MINE LAND RECLAMATION CERTIFICATION AND NONCOAL RECLAMATION § 875.20 Contractor eligibility. Every...

  13. 30 CFR 874.16 - Contractor eligibility.

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Contractor eligibility. 874.16 Section 874.16 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR ABANDONED MINE LAND RECLAMATION GENERAL RECLAMATION REQUIREMENTS § 874.16 Contractor eligibility. To receive...

  14. 7 CFR 1786.99 - Eligibility criteria.

    2010-01-01

    ... Eligibility criteria. To be eligible to prepay RUS Notes at the Discounted Present Value, a borrower must... the RUS Notes between the amount outstanding on the RUS Note and the Discounted Present Value of the... a substantial portion of its assets, whether now owned or hereafter acquired. Notwithstanding the...

  15. 7 CFR 1434.4 - Eligible producer.

    2010-01-01

    ... of the loan; (4) Store the honey pledged as loan collateral in eligible storage and in eligible... paragraph (a) of this section, who enters into a contract to sell the honey used as collateral for a loan... are tendering for a loan; and (2) The commingled honey is not used as collateral for an individual...

  16. 5 CFR 330.704 - Eligibility.

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Interagency Career Transition Assistance Plan for Displaced Employees § 330.704 Eligibility. (a) To be eligible for the special selection priority, an individual must meet all of the...

  17. Restoring proximal caries lesions conservatively with tunnel restorations

    Chu, Chun-Hung; Cheung,; Nalliah,Romesh; Mei,May L

    2013-01-01

    Chun-Hung Chu1, May L Mei,1 Chloe Cheung,1 Romesh P Nalliah2 1Faculty of Dentistry, The University of Hong Kong, Hong Kong, People's Republic of China; 2Department of Restorative Dentistry and Biomaterials Sciences, Harvard School of Dental Medicine, Boston, MA, USA Abstract: The tunnel restoration has been suggested as a conservative alternative to the conventional box preparation for treating proximal caries. The main advantage of tunnel restoration over the conventional box or slo...

  18. 38 CFR 21.3041 - Periods of eligibility; child.

    2010-07-01

    ...; child. 21.3041 Section 21.3041 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS... 38 U.S.C. Chapter 35 Eligibility and Entitlement § 21.3041 Periods of eligibility; child. (a) Eligibility derived from a veteran with a P&T disability. An eligible child's period of eligibility generally...

  19. Soil Surface Runoff Scheme for Improving Land-Hydrology and Surface Fluxes in Simple SiB (SSiB)

    Sud, Y. C.; Mocko, David M.

    1999-01-01

    Evapotranspiration on land is hard to measure and difficult to simulate. On the scale of a GCM grid, there is large subgrid-scale variability of orography, soil moisture, and vegetation. Our hope is to be able to tune the biophysical constants of vegetation and soil parameters to get the most realistic space-averaged diurnal cycle of evaporation and its climatology. Field experiments such as First ISLSCP Field Experiment (FIFE), Boreal Ecosystem-Atmosphere Study (BOREAS), and LBA help a great deal in improving our evapotranspiration schemes. However, these improvements have to be matched with, and coupled to, consistent improvement in land-hydrology; otherwise, the runoff problems will intrinsically reflect on the soil moisture and evapotranspiration errors. Indeed, a realistic runoff simulation also ensures a reasonable evapotranspiration simulation provided the precipitation forcing is reliable. We have been working on all of the above problems to improve the simulated hydrologic cycle. Through our participation in the evaluation and intercomparison of land-models under the behest of Global Soil Wetness Project (GSWP), we identified a few problems with Simple SiB (SSIB; Xue et al., 1991) hydrology in regions of significant snowmelt. Sud and Mocko (1999) show that inclusion of a separate snowpack model, with its own energy budget and fluxes with the atmosphere aloft and soil beneath, helps to ameliorate some of the deficiencies of delayed snowmelt and excessive spring season runoff. Thus, much more realistic timing of melt water generation was simulated with the new snowpack model in the subsequent GSWP re-evaluations using 2 years of ISLSCP Initiative I forcing data for 1987 and 1988. However, we noted an overcorrection of the low meltwater infiltration of SSiB. While the improvement in snowmelt timing was found everywhere, the snowmelt infiltration has became excessive in some regions, e.g., Lena river basin. This leads to much reduced runoff in many basins as

  20. Predictable repair of provisional restorations.

    Hammond, Barry D; Cooper, Jeril R; Lazarchik, David A

    2009-01-01

    The importance of provisional restorations is often downplayed, as they are thought of by some as only "temporaries." As a result, a less-than-ideal provisional is sometimes fabricated, in part because of the additional chair time required to make provisional modifications when using traditional techniques. Additionally, in many dental practices, these provisional restorations are often fabricated by auxillary personnel who may not be as well trained in the fabrication process. Because provisionals play an important role in achieving the desired final functional and esthetic result, a high-quality provisional restoration is essential to fabricating a successful definitive restoration. This article describes a method for efficiently and predictably repairing both methacrylate and bis-acryl provisional restorations using flowable composite resin. By use of this relatively simple technique, provisional restorations can now be modified or repaired in a timely and productive manner to yield an exceptional result. Successful execution of esthetic and restorative dentistry requires attention to detail in every aspect of the case. Fabrication of high-quality provisional restorations can, at times, be challenging and time consuming. The techniques for optimizing resin provisional restorations as described in this paper are pragmatic and will enhance the delivery of dental treatment.

  1. Technologies for lake restoration

    Helmut KLAPPER

    2003-09-01

    Full Text Available Lakes are suffering from different stress factors and need to be restored using different approaches. The eutrophication remains as the main water quality management problem for inland waters: both lakes and reservoirs. The way to curb the degradation is to stop the nutrient sources and to accelerate the restoration with help of in-lake technologies. Especially lakes with a long retention time need (eco- technological help to decrease the nutrient content in the free water. The microbial and other organic matter from sewage and other autochthonous biomasses, causes oxygen depletion, which has many adverse effects. In less developed countries big reservoirs function as sewage treatment plants. Natural aeration solves problems only partly and many pollutants tend to accumulate in the sediments. The acidification by acid rain and by pyrite oxidation has to be controlled by acid neutralizing technologies. Addition of alkaline chemicals is useful only for soft waters, and technologies for (microbial alkalinization of very acidic hardwater mining lakes are in development. The corrective measures differ from those in use for eutrophication control. The salinization and water shortage mostly occurs if more water is used than available. L. Aral, L. Tschad, the Dead Sea or L. Nasser belong to waters with most severe environmental problems on a global scale. Their hydrologic regime needs to be evaluated. The inflow of salt water at the bottom of some mining lakes adds to stability of stratification, and thus accumulation of hydrogen sulphide in the monimolimnion of the meromictic lakes. Destratification, which is the most used technology, is only restricted applicable because of the dangerous concentrations of the byproducts of biological degradation. The contamination of lakes with hazardous substances from industry and agriculture require different restoration technologies, including subhydric isolation and storage, addition of nutrients for better self

  2. Restoration of harvested peatlands

    Saarmets, Tiit

    1999-01-01

    A short analysis of the main topics of the IPS Symposium Peatland Restoration and Reclamation, Duluth, Minnesota, USA, 1998 is given. It has been single-mindedly recommended in Estonia so far that harvested peatland surfaces should be levelled and outflows shut. But following these recommendations will lead to an unfounded formation of marshy areas with a very low growth of plants. The reclamation of harvested peatlands for agricultural purposes is expensive and there is no commercial need for agricultural land in today's Estonia now. In the author's opinion the foreflows and intermediate ditches should be left open which would favour the growth of the brushwood to grow later into the forest of commercial value. (author)

  3. Restorative Justice in Children.

    Riedl, Katrin; Jensen, Keith; Call, Josep; Tomasello, Michael

    2015-06-29

    An important, and perhaps uniquely human, mechanism for maintaining cooperation against free riders is third-party punishment. Our closest living relatives, chimpanzees, will not punish third parties even though they will do so when personally affected. Until recently, little attention has been paid to how punishment and a sense of justice develop in children. Children respond to norm violations. They are more likely to share with a puppet that helped another individual as opposed to one who behaved harmfully, and they show a preference for seeing a harmful doll rather than a victim punished. By 6 years of age, children will pay a cost to punish fictional and real peers, and the threat of punishment will lead preschoolers to behave more generously. However, little is known about what motivates a sense of justice in children. We gave 3- and 5-year-old children--the youngest ages yet tested--the opportunity to remove items and prevent a puppet from gaining a reward for second- and third-party violations (experiment 1), and we gave 3-year-olds the opportunity to restore items (experiment 2). Children were as likely to engage in third-party interventions as they were when personally affected, yet they did not discriminate among the different sources of harm for the victim. When given a range of options, 3-year-olds chose restoration over removal. It appears that a sense of justice centered on harm caused to victims emerges early in childhood and highlights the value of third-party interventions for human cooperation. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Social welfare and restorative justice

    Fox, Darrell

    2009-01-01

    "This paper explores the links and connections between social work and restorative justice. After a brief description of social work, restorative justice and family group conferencing, I will explore some the complementary theoretical links and practice applications, critically examining the potential implications and opportunities for social work practitioners and academics in relation to practice." [author's abstract

  5. Forest restoration is forward thinking

    R. Kasten Dumroese; Brian J. Palik; John A. Stanturf

    2015-01-01

    It is not surprising to us that the topic of forest restoration is being discussed in the Journal of Forestry. It is a topic frequently bantered about in the literature; a quick search in Google Scholar for "forest restoration" generates more than 1 million hits. A significant portion of the debate centers on the search for succinct, holistic, universally...

  6. [Posterior ceramic bonded partial restorations].

    Mainjot, Amélie; Vanheusden, Alain

    2006-01-01

    Posterior ceramic bonded partial restorations are conservative and esthetic approaches for compromised teeth. Overlays constitute a less invasive alternative for tooth tissues than crown preparations. With inlays and onlays they are also indicated in case of full arch or quadrant rehabilitations including several teeth. This article screens indications and realization of this type of restorations.

  7. Prescribed burning for understory restoration

    Kenneth W. Outcalt

    2006-01-01

    Because the longleaf ecosystem evolved with and is adapted to frequent fire, every 2 to 8 years, prescribed burning is often useful for restoring understory communities to a diverse ground layer of grasses, herbs, and small shrubs. This restoration provides habitat for a number of plant and animal species that are restricted to or found mostly in longleaf pine...

  8. Bathyodontus mirus (Andrássy, 1956, first record of a representative of the suborder Bathyodontina (Nematoda, Mononchida in the Iberian fauna

    Peña-Santiago, R.

    2010-12-01

    Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.

  9. 7 CFR 764.302 - Eligibility requirements.

    2010-01-01

    ... AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN MAKING Youth Loan Program § 764.302 Eligibility requirements. The... the loan is closed; (d) Must reside in a rural area, city or town with a population of 50,000 or fewer...

  10. 47 CFR 95.5 - Licensee eligibility.

    2010-10-01

    ... SERVICES General Mobile Radio Service (GMRS) § 95.5 Licensee eligibility. (a) An individual (one man or one... entity other than an individual) is ineligible to obtain a new GMRS system license or make a major...

  11. 47 CFR 90.1203 - Eligibility.

    2010-10-01

    ... are eligible to hold a Commission license for systems operating in the 4940-4990 MHz band. All of the... MOBILE RADIO SERVICES Regulations Governing Licensing and Use of Frequencies in the 4940-4990 MHz Band...

  12. 7 CFR 1709.106 - Eligible applicants.

    2010-01-01

    ...), cooperatives, trusts, and sole proprietorships. (c) Eligible government applicants include State and local... and not be for the sole benefit of the individual applicant or an individual household. (f) As a...

  13. 23 CFR 656.5 - Eligibility.

    2010-04-01

    .... Eligible costs for such systems may include costs of use or rental of computer hardware, costs of software... the vanpool concept among employees, employers, and other groups by allowing potential riders and...

  14. Presumptive Eligibility for Medicaid and CHIP Coverage

    U.S. Department of Health & Human Services — Health care providers and Head Start programs can play a major role in finding and enrolling uninsured children through presumptive eligibility. States can authorize...

  15. 7 CFR 3430.203 - Eligibility.

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) COOPERATIVE STATE RESEARCH, EDUCATION, AND EXTENSION..., national laboratories; colleges and universities (offering associate's or higher degrees); research...-GENERAL AWARD ADMINISTRATIVE PROVISIONS Specialty Crop Research Initiative § 3430.203 Eligibility...

  16. 49 CFR 256.5 - Eligibility.

    2010-10-01

    ... reasonable opportunity to review and comment upon the project as it affects property listed or eligible for... passenger terminal, features which appear reasonably likely to attract private investors willing to finance...

  17. Dual Eligibles and Potentially Avoidable Hospitalizations

    U.S. Department of Health & Human Services — About 25 percent of the hospitalizations for dual eligible beneficiaries in 2005 were potentially avoidable. Medicare and Medicaid spending for those potentially...

  18. 32 CFR 203.10 - Eligible activities.

    2010-07-01

    ... documents. The installation restoration program documents each stage of investigation and decision-making...) MISCELLANEOUS TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION... public's ability to provide advice to decision-makers by improving the public's understanding of overall...

  19. "I Was Dead Restorative Today": From Restorative Justice to Restorative Approaches in School

    McCluskey, G.; Lloyd, G.; Stead, J.; Kane, J.; Riddell, S.; Weedon, E.

    2008-01-01

    This paper explores definitions and understandings of restorative practices in education. It offers a critique of current theoretical models of restorative justice originally derived from the criminal justice system and now becoming popular in educational settings. It questions the appropriateness of these concepts as they are being introduced to…

  20. Provisional Restorations – A Permanent Problem?

    Keys, William F; Keirby, Naomi; Ricketts, David N J

    2016-12-01

    Provisional restorations play an important role when providing indirect restorations. There are a number of materials and techniques available for their construction. Careful planning and construction can protect the prepared tooth surface, improve the periodontal condition and help plan for the definitive restoration. A good provisional restoration can save time, money and effort. Clinical relevance: Provisional restoration construction is an integral part of the indirect restorative process for inlays, onlays, crowns and bridges.

  1. Fernald restoration: ecologists and engineers integrate restoration and cleanup

    Woods, Eric; Homer, John

    2002-07-15

    As cleanup workers excavate pits and tear down buildings at the Fernald site in southwest Ohio, site ecologists are working side-by-side to create thriving wetlands and develop the early stages of forest, prairie, and savanna ecosystems to restore natural resources that were impacted by years of site operations. In 1998, the U.S. Department of Energy-Fernald Office (DOE-FN) and its cleanup contractor, Fluor Fernald, Inc., initiated several ecological restoration projects in perimeter areas of the site (e.g., areas not used for or impacted by uranium processing or waste management). The projects are part of Fernald's final land use plan to restore natural resources over 904 acres of the 1,050-acre site. Pete Yerace, the DOE-FN Natural Resource Trustee representative is working with the Fernald Natural Resource Trustees in an oversight role to resolve the state of Ohio's 1986 claim against DOE for injuries to natural resources. Fluor Fernald, Inc., and DOE-FN developed the ''Natural Resource Restoration Plan'', which outlines 15 major restoration projects for the site and will restore injured natural resources at the site. In general, Fernald's plan includes grading to maximize the formation of wetlands or expanded floodplain, amending soil where topsoil has been removed during excavation, and establishing native vegetation throughout the site. Today, with cleanup over 35 percent complete and site closure targeted for 2006, Fernald is entering a new phase of restoration that involves heavily remediated areas. By working closely with engineers and cleanup crews, site ecologists can take advantage of remediation fieldwork (e.g., convert an excavated depression into a wetland) and avoid unnecessary costs and duplication. This collaboration has also created opportunities for relatively simple and inexpensive restoration of areas that were discovered during ongoing remediation. To ensure the survival of the plant material in heavily

  2. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable that SKB have

  3. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    NONE

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable

  4. VT River Restoration Data in Lamoille County

    Vermont Center for Geographic Information — (Link to Metadata) Documented river and riparian buffer restoration projects in Lamoille County, Vermont. Restoration includes buffer plantings (trees and shrubs),...

  5. 7 CFR 760.303 - Eligible livestock producer.

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligible livestock producer. 760.303 Section 760.303... AGRICULTURE SPECIAL PROGRAMS INDEMNITY PAYMENT PROGRAMS Livestock Forage Disaster Program § 760.303 Eligible livestock producer. (a) To be considered an eligible livestock producer, the eligible producer on a farm...

  6. 40 CFR 35.133 - Programs eligible for inclusion.

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Programs eligible for inclusion. 35.133... Programs eligible for inclusion. (a) Eligible programs. Except as provided in paragraph (b) of this section, the environmental programs eligible, in accordance with appropriation acts, for inclusion in a...

  7. 40 CFR 35.533 - Programs eligible for inclusion.

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Programs eligible for inclusion. 35.533... § 35.533 Programs eligible for inclusion. (a) Eligible programs. Except as provided in paragraph (b) of this section, the environmental programs eligible for inclusion in a Performance Partnership Grant are...

  8. Atraumatic restorative treatment versus conventional restorative treatment for managing dental caries.

    Dorri, Mojtaba; Martinez-Zapata, Maria José; Walsh, Tanya; Marinho, Valeria Cc; Sheiham Deceased, Aubrey; Zaror, Carlos

    2017-12-28

    Trials.gov) and the World Health Organization International Clinical Trials Registry Platform were searched for ongoing trials. No restrictions were placed on the language or date of publication when searching the electronic databases. We included randomised controlled trials (RCTs) with at least six months' follow-up that compared the effects of ART with a conventional restorative approach using the same or different restorative dental materials to treat caries lesions. Two review authors independently screened search results, extracted data from included studies and assessed the risk of bias in those studies. We used standard methodological procedures expected by Cochrane to evaluate risk of bias and synthesise data. Where pooling was appropriate we conducted meta-analyses using the random-effects model. We assessed the quality of the evidence using GRADE criteria. We included a total of 15 eligible studies randomising 3760 participants in this review. The age of participants across the studies ranged from 3 to 101 years, with a mean of 25.42 years. 48% of participants were male. All included studies were published between 2002 and 2016. Two of the 15 studies declared that the financial support was from companies that manufacture restorative material. Five studies were individually randomised parallel-group studies; six were cluster-randomised parallel-group studies; and four were randomised studies that used a split-mouth design. Eleven studies evaluated the effects of ART on primary teeth only, and four on permanent teeth. The follow-up period of the included studies ranged from 6 months to 36 months. We judged all studies to be at high risk of bias.For the main comparison of ART compared to conventional treatment using the same material: all but two studies used high-viscosity glass ionomer (H-GIC) as the restorative material; one study used a composite material; and one study used resin-modified glass ionomer cement (RM-GIC)).Compared to conventional treatment using H

  9. Basic research for environmental restoration

    1990-12-01

    The Department of Energy (DOE) is in the midst of a major environmental restoration effort to reduce the health and environmental risks resulting from past waste management and disposal practices at DOE sites. This report describes research needs in environmental restoration and complements a previously published document, DOE/ER-0419, Evaluation of Mid-to-Long Term Basic Research for Environmental Restoration. Basic research needs have been grouped into five major categories patterned after those identified in DOE/ER-0419: (1) environmental transport and transformations; (2) advanced sampling, characterization, and monitoring methods; (3) new remediation technologies; (4) performance assessment; and (5) health and environmental effects. In addition to basic research, this document deals with education and training needs for environmental restoration. 2 figs., 6 tabs

  10. Wetlands Restoration Definitions and Distinctions

    Ecological restoration is a valuable endeavor that has proven very difficult to define. The term indicates that degraded and destroyed natural wetland systems will be reestablished to sites where they once existed. But, what wetland ecosystems are we talki

  11. Basic research for environmental restoration

    1990-12-01

    The Department of Energy (DOE) is in the midst of a major environmental restoration effort to reduce the health and environmental risks resulting from past waste management and disposal practices at DOE sites. This report describes research needs in environmental restoration and complements a previously published document, DOE/ER-0419, Evaluation of Mid-to-Long Term Basic Research for Environmental Restoration. Basic research needs have been grouped into five major categories patterned after those identified in DOE/ER-0419: (1) environmental transport and transformations; (2) advanced sampling, characterization, and monitoring methods; (3) new remediation technologies; (4) performance assessment; and (5) health and environmental effects. In addition to basic research, this document deals with education and training needs for environmental restoration. 2 figs., 6 tabs.

  12. Restorative justice innovations in Canada.

    Wilson, Robin J; Huculak, Bria; McWhinnie, Andrew

    2002-01-01

    As many jurisdictions move towards more retributive measures as a means to address public discontent with crime, a parallel movement has developed in regard to restorative justice. This article presents three restorative initiatives currently in use in Canada. Each initiative addresses offender behavior and community engagement at a different point in the justice continuum. The use of Sentencing Circles is an example of how restorative justice principles can be instituted at the front end, prior to an offender becoming lodged in the system. The Restorative Justice Options to Parole Suspension project demonstrates how community engagement can assist in preventing offenders from being returned to the system once they have achieved conditional release. The Circles of Support and Accountability project has enlisted the support of professionally supported volunteers in the community reintegration of high-risk sexual offenders. These initiatives are presented within a framework of effective correctional interventions and increased empowerment for a variety of stakeholders. Copyright 2002 John Wiley & Sons, Ltd.

  13. Wetland Restoration and Sediment Removal

    Department of the Interior — In 2008, Minnesota’s Private Lands Program and Wetland Management Districts began to compare different methods of restoring prairie pothole wetlands to see if there...

  14. 20 CFR 638.300 - Eligibility for funds and eligible deliverers.

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Eligibility for funds and eligible deliverers. 638.300 Section 638.300 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR JOB CORPS PROGRAM UNDER TITLE IV-B OF THE JOB TRAINING PARTNERSHIP ACT Funding, Site Selection...

  15. Methodology for ranking restoration options

    Jensen, Per Hedemann

    1999-01-01

    techniques as a function of contamination and site characteristics. The project includes analyses of existing remediation methodologies and contaminated sites, and is structured in the following steps:-characterisation of relevant contaminated sites -identication and characterisation of relevant restoration...... techniques -assessment of the radiological impact -development and application of a selection methodology for restoration options -formulation ofgeneric conclusions and development of a manual The project is intended to apply to situations in which sites with nuclear installations have been contaminated...

  16. Urbanistid ja keskkonnaeksperdid: iga muudatuse eest Reidi tee projektis oleme pidanud võitlema / Helen Sooväli-Sepping, Kristi Grišakov, Mari Jüssi ; intervjueerinud Mari Peegel ; kommenteerinud Taavi Aas

    Sooväli-Sepping, Helen, 1974-

    2016-01-01

    TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik

  17. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    Shulan Xu; Dverstorp, Bjoern; Woerman, Anders; Marklund, Lars; Klos, Richard; Shaw, George

    2008-03-01

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB investigation

  18. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    Shulan Xu; Dverstorp, Bjoern (Swedish Radiation Protection Authority, Stockholm (Sweden)); Woerman, Anders; Marklund, Lars (Royal Institute of Technology (KTH), Stockholm (SE)); Klos, Richard (Aleksandria Sciences, Sheffield (GB)); Shaw, George (Univ. of Nottingham (GB))

    2008-03-15

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB

  19. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    2008-03-15

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  20. Oak restoration trials: Santa Catalina Island

    Lisa Stratton

    2002-01-01

    Two restoration trials involving four oak species have been implemented as part of a larger restoration program for Catalina Island. In 1997 the Catalina Island Conservancy began an active program of restoration after 50 years of ranching and farming activities on the island. The restoration program includes removing feral goats and pigs island-wide and converting 80...

  1. Restorative outcomes for endodontically treated teeth in the Practitioners Engaged in Applied Research and Learning network.

    Spielman, Howard; Schaffer, Scott B; Cohen, Mitchell G; Wu, Hongyu; Vena, Donald A; Collie, Damon; Curro, Frederick A; Thompson, Van P; Craig, Ronald G

    2012-07-01

    The authors aimed to determine the outcome of and factors associated with success and failure of restorations in endodontically treated teeth in patients in practices participating in the Practitioners Engaged in Applied Research and Learning (PEARL) Network. Practitioner-investigators (P-Is) invited the enrollment of all patients seeking care at participating practices who had undergone primary endodontic therapy and restoration in a permanent tooth three to five years earlier. P-Is classified endodontically reated teeth as restorative failures if the restoration was replaced, the restoration needed replacement or the tooth was cracked or fractured. P-Is from 64 practices enrolled in the study 1,298 eligible patients who had endodontically treated teeth that had been restored. The mean (standard deviation) time to follow-up was 3.9 (0.6) years. Of the 1,298 enrolled teeth, P-Is classified 181 (13.9 percent; 95 percent confidence interval [CI], 12.1-15.8 percent) as restorative failures: 44 (3.4 percent) due to cracks or fractures, 57 (4.4 percent) due to replacement of the original restoration for reasons other than fracture and 80 (6.2 percent) due to need for a new restoration. When analyzing the results by means of multivariate logistic regression, the authors found a greater risk of restorative failure to be associated with canines or incisors and premolars (P = .04), intracoronal restorations (P < .01), lack of preoperative proximal contacts (P < .01), presence of periodontal connective-tissue attachment loss (P < .01), younger age (P = .01), Hispanic/Latino ethnicity (P = .04) and endodontic therapy not having been performed by a specialist (P = .04). These results suggest that molars (as opposed to other types of teeth), full-coverage restorations, preoperative proximal contacts, good periodontal health, non-Hispanic/Latino ethnicity, endodontic therapy performed by a specialist and older patient age are associated with restorative success for

  2. Technical approach to groundwater restoration

    1993-01-01

    The Technical Approach to Groundwater Restoration (TAGR) provides general technical guidance to implement the groundwater restoration phase of the Uranium Mill Tailings Remedial Action (UMTRA) Project. The TAGR includes a brief overview of the surface remediation and groundwater restoration phases of the UMTRA Project and describes the regulatory requirements, the National Environmental Policy Act (NEPA) process, and regulatory compliance. A section on program strategy discusses program optimization, the role of risk assessment, the observational approach, strategies for meeting groundwater cleanup standards, and remedial action decision-making. A section on data requirements for groundwater restoration evaluates the data quality objectives (DQO) and minimum data required to implement the options and comply with the standards. A section on sits implementation explores the development of a conceptual site model, approaches to site characterization, development of remedial action alternatives, selection of the groundwater restoration method, and remedial design and implementation in the context of site-specific documentation in the site observational work plan (SOWP) and the remedial action plan (RAP). Finally, the TAGR elaborates on groundwater monitoring necessary to evaluate compliance with the groundwater cleanup standards and protection of human health and the environment, and outlines licensing procedures

  3. 13 CFR 500.201 - Eligible Lender.

    2010-01-01

    ...: (1) The Lender's level of regulatory capital, in the case of banking institutions, or net worth, in... eligible to apply to the Board for a Guarantee of a loan must be: (1) A banking institution, such as a commercial bank or trust company, subject to regulation by the Federal banking agencies enumerated in 12 U.S...

  4. 34 CFR 668.8 - Eligible program.

    2010-07-01

    ... current valid certification from the Federal Aviation Administration. (j) English as a second language... of Social Security taxes. (h) Eligibility for Federal Pell Grant, ACG, National SMART Grant, TEACH... purposes of the TEACH Grant program if it satisfies the requirements of the definition of TEACH Grant...

  5. 42 CFR 86.11 - Eligibility.

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Eligibility. 86.11 Section 86.11 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES GRANTS FOR EDUCATION PROGRAMS IN OCCUPATIONAL SAFETY AND HEALTH Occupational Safety and Health Training Grants § 86.11...

  6. 5 CFR 844.103 - Eligibility.

    2010-01-01

    ... not disabled for the position in question to the Merit Systems Protection Board under 5 U.S.C. 7701... EMPLOYEES' RETIREMENT SYSTEM-DISABILITY RETIREMENT General Provisions § 844.103 Eligibility. (a) Except as..., resulting in a deficiency in performance, conduct, or attendance, or if there is no such deficiency, the...

  7. 28 CFR 74.3 - Eligibility determinations.

    2010-07-01

    ... Residence” card with the Wartime Civil Control Administration; or (3) Individuals ordered by the Navy to... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Eligibility determinations. 74.3 Section 74.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) CIVIL LIBERTIES ACT REDRESS PROVISION...

  8. 75 FR 68704 - Suspension of Community Eligibility

    2010-11-09

    ... DEPARTMENT OF HOMELAND SECURITY Federal Emergency Management Agency 44 CFR Part 64 [Docket ID FEMA-2010-0003; Internal Agency Docket No. FEMA-8155] Suspension of Community Eligibility AGENCY: Federal.... Acadia Parish. Emerg; February 4, 1981, Reg; November 26, 2010, Susp. Iota, Town of, Acadia 220005...

  9. 7 CFR 3411.3 - Eligibility requirements.

    2010-01-01

    ... universities and colleges for receiving Federal funds for science and engineering research as specified in the... for science and engineering research as specified in the annual program solicitation or must be from... control of all funds, property, and other assets; and (5) Otherwise qualified and eligible to receive a...

  10. 7 CFR 3430.903 - Eligibility.

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Eligibility. 3430.903 Section 3430.903 Agriculture Regulations of the Department of Agriculture (Continued) COOPERATIVE STATE RESEARCH, EDUCATION, AND EXTENSION SERVICE, DEPARTMENT OF AGRICULTURE COMPETITIVE AND NONCOMPETITIVE NON-FORMULA FEDERAL ASSISTANCE PROGRAMS...

  11. 24 CFR 570.703 - Eligible activities.

    2010-04-01

    ....705(b)(1). (l) Acquisition, construction, reconstruction, rehabilitation or historic preservation, or... the CDBG program account or line of credit for costs incurred by the public entity or designated... environmental assessment costs not otherwise eligible under § 570.205. (f) Site preparation, including...

  12. 32 CFR 903.2 - Eligibility requirements.

    2010-07-01

    ... SCHOOLS AIR FORCE ACADEMY PREPARATORY SCHOOL § 903.2 Eligibility requirements. (a) For admission to the HQ... have no dependents. (4) Of high moral character. Applicants must have no record of Uniform Code of... Preparatory School. The Headquarters USAFA Registrar's Office (HQ USAFA/RR) determines an applicant's status...

  13. 23 CFR 668.109 - Eligibility.

    2010-04-01

    ...) Betterments, only where clearly economically justified to prevent future recurring damage. Economic justification must weigh the cost of betterment against the risk of eligible recurring damage and the cost of... a betterment for the purpose of 23 CFR 668.109(b)(6); and (9) Repair of toll facilities when the...

  14. 22 CFR 62.3 - Sponsor eligibility.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Sponsor eligibility. 62.3 Section 62.3 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES EXCHANGE VISITOR PROGRAM General Provisions... visitor program are: (1) United States local, state and federal government agencies; (2) International...

  15. 22 CFR 231.04 - Guarantee eligibility.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Guarantee eligibility. 231.04 Section 231.04 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ARAB REPUBLIC OF EGYPT LOAN GUARANTEES ISSUED UNDER THE EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND...

  16. 7 CFR 760.1304 - Eligibility.

    2010-01-01

    ... SPECIAL PROGRAMS INDEMNITY PAYMENT PROGRAMS Dairy Economic Loss Assistance Payment Program § 760.1304... political subdivisions and related agencies) excluded from the MILC program will not be eligible for DELAP... (4) Submit an accurate and complete request for benefits as specified in § 760.1303, if production...

  17. 7 CFR 766.55 - Eligibility determination.

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligibility determination. 766.55 Section 766.55 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF... determination. Within 30 days of a complete DSA application, the Agency will determine if the borrower meets the...

  18. 30 CFR 884.11 - State eligibility.

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false State eligibility. 884.11 Section 884.11 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR....5 of this chapter within your jurisdiction. We may approve your proposed reclamation plan if you...

  19. 38 CFR 17.61 - Eligibility.

    2010-07-01

    ... or VA medical center, domiciliary, or nursing home care; or (2) Such care or services were furnished... Residential Care § 17.61 Eligibility. VA health care personnel may assist a veteran by referring such veteran for placement in a privately or publicly-owned community residential care facility if: (a) At the time...

  20. 24 CFR 941.201 - PHA eligibility.

    2010-04-01

    .... HUD will determine eligibility based on a showing that the PHA has the legal authority and local cooperation required by this part. (b) Legal authority. The PHA must demonstrate that it has the legal... solicitation and the selection before award of a contract is made by such a PHA. (d) Local cooperation. The PHA...

  1. 7 CFR 3415.3 - Eligibility requirements.

    2010-01-01

    ... under grants or contracts from the Federal government; (4) Adequate financial management system and..., AND EXTENSION SERVICE, DEPARTMENT OF AGRICULTURE BIOTECHNOLOGY RISK ASSESSMENT RESEARCH GRANTS PROGRAM... private research or educational institution or organization shall be eligible to apply for and to receive...

  2. 23 CFR 660.511 - Eligibility.

    2010-04-01

    ... determining the eligibility of proposed improvements for financing with defense access roads funds. The... financing either in whole or in part with defense access road funds, MTMC will certify the project as important to the national defense and will authorize expenditure of defense access road funds. The Commander...

  3. 34 CFR 200.71 - LEA eligibility.

    2010-07-01

    ... least five percent of the LEA's total population ages 5 to 17 years, inclusive. (d) Education finance... 34 Education 1 2010-07-01 2010-07-01 false LEA eligibility. 200.71 Section 200.71 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION...

  4. 7 CFR 760.404 - Eligible livestock.

    2010-01-01

    ..., goats, swine, poultry, deer, or reindeer and meet all the conditions in paragraph (c) of this section... part of a farming operation on the day they died; and (3) Before dying, not have been produced or maintained for reasons other than commercial use as part of a farming operation, such non-eligible uses being...

  5. 7 CFR 1416.203 - Eligible livestock.

    2010-01-01

    ... hurricane during the disaster period; (iii) Been maintained for commercial use as part of a farming... other than commercial use as part of a farming operation, including but not limited to wild free roaming..., crawfish, equine, sheep goats, swine, poultry or deer; (ii) Died in an eligible county as a direct result...

  6. 44 CFR 79.6 - Eligibility.

    2010-10-01

    ... SECURITY INSURANCE AND HAZARD MITIGATION National Flood Insurance Program FLOOD MITIGATION GRANTS § 79.6... develop or update the flood portion of any mitigation plan. Planning grants are not eligible for funding... requirement. (1) States must have an approved State Mitigation Plan meeting the requirements of §§ 201.4 or...

  7. 7 CFR 1735.14 - Borrower eligibility.

    2010-01-01

    ... liability company. [58 FR 66253, Dec. 20, 1993, as amended at 64 FR 50429, Sept. 17, 1999; 65 FR 42619, July... in rural areas as of October 28, 1949; and (3) Cooperative, nonprofit, limited dividend or mutual..., nonprofit, limited dividend, or mutual associations. To be eligible for a loan, a borrower: (1) Must have...

  8. 32 CFR 732.12 - Eligibility.

    2010-07-01

    ... eligible for non-Federal medical, dental, or emergency maternity care at Government expense, Regular active... training, including leave and liberty therefrom, are considered to be in a duty status while participating... maternity care at Government expense. The only exception occurs when a member's illness or injury is...

  9. 24 CFR 982.352 - Eligible housing.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Eligible housing. 982.352 Section 982.352 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT...

  10. 24 CFR 1007.20 - Eligible housing.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Eligible housing. 1007.20 Section 1007.20 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT...

  11. 7 CFR 1775.65 - Eligibility.

    2010-01-01

    ... (CONTINUED) TECHNICAL ASSISTANCE GRANTS Solid Waste Management Grants § 1775.65 Eligibility. (a) Entities...) Applicants must also have the proven ability; background; experience, as evidenced by the organization's satisfactory completion of project(s) similar to those proposed; legal authority; and actual capacity to...

  12. 24 CFR 574.300 - Eligible activities.

    2010-04-01

    ... not limited to, health, mental health, assessment, permanent housing placement, drug and alcohol abuse... that health services may only be provided to individuals with acquired immunodeficiency syndrome or... by HUD. (c) Faith-based activities. (1) Organizations that are religious or faith-based are eligible...

  13. 7 CFR 1435.102 - Eligibility requirements.

    2010-01-01

    ... to be eligible to be pledged as loan collateral: (1) Refined beet sugar to be pledged as loan... yield raw cane sugar or refined beet sugar, as determined by CCC. (e) The loan collateral must be stored... OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS SUGAR PROGRAM Sugar Loan Program § 1435.102...

  14. 13 CFR 120.346 - Eligibility.

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Eligibility. 120.346 Section 120.346 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Special Purpose Loans... will significantly expand an existing export market or develop new export markets; or (2) The applicant...

  15. 47 CFR 90.33 - General eligibility.

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND... to furnish nonprofit radio-communication service to its parent corporation, to another subsidiary of the same parent, or to its own subsidiary. This corporate eligibility is not subject to the...

  16. 24 CFR 570.482 - Eligible activities.

    2010-04-01

    ... certification from the assisted business that neither it, nor any of its subsidiaries, has plans to relocate... Block Grant Program § 570.482 Eligible activities. (a) General. The choice of activities on which block... accordance with the state's program design and procedures, as to which approach or approaches will best serve...

  17. Restoration of motion blurred images

    Gaxiola, Leopoldo N.; Juarez-Salazar, Rigoberto; Diaz-Ramirez, Victor H.

    2017-08-01

    Image restoration is a classic problem in image processing. Image degradations can occur due to several reasons, for instance, imperfections of imaging systems, quantization errors, atmospheric turbulence, relative motion between camera or objects, among others. Motion blur is a typical degradation in dynamic imaging systems. In this work, we present a method to estimate the parameters of linear motion blur degradation from a captured blurred image. The proposed method is based on analyzing the frequency spectrum of a captured image in order to firstly estimate the degradation parameters, and then, to restore the image with a linear filter. The performance of the proposed method is evaluated by processing synthetic and real-life images. The obtained results are characterized in terms of accuracy of image restoration given by an objective criterion.

  18. Minimizing waste in environmental restoration

    Moos, L.; Thuot, J.R.

    1996-01-01

    Environmental restoration, decontamination and decommissioning and facility dismantelment projects are not typically known for their waste minimization and pollution prevention efforts. Typical projects are driven by schedules and milestones with little attention given to cost or waste minimization. Conventional wisdom in these projects is that the waste already exists and cannot be reduced or minimized. In fact, however, there are three significant areas where waste and cost can be reduced. Waste reduction can occur in three ways: beneficial reuse or recycling; segregation of waste types; and reducing generation of secondary waste. This paper will discuss several examples of reuse, recycle, segregation, and secondary waste reduction at ANL restoration programs

  19. Intellectual system for images restoration

    Mardare, Igor

    2005-02-01

    Intelligence systems on basis of artificial neural networks and associative memory allow to solve effectively problems of recognition and restoration of images. However, within analytical technologies there are no dominating approaches of deciding of intellectual problems. Choice of the best technology depends on nature of problem, features of objects, volume of represented information about the object, number of classes of objects, etc. It is required to determine opportunities, preconditions and field of application of neural networks and associative memory for decision of problem of restoration of images and to use their supplementary benefits for further development of intelligence systems.

  20. Restorative Glass : Reversible, discreet restoration using structural glass components

    Oikonomopoulou, F.; Bristogianni, T.; Barou, L.; van Hees, R.P.J.; Nijsse, R.; Veer, F.A.; Henk, Schellen; van Schijndel, Jos

    2016-01-01

    The application of structural glass as the principal material in restoration and conservation practices is a distinguishable, yet discreet approach. The transparency of glass allows the simultaneous perception of the monument at both its original and present condition, preserving its historical and

  1. Optical properties of composite restorations influenced by dissimilar dentin restoratives.

    Marjanovic, Jovana; Veljovic, Djordje N; Stasic, Jovana N; Savic-Stankovic, Tatjana; Trifkovic, Branka; Miletic, Vesna

    2018-05-01

    To evaluate optical properties (color and translucency) of 'sandwich' restorations of resin-based composites and esthetically unfavorable dentin restoratives. Cylindrical 'dentin' specimens (8mm in diameter and 2mm thick, N=5/group) were prepared using EverX Posterior (GC), Biodentine (Septodont), experimental hydroxyapatite (HAP) or conventional composites (Gradia Direct Posterior, GC; Filtek Z250 and Filtek Z500, 3M ESPE). Capping 'enamel' layers were prepared using composites (Gradia Direct Posterior, Filtek Z250 or Z550) of A1 or A3 shade and the following thickness: 0.6, 1 or 2mm. Color (ΔE) and translucency parameter (TP) were determined using a spectrophotometer (VITA Easyshade Advance 4.0, VITA Zahnfabrik). Data were statistically analyzed using analysis of variance with Tukey's post-hoc tests (α=0.05). TP was greatly affected by layer thickness, whilst ΔE depended on shade and layer thickness of the capping composite. HAP and Biodentine showed significantly lower TP and higher ΔE (deviation from 'ideal white') than composites (p<0.05). Greater TP was seen in EverX_composite groups than in corresponding control groups of the same shade and thickness. TP of composites combined with Biodentine or HAP was below 2, lower than the corresponding control groups (p<0.05). Within-group differences of ΔE were greatest in HAP_composite groups. EverX_Gradia and EverX_FiltekZ250 combinations showed the most comparable ΔE with the control groups. A 2mm thick layer of composite covering dentin restoratives with unfavorable esthetics is recommended for a final 'sandwich' restoration that is esthetically comparable to a conventional, mono-composite control restoration. Copyright © 2018 The Academy of Dental Materials. Published by Elsevier Inc. All rights reserved.

  2. 7 CFR 760.403 - Eligible owners and contract growers.

    2010-01-01

    ..., the applicant must have had legal ownership of the eligible livestock on the day the livestock died... eligible livestock on the day the livestock died; and (iii) A risk of loss in the animal. (b) A producer...

  3. 44 CFR 361.7 - General eligible expenditures.

    2010-10-01

    ... consistent with the definition of eligible activities in § 361.2. (b) The following is a list of eligible... full-time earthquake staff person must be employed and the equipment must be dedicated entirely to the...

  4. 48 CFR 922.608-3 - Protests against eligibility.

    2010-10-01

    ... SOCIOECONOMIC PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITION Walsh-Healey Public Contracts Act 922.608-3 Protests against eligibility. When an eligibility determination made by the contracting officer...

  5. 22 CFR 228.23 - Eligibility of marine insurance.

    2010-04-01

    ...-Related Services for USAID Financing § 228.23 Eligibility of marine insurance. The eligibility of marine... commodities procured with USAID funds be insured in the United States against marine loss. The decision of any...

  6. Restoration of severely weathered wood

    R. Sam. Williams; Mark. Knaebe

    2000-01-01

    Severely weathered window units were used to test various restoration methods and pretreatments. Sanded and unsanded units were pretreated with a consolidant or water repellent preservative, finished with an oil- or latex-based paint system, and exposed outdoors near Madison, WI, for five years. Pretreatments were applied to both window sashes (stiles and rails) and...

  7. Restoring formation after leaching process

    Barrett, R.B.

    1983-01-01

    A method of restoring a formation which had uranium and other mineral values extracted by an alkaline lixiviant comprises introducing a source of phosphate in an amount sufficient to lower the level of soluble uranium compounds below that previously existing in the formation by the formation of insoluble uranium phosphate compounds

  8. Natural look in volume restoration.

    Lupo, Mary P

    2008-09-01

    Filling and volumizing injection procedures are currently widely used for facial augmentation and re-establishing a youthful appearance. Aesthetic physicians have advanced from the practice of treating single lines and wrinkles towards filling large facial areas to globally restore natural facial contours and meet patient demand for nonsurgical rejuvenation. This review describes the different categories of fillers and volumizers based on their duration of action and ability to create a natural looking effect; they can be broadly classified as temporary or long-lasting biodegradable agents, or permanent nonbiodegradable agents. Temporary fillers are effective to correct lines and wrinkles, but may not adequately meet the need for global facial rejuvenation and volume replacement in a long-term, cost-efficient manner. Permanent fillers for global restoration pose the issue of long-term safety, and may not be compatible with changes in facial architecture with continued aging. Longer lasting volumizers provide patients with a durable, effective option for the restoration of facial volume and the re-establishment of youthful facial contours. Temporary fillers and volumizers may also be used in combination to provide a wide source of options for the global restoration and rejuvenation of the face.

  9. Image Restoration with New Technology

    Bülow-Møller, Anne Marie

    The article examines the role played by the corporate website while a company - Arla - attempted to restore an image tarnished by unethical behaviour. The company's strategy focussed on dialogue: it introduced a large number of authentic employees in their natural role as cook, dairy farmer, etc....

  10. Bayesian image restoration, using configurations

    Thorarinsdottir, Thordis

    configurations are expressed in terms of the mean normal measure of the random set. These probabilities are used as prior probabilities in a Bayesian image restoration approach. Estimation of the remaining parameters in the model is outlined for salt and pepper noise. The inference in the model is discussed...

  11. Bayesian image restoration, using configurations

    Thorarinsdottir, Thordis Linda

    2006-01-01

    configurations are expressed in terms of the mean normal measure of the random set. These probabilities are used as prior probabilities in a Bayesian image restoration approach. Estimation of the remaining parameters in the model is outlined for the salt and pepper noise. The inference in the model is discussed...

  12. [Dental implant restoration abutment selection].

    Bin, Shi; Hao, Zeng

    2017-04-01

    An increasing number of implant restoration abutment types are produced with the rapid development of dental implantology. Although various abutments can meet different clinical demands, the selection of the appropriate abutment is both difficult and confusing. This article aims to help clinicians select the appropriate abutment by describing abutment design, types, and selection criteria.

  13. Terrorism, forgiveness and restorative justice

    Pemberton, A.

    2014-01-01

    This paper is intended to enhance understanding of the complexities of restorative justice in cases of terrorism from a victimological perspective. It does so first by analysing what separates terrorism from other forms of crime. The author argues that the main distinction concerns the peculiarly

  14. Phonemic restoration in developmental dyslexia

    Stephanie N. Del Tufo

    2014-06-01

    Full Text Available The comprehension of fluent speech in one’s native language requires that listeners integrate the detailed acoustic-phonetic information available in the sound signal with linguistic knowledge. This interplay is especially apparent in the phoneme restoration effect, a phenomenon in which a missing phoneme is ‘restored’ via the influence of top-down information from the lexicon and through bottom-up acoustic processing. Developmental dyslexia is a disorder characterized by an inability to read at the level of one’s peers without any clear failure due to environmental influences. In the current study we utilized the phonemic restoration illusion paradigm, to examine individual differences in phonemic restoration across a range of reading ability, from very good to dyslexic readers. Results demonstrate that restoration occurs less in those who have high scores on measures of phonological processing. Based on these results, we suggest that the processing or representation of acoustic detail may not be as reliable in poor and dyslexic readers, with the result that lexical information is more likely to override acoustic properties of the stimuli. This pattern of increased restoration could result from a failure of perceptual tuning, in which unstable representations of speech sounds result in the acceptance of non-speech sounds as speech. An additional or alternative theory is that degraded or impaired phonological processing at the speech sound level may reflect architecture that is overly plastic and consequently fails to stabilize appropriately for speech sound representations. Therefore the inability to separate speech and noise may result as a deficit in separating noise from the acoustic signal.

  15. 14 CFR 61.83 - Eligibility requirements for student pilots.

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Eligibility requirements for student pilots... TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND INSTRUCTORS Student Pilots § 61.83 Eligibility requirements for student pilots. To be eligible for a student pilot...

  16. 45 CFR 400.94 - Determination of eligibility for Medicaid.

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Determination of eligibility for Medicaid. 400.94... Determination of eligibility for Medicaid. (a) The State must determine Medicaid and SCHIP eligibility under its Medicaid and SCHIP State plans for each individual member of a family unit that applies for medical...

  17. 45 CFR 233.51 - Eligibility of sponsored aliens.

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Eligibility of sponsored aliens. 233.51 Section... CONDITIONS OF ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.51 Eligibility of sponsored aliens... affidavit(s) of support or similar agreement on behalf of an alien (who is not the child of the sponsor or...

  18. 24 CFR 5.510 - Documents of eligible immigration status.

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Documents of eligible immigration... Noncitizens § 5.510 Documents of eligible immigration status. (a) General. A responsible entity shall request and review original documents of eligible immigration status. The responsible entity shall retain...

  19. 13 CFR 127.400 - What is an eligibility examination?

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What is an eligibility examination? 127.400 Section 127.400 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION WOMEN-OWNED SMALL BUSINESS FEDERAL CONTRACT ASSISTANCE PROCEDURES Eligibility Examinations § 127.400 What is an eligibility...

  20. 45 CFR 1626.7 - Verification of eligible alien status.

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Verification of eligible alien status. 1626.7... CORPORATION RESTRICTIONS ON LEGAL ASSISTANCE TO ALIENS § 1626.7 Verification of eligible alien status. (a) An alien seeking representation shall submit appropriate documents to verify eligibility, unless the only...

  1. 10 CFR 611.102 - Eligible project costs.

    2010-01-01

    ... Accounting Principles and these costs may be considered by DOE in determining the Borrower's contribution to... 10 Energy 4 2010-01-01 2010-01-01 false Eligible project costs. 611.102 Section 611.102 Energy... PROGRAM Direct Loan Program § 611.102 Eligible project costs. (a) Eligible costs are: (1) Those costs that...

  2. 48 CFR 919.7005 - Eligibility to be a Mentor.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Eligibility to be a Mentor... PROGRAMS SMALL BUSINESS PROGRAMS The Department of Energy Mentor-Protege Program 919.7005 Eligibility to be a Mentor. To be eligible for recognition by DOE as a Mentor, an entity must be performing at least...

  3. 45 CFR 1639.4 - Permissible representation of eligible clients.

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Permissible representation of eligible clients... CORPORATION WELFARE REFORM § 1639.4 Permissible representation of eligible clients. Recipients may represent an individual eligible client who is seeking specific relief from a welfare agency. [62 FR 30766...

  4. 50 CFR 296.4 - Claims eligible for compensation.

    2010-10-01

    ... compensation. (a) Claimants. Damage or loss eligible for Fund compensation must be suffered by a commercial fisherman. (b) Damage or loss of fishing gear. Damage or loss is eligible for Fund compensation if it was... is not eligible for Fund compensation: (1) If the damage or loss was caused by the negligence or...

  5. 7 CFR 632.13 - Eligible lands and water.

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Eligible lands and water. 632.13 Section 632.13... lands and water. Lands and water eligible for reclamation are those that were mined for coal or were... lands and water are not eligible if: (a) There is continuing reclamation responsibility on the part of a...

  6. Measuring the quality of eligible collateral

    Lehmbecker, Philipp; Missong, Martin

    2008-01-01

    Recently, the U. S. subprime crisis has shown that a weak collateralization of credits may have massive economic implications, entailing severe perturbations of the international financial system. We focus on central bank lending and try to pin down the quantitative impact of the collateralization of central banks' credits. A questionnaire on national monetary frameworks was used to collect data from central banks. Drawing on these data we derive an index of the quality of eligible assets mea...

  7. Technology needs for environmental restoration remedial action. Environmental Restoration Program

    Watson, J.S.

    1992-11-01

    This report summarizes the current view of the most important technology needs for the US Department of Energy (DOE) facilities operated by Martin Marietta Energy Systems, Inc. These facilities are the Oak Ridge National Laboratory, the Oak Ridge K-25 Site, the Oak Ridge Y-12 Plant, the Paducah Gaseous Diffusion Plant, and the Portsmouth Gaseous Diffusion Plant. The sources of information used in this assessment were a survey of selected representatives of the Environmental Restoration (ER) programs at each facility, results from a questionnaire distributed by Geotech CWM, Inc., for DOE, and associated discussions with individuals from each facility. This is not a final assessment, but a brief look at an ongoing assessment; the needs will change as the plans for restoration change and, it is hoped, as some technical problems are solved through successful development programs.

  8. Restorative glass: reversible, discreet restoration using structural glass components

    Faidra Oikonomopoulou

    2017-12-01

    Full Text Available The application of structural glass as the principal material in restoration and conservation practices is a distinguishable, yet discreet approach. The transparency of glass allows the simultaneous perception of the monument at both its original and present condition, preserving its historical and aesthetical integrity. Concurrently, the material’s unique mechanical properties enable the structural consolidation of the monument. As a proof of concept, the restoration of Lichtenberg Castle is proposed. Solid cast glass units are suggested to complete the missing parts, in respect to the existing construction technique and aesthetics of the original masonry. Aiming for a reversible system, the glass units are interlocking, ensuring the overall stability without necessitating permanent, adhesive connections. This results in an elegant and reversible intervention.

  9. Poplar Island Environmental Restoration Project Nekton Data

    National Oceanic and Atmospheric Administration, Department of Commerce — The Poplar Island Environmental Restoration Project (PIERP) is a large scale 1,800 acres restoration project located in mid Chesapeake Bay. Fishery collections are...

  10. Economic barriers and incentives for biodiversity restoration

    Garcia Frapolli, Eduardo; Lindigcisneros, Roberto

    2011-01-01

    Costs related with restoration efforts, as well as the economic incentives, are fundamental issues that have not been fully considered from a formal standpoint. Through the analysis of restoration trials in collaboration with an indigenous community in western Mexico, we analyzed economic issues related with the restoration trials themselves, and with the economic context that gives incentives for ecological restoration. We reach to the conclusion that the cost-benefit relationship of the restoration process by itself can be straightforward calculated in some cases, calculating economic benefits accrued from the diversity restored to ecosystem is more difficult. In terms of the incentives for biodiversity restoration, we concluded that in many cases, economic variables out of the control of those involved in restoration are determinant.

  11. Two-dimensional maximum entropy image restoration

    Brolley, J.E.; Lazarus, R.B.; Suydam, B.R.; Trussell, H.J.

    1977-07-01

    An optical check problem was constructed to test P LOG P maximum entropy restoration of an extremely distorted image. Useful recovery of the original image was obtained. Comparison with maximum a posteriori restoration is made. 7 figures

  12. 32 CFR 147.32 - Temporary eligibility for access at the top secret and SCI levels and temporary eligibility for...

    2010-07-01

    ... Guidelines for Temporary Access § 147.32 Temporary eligibility for access at the top secret and SCI levels... 32 National Defense 1 2010-07-01 2010-07-01 false Temporary eligibility for access at the top secret and SCI levels and temporary eligibility for âQâ access authorization: For someone who is not the...

  13. 32 CFR 147.30 - Temporary eligibility for access at the confidential and secret levels and temporary eligibility...

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Temporary eligibility for access at the confidential and secret levels and temporary eligibility for âLâ access authorization. 147.30 Section 147.30... Temporary Access § 147.30 Temporary eligibility for access at the confidential and secret levels and...

  14. Wetland restoration: a survey of options for restoring peatlands

    Lode, Elve

    1999-01-01

    In spite of increased attention to wetland conservation following the Ramsar Convention on Wetlands of International Importance, the peat-harvesting industry in many countries is still interested in the further exploitation of peatlands. In some of the most industrialised countries, all natural peatlands have already been lost. In others, only small areas of native peatland remain. Among other possible uses for cut-over peatlands, peatland restoration is one: there is an urgent need for the development of measures for regenerating peat-accumulation processes. The redevelopment of a fen or bog peat landscape is a long-term process, which will probably take centuries. The restoration of any peatland may therefore be considered successful if the outcome is the development and growth of plant communities able to produce peat. The renewal of the hydrological regime of such areas is a major factor which determines the re-colonisation of cut-over peat fields by peat-forming plants. The aim of this paper is to give a brief survey of wetlands, and especially of peatland restoration options, for use in terminated peat-cuttings. It aims to show how peatland management may be made sustainable by means of existing and tried methods and principles, with the goal of returning cut-over peat fields to their former peat-accumulating state. A glossary of peat and peatland terminology is included 105 refs, 5 figs

  15. Marine Ecosystem Restoration in Changing European Seas

    Ounanian, Kristen; Delaney, Alyne; Carballo Cárdenas, Eira

    2017-01-01

    and using different narratives of marine restoration, and being confronted with different forms of uncertainties. The paper’s overall contribution is the synthesis of these seemingly disparate components (narratives of restoration, uncertainty in decision making, and governance arrangements) to evaluate...... the impact of existing (maritime and environmental) policies, the governance setting, definitions of restoration and uncertainties on the effectiveness of marine restoration projects. Such a synthesis is a necessary move toward a systematic evaluation of ways to govern and formally institutionalize marine...

  16. Forests planted for ecosystem restoration or conservation.

    Constance A. Harrington

    1999-01-01

    Although the phrase, "planting for ecosystem restoration," is of recent origin, many of the earliest large-scale tree plantings were made for what we now refer to as "'restoration" or "conservation" goals. Forest restoration activities may be needed when ecosystems are disturbed by either natural or anthropogenic forces. Disturbances...

  17. Restorative Justice as Strength-Based Accountability

    Ball, Robert

    2003-01-01

    This article compares strength-based and restorative justice philosophies for young people and their families. Restorative justice provides ways to respond to crime and harm that establish accountability while seeking to reconcile members of a community. Restorative approaches are an important subset of strength-based interventions.

  18. RESEARCH NEEDS IN RIPARIAN BUFFER RESTORATION

    Riparian buffer restorations are used as management tools to produce favorable water quality impacts; moreover, the basis for riparian buffers as an instrument of water quality restoration rests on a relatively firm foundation. However, the extent to which buffers can restore rip...

  19. Restoration of a fractured central incisor.

    Olson, Bradley J

    2012-03-01

    The treatment of a traumatically damaged single central incisor poses significant challenges relative to function and esthetics to the restoring clinician. Providing a good long-term prognosis is paramount when determining whether to maintain or extract a structurally compromised tooth. Successful restoration demands timely and thorough risk assessment along with excellent communication with both the patient and the laboratory fabricating the restoration.

  20. Improving snow albedo processes in WRF/SSiB regional climate model to assess impact of dust and black carbon in snow on surface energy balance and hydrology over western U.S.

    Oaida, CM; Xue, Y; Flanner, MG; Skiles, SMK; De Sales, F; Painter, TH

    2015-01-01

    © 2015. American Geophysical Union. All Rights Reserved. Two important factors that control snow albedo are snow grain growth and presence of light-absorbing impurities (aerosols) in snow. However, current regional climate models do not include such processes in a physically based manner in their land surface models. We improve snow albedo calculations in the Simplified Simple Biosphere (SSiB) land surface model coupled with the Weather Research and Forecasting (WRF) regional climate model (R...

  1. International Expert Review of Sr-Can: Safety Assessment Methodology - External review contribution in support of SSI's and SKI's review of SR-Can

    Sagar, Budhi; Egan, Michael; Roehlig, Klaus-Juergen; Chapman, Neil; Wilmot, Roger

    2008-03-01

    In 2006, SKB published a safety assessment (SR-Can) as part of its work to support a licence application for the construction of a final repository for spent nuclear fuel. The purposes of the SR-Can project were stated in the main project report to be: 1. To make a first assessment of the safety of potential KBS-3 repositories at Forsmark and Laxemar to dispose of canisters as specified in the application for the encapsulation plant. 2. To provide feedback to design development, to SKB's research and development (R and D) programme, to further site investigations and to future safety assessments. 3. To foster a dialogue with the authorities that oversee SKB's activities, i.e. the Swedish Nuclear Power Inspectorate, SKI, and the Swedish Radiation Protection Authority, SSI, regarding interpretation of applicable regulations, as a preparation for the SR-Site project. To help inform their review of SKB's proposed approach to development of the longterm safety case, the authorities appointed three international expert review teams to carry out a review of SKB's SR-Can safety assessment report. Comments from one of these teams - the Safety Assessment Methodology (SAM) review team - are presented in this document. The SAM review team's scope of work included an examination of SKB's documentation of the assessment ('Long-term safety for KBS-3 Repositories at Forsmark and Laxemar - a first evaluation' and several supporting reports) and hearings with SKB staff and contractors, held in March 2007. As directed by SKI and SSI, the SAM review team focused on methodological aspects and sought to determine whether SKB's proposed safety assessment methodology is likely to be suitable for use in the future SR-Site and to assess its consistency with the Swedish regulatory framework. No specific evaluation of long-term safety or site acceptability was undertaken by any of the review teams. SKI and SSI's Terms of Reference for the SAM review team requested that consideration be given

  2. Conversion of fracture toughness testing values from small scale three point bending test specimens to small scale yielding state (SSY) by elastic-plastic stress analysis

    Ikonen, K.

    1993-07-01

    The report describes the work performed for achieving readiness to calculate fracture toughness dependence on dimension effects and loading conditions in fracture test specimens and real structures. In the report two- and three-dimensional computer codes developed and calculational methods applied are described. One of the main goals is to converse fracture toughness from small scale three point bending test specimens to case of a depth crack in plane strain i.e. to small scale yielding state (SSY) by numerical elastic-plastic stress analysis. Thickness effect of a test specimens and effect of a crack depth are separately investigated. Tests of three point bending specimens with and without sidegrooves and curved crack front are numerically simulated and experimental and computed results are compared. J-integral is calculated along crack front and also from force-deflection dependence of the beam. For the analyses the computing system was thoroughly automatized. Measuring capacity of three point bending test specimens was tried to evaluate. (orig.) (7 refs., 54 figs.)

  3. Review of SKB's interim report of SR-Can: SKI's and SSI's evaluation of SKB's up-dated methodology for safety assessment

    Dverstorp, Bjoern; Moberg, Leif; Wiebert, Anders; Xu Shulan; Stroemberg, Bo; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Sundstroem, Benny; Toverud, Oeivind

    2005-07-01

    This report presents the findings of a review of the Swedish Nuclear Fuel and Waste Management Co.'s (SKB) interim report of the safety assessment SR-Can (SKB TR 04-11), conducted by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). SKB's interim report describes and exemplifies the safety assessment methodology that SKB plans to use in the oncoming licence applications for an encapsulation plant and a final repository for spent nuclear fuel. The authorities' review takes into account the findings of an international peer review of SKB's interim report. The authorities conclude that SKB has improved its safety assessment methodology in several aspects compared to earlier safety reports. Among other things the authorities commend SKB for giving a comprehensive account of relevant regulations and guidance, and for the systematic approach to identification and documentation of features, events and processes that need to be considered in the safety assessment. However, the authorities also conclude that important parts of SKB's method need to be further developed before they are mature enough to be used as a basis for a license application. The authorities' overall assessment is summarised in chapter 8 of this report

  4. SKI and SSI's recommendations to the government concerning long-term responsibility after closure of a repository for spent nuclear fuel

    Paeivioe Jonsson, Josefin

    2008-01-01

    Many activities will cease at the closure of a repository, but not responsibilities. The candidate municipalities in Sweden expressed concern about who will take over after the implementer is released from responsibility for the facility. The government thus commissioned SKI (Swedish Nuclear Power Inspectorate) and SSI (Swedish Radiation Protection Authority) to review the legal obligations of institutional players as laid out today in legislation in Sweden. After closure of the repository in about 100 years there will be post-closure monitoring, possibly for a few hundred years. This will be a part of the conditions on SKB (Swedish Nuclear Fuel and Waste Management Company) which will be set out at the time. Some activities will end at the closure of the facility but monitoring and safeguards obligations may continue. The exact nature of this monitoring and safeguard work needs to be discussed and agreed upon. With the proposed approach most of the liabilities rest with the state in the long term, the waste producers only have liabilities in the short term but their decisions could have big impacts on long term liabilities

  5. Resilience and Restoration of Lakes

    Stephen R. Carpenter

    1997-06-01

    Full Text Available Lake water quality and ecosystem services are normally maintained by several feedbacks. Among these are nutrient retention and humic production by wetlands, nutrient retention and woody habitat production by riparian forests, food web structures that cha nnel phosphorus to consumers rather than phytoplankton, and biogeochemical mechanisms that inhibit phosphorus recycling from sediments. In degraded lakes, these resilience mechanisms are replaced by new ones that connect lakes to larger, regional economi c and social systems. New controls that maintain degraded lakes include runoff from agricultural and urban areas, absence of wetlands and riparian forests, and changes in lake food webs and biogeochemistry that channel phosphorus to blooms of nuisance al gae. Economic analyses show that degraded lakes are significantly less valuable than normal lakes. Because of this difference in value, the economic benefits of restoring lakes could be used to create incentives for lake restoration.

  6. 75 FR 34975 - Notice of Estuary Habitat Restoration Council's Intent to Revise its Estuary Habitat Restoration...

    2010-06-21

    ... Estuary Habitat Restoration Council's Intent to Revise its Estuary Habitat Restoration Strategy; Request... interagency Estuary Habitat Restoration Council, is providing notice of the Council's intent to revise the ''Estuary Habitat Restoration Strategy'' and requesting public comments to guide its revision. DATES...

  7. Image restoration and processing methods

    Daniell, G.J.

    1984-01-01

    This review will stress the importance of using image restoration techniques that deal with incomplete, inconsistent, and noisy data and do not introduce spurious features into the processed image. No single image is equally suitable for both the resolution of detail and the accurate measurement of intensities. A good general purpose technique is the maximum entropy method and the basis and use of this will be explained. (orig.)

  8. Autonomous algorithms for image restoration

    Griniasty , Meir

    1994-01-01

    We describe a general theoretical framework for algorithms that adaptively tune all their parameters during the restoration of a noisy image. The adaptation procedure is based on a mean field approach which is known as ``Deterministic Annealing'', and is reminiscent of the ``Deterministic Bolzmann Machiné'. The algorithm is less time consuming in comparison with its simulated annealing alternative. We apply the theory to several architectures and compare their performances.

  9. Bayesian image restoration, using configurations

    Thorarinsdottir, Thordis

    2006-01-01

    In this paper, we develop a Bayesian procedure for removing noise from images that can be viewed as noisy realisations of random sets in the plane. The procedure utilises recent advances in configuration theory for noise free random sets, where the probabilities of observing the different boundary configurations are expressed in terms of the mean normal measure of the random set. These probabilities are used as prior probabilities in a Bayesian image restoration approach. Estimation of the re...

  10. Environmental Restoration 1997 annual report

    Cosper, M.B.

    1997-01-01

    During 1997, the Environmental Restoration Program at the Savannah River Site achieved all of the ''Breakthrough Goals'' that were established with the regulatory agencies in 1995 to advance their cleanup efforts. Effective focus on field remediation was demonstrated by the allocation of 75% of program funding to remediation activities. The Remediation Phase is complete or has begun on sixty-nine waste sites that represent approximately 80% of the known environmental and health risk. The average time required for the assessment phase of active projects was reduced by 50%, from 49 to less than 24 months, which allows cleanup actions to start twice as fast as before. Breakthrough performance has tangible results. During 1997, all of the funding allocation was used effectively to accomplish environmental restoration scope worth over $123 million. That represents a validated cost efficiency of over 20% for the third straight year. Over half of the 500 contaminated acres at SRS have been cleaned up or are currently in the remediation phase. Almost 3 billion gallons of groundwater have been restored by removing over half a million pounds of organic solvents

  11. Methodology for ranking restoration options

    Hedemann Jensen, Per

    1999-04-01

    The work described in this report has been performed as a part of the RESTRAT Project FI4P-CT95-0021a (PL 950128) co-funded by the Nuclear Fission Safety Programme of the European Commission. The RESTRAT project has the overall objective of developing generic methodologies for ranking restoration techniques as a function of contamination and site characteristics. The project includes analyses of existing remediation methodologies and contaminated sites, and is structured in the following steps: characterisation of relevant contaminated sites; identification and characterisation of relevant restoration techniques; assessment of the radiological impact; development and application of a selection methodology for restoration options; formulation of generic conclusions and development of a manual. The project is intended to apply to situations in which sites with nuclear installations have been contaminated with radioactive materials as a result of the operation of these installations. The areas considered for remedial measures include contaminated land areas, rivers and sediments in rivers, lakes, and sea areas. Five contaminated European sites have been studied. Various remedial measures have been envisaged with respect to the optimisation of the protection of the populations being exposed to the radionuclides at the sites. Cost-benefit analysis and multi-attribute utility analysis have been applied for optimisation. Health, economic and social attributes have been included and weighting factors for the different attributes have been determined by the use of scaling constants. (au)

  12. Environmental restoration project configuration control

    Hutterman, L.L.

    1991-01-01

    This paper provides an overview of the approach that Westinghouse Idaho Nuclear Company, Inc. (WINCO) is using for the implementation of the configuration control requirements for a major system acquisition under the guidance of US Department of Energy (DOE) Order 4700.1, open-quotes Project Management System,close quotes for environmental restoration. The two major features of the WINCO environmental restoration approach relate to (1) the product and (2) the maintenance of the baseline for many sites in different phases at the same time. Historically, a project has typically produced a product. Environmental restoration in some ways produces no typical project product. Essentially, what is produced and what configuration control management is exercised on is one of the following: (1) the development of clean dirt, (2) the documentation to support clean dirt, or (3) the track record of each of the sites. It is the latter approach that this paper deals with. This approach is unique in that there are four baselines [cost, schedule, scope, and technical (the track record product)] rather than the typical three. This is essential in configuration management due to the lack of a uniquely identifiable product for each site. Essentially, the philosophy behind the four-part configuration controls allows the technical baseline to fulfill the function typically met by the identifiable product

  13. Power system restoration: planning and simulation

    Hazarika, D. [Assam Engineering Coll., Dept. of Electrical Engineering, Assam (India); Sinha, A.K. [Inidan Inst. of Technology, Dept. of Electrical Engineering, Kharagpur (India)

    2003-03-01

    This paper describes a restoration guidance simulator, which allows power system operator/planner to simulate and plan restoration events in an interactive mode. The simulator provides a list of restoration events according to the priority based on some restoration rules and list of priority loads. It also provides in an interactive mode the list of events, which becomes possible as the system grows during restoration. Further, the selected event is validated through a load flow and other analytical tools to show the consequences of implementing the planned event. (Author)

  14. [Multiple agenesis and prosthetic restoration].

    Renault, P

    1990-03-01

    Cases of multiple agenesia present some difficulties in the treatment planing. Three situations may be encountered: limited agenesia, restored by a fixed, bonded or cemented prosthesis, multiple uni- or bimaxillary agenesia without remaining of deciduous teeth, restored by a fixed, bonded or cemented prosthesis or the partial adjacent prosthesis, multiple uni- or bimaxillary agenesia with remaining of deciduous teeth, restored by means of a supra-dental prosthesis. The first two situations have been described in dental literature and are relatively easy to treat. The same is not true for the third situation, where the decision to keep the temporary teeth considerably increases the difficulty of prosthetic restoration. This subject will be illustrated by the presentation of a clinical case of multiple bi-maxillary agenesia. The patient has: on the maxilla: an absence of 9 permanent teeth (18, 15, 14, 12, 22, 23, 24, 25, 28) and the presence of 4 deciduous teeth (62, 63, 64, 65), on the mandible: an absence of all permanent teeth, with the exception of 36 and 46, and the remaining of 4 deciduous teeth (75, 73, 83, 84). The remaining of deciduous teeth and the presence of a very high inter-arch space led to opting for dental coverage so as to keep the deciduous teeth and a proper vertical dimension. The patient wished to solve his "problem" in the maxilla first, and is not wanting to undergo the extraction of his deciduous teeth. The following therapeutic proposal was adapted: On the maxilla, a three-step procedure: first step: building of metal copings on 13, 16 and 26 and metal-ceramic crowns on 11 and 21, second step: building of telescop crowns on 16 and 26 and clasps on 13, 11 and 21, third step: casting of the removable partial denture framework and soldering to the telescop crowns and clasps. On the mandible, a provisional restoration using a supra-dental resin removable partial denture with ceramic occlusal surfaces was adopted. The aesthetic and functional

  15. The science and practice of river restoration

    Wohl, Ellen; Lane, Stuart N.; Wilcox, Andrew C.

    2015-08-01

    River restoration is one of the most prominent areas of applied water-resources science. From an initial focus on enhancing fish habitat or river appearance, primarily through structural modification of channel form, restoration has expanded to incorporate a wide variety of management activities designed to enhance river process and form. Restoration is conducted on headwater streams, large lowland rivers, and entire river networks in urban, agricultural, and less intensively human-altered environments. We critically examine how contemporary practitioners approach river restoration and challenges for implementing restoration, which include clearly identified objectives, holistic understanding of rivers as ecosystems, and the role of restoration as a social process. We also examine challenges for scientific understanding in river restoration. These include: how physical complexity supports biogeochemical function, stream metabolism, and stream ecosystem productivity; characterizing response curves of different river components; understanding sediment dynamics; and increasing appreciation of the importance of incorporating climate change considerations and resiliency into restoration planning. Finally, we examine changes in river restoration within the past decade, such as increasing use of stream mitigation banking; development of new tools and technologies; different types of process-based restoration; growing recognition of the importance of biological-physical feedbacks in rivers; increasing expectations of water quality improvements from restoration; and more effective communication between practitioners and river scientists.

  16. Impact of stream restoration on flood waves

    Sholtes, J.; Doyle, M.

    2008-12-01

    Restoration of channelized or incised streams has the potential to reduce downstream flooding via storing and dissipating the energy of flood waves. Restoration design elements such as restoring meanders, reducing slope, restoring floodplain connectivity, re-introducing in-channel woody debris, and re-vegetating banks and the floodplain have the capacity to attenuate flood waves via energy dissipation and channel and floodplain storage. Flood discharge hydrographs measured up and downstream of several restored reaches of varying stream order and located in both urban and rural catchments are coupled with direct measurements of stream roughness at various stages to directly measure changes to peak discharge, flood wave celerity, and dispersion. A one-dimensional unsteady flow routing model, HEC-RAS, is calibrated and used to compare attenuation characteristics between pre and post restoration conditions. Modeled sensitivity results indicate that a restoration project placed on a smaller order stream demonstrates the highest relative reduction in peak discharge of routed flood waves compared to one of equal length on a higher order stream. Reductions in bed slope, extensions in channel length, and increases in channel and floodplain roughness follow restoration placement with the watershed in relative importance. By better understanding how design, scale, and location of restored reaches within a catchment hydraulically impact flood flows, this study contributes both to restoration design and site decision making. It also quantifies the effect of reach scale stream restoration on flood wave attenuation.

  17. Ecological restoration success is higher for natural regeneration than for active restoration in tropical forests.

    Crouzeilles, Renato; Ferreira, Mariana S; Chazdon, Robin L; Lindenmayer, David B; Sansevero, Jerônimo B B; Monteiro, Lara; Iribarrem, Alvaro; Latawiec, Agnieszka E; Strassburg, Bernardo B N

    2017-11-01

    Is active restoration the best approach to achieve ecological restoration success (the return to a reference condition, that is, old-growth forest) when compared to natural regeneration in tropical forests? Our meta-analysis of 133 studies demonstrated that natural regeneration surpasses active restoration in achieving tropical forest restoration success for all three biodiversity groups (plants, birds, and invertebrates) and five measures of vegetation structure (cover, density, litter, biomass, and height) tested. Restoration success for biodiversity and vegetation structure was 34 to 56% and 19 to 56% higher in natural regeneration than in active restoration systems, respectively, after controlling for key biotic and abiotic factors (forest cover, precipitation, time elapsed since restoration started, and past disturbance). Biodiversity responses were based primarily on ecological metrics of abundance and species richness (74%), both of which take far less time to achieve restoration success than similarity and composition. This finding challenges the widely held notion that natural forest regeneration has limited conservation value and that active restoration should be the default ecological restoration strategy. The proposition that active restoration achieves greater restoration success than natural regeneration may have arisen because previous comparisons lacked controls for biotic and abiotic factors; we also did not find any difference between active restoration and natural regeneration outcomes for vegetation structure when we did not control for these factors. Future policy priorities should align the identified patterns of biophysical and ecological conditions where each or both restoration approaches are more successful, cost-effective, and compatible with socioeconomic incentives for tropical forest restoration.

  18. Long-term evaluation of extensive restorations in permanent teeth

    Nieuwenhuysen, J.-P. van; D'hoore, W.D.; Carvalho, J.

    2003-01-01

    Biostatistics, cast crowns, complex restorations, composite resins, decision making, dental amalgam, metal ceramic crowns, multi-surfaced restorations, prosthodontics, restorative dentistry......Biostatistics, cast crowns, complex restorations, composite resins, decision making, dental amalgam, metal ceramic crowns, multi-surfaced restorations, prosthodontics, restorative dentistry...

  19. 78 FR 28140 - Tentative Eligibility Determinations; Presumptive Eligibility for Psychosis and Other Mental Illness

    2013-05-14

    ...; Presumptive Eligibility for Psychosis and Other Mental Illness AGENCY: Department of Veterans Affairs. ACTION... time periods and for Persian Gulf War veterans who developed a mental illness other than psychosis... veterans, 38 CFR 17.37, to include veterans with psychosis or mental illness other than psychosis. We are...

  20. Factors influencing bonding fixed restorations

    Medić Vesna

    2008-01-01

    Full Text Available INTRODUCTION Crown displacement often occurs because the features of tooth preparations do not counteract the forces directed against restorations. OBJECTIVE The purpose of this study was to evaluate the effect of preparation designs on retention and resistance of fixed restorations. METHOD The study was performed on 64 differently sized stainless steel dies. Also, caps which were used for evaluated retention were made of stainless steel for each die. After cementing the caps on experimental dies, measuring of necessary tensile forces to separate cemented caps from dies was done. Caps, which were made of a silver-palladium alloy with a slope of 60° to the longitudinal axis formed on the occlusal surface, were used for evaluating resistance. A sudden drop in load pressure recorded by the test machine indicated failure for that cap. RESULTS A significant difference was found between the tensile force required to remove the caps from the dies with different length (p<0.05 and different taper (p<0.01. The greatest retentive strengths (2579.2 N and 2989.8 N were noticed in experimental dies with the greatest length and smallest taper. No statistically significant (p>0.05 differences were found between tensile loads for caps cemented on dies with different diameter. Although there was an apparent slight increase in resistance values for caps on dies with smaller tapers, the increase in resistance for those preparation designs was not statistically significant. There was a significant difference among the resistance values for caps on dies with different length (p<0.01 and diameter (p<0.05. CONCLUSION In the light of the results obtained, it could be reasonably concluded that retention and resistance of the restoration is in inverse proportion to convergence angle of the prepared teeth. But, at a constant convergence angle, retention and resistance increase with rising length and diameter.

  1. Focusing on SSI's risk and radiation protection criteria. A report based on discussions in focus groups in Oesthammar and Oskarshamn municipalities

    Drottz-Sjoeberg, Britt-Marie

    2003-11-01

    questions that need to be clarified but also contains the participants' comments and advice to SSI. The material is summarised in a more overarching way in the discussion and there is a brief evaluation of the main results of the project. The conclusion is that there is still a strong commitment in the site selection municipalities to contribute to and develop the work in the process of creating a Swedish repository for spent nuclear fuel and nuclear waste. The discussions in the focus groups in the municipalities of Oskarshamn and Oesthammar showed a) that people have substantial points of view on the content and formulation of the general guidelines that can be useful for SSI in the ongoing work, and b) that the need for knowledge and points of view of committed people now extend far beyond the framework specifying the work with the general guidelines. They include questions both about general concepts and detailed technical calculations as well as legal, health, organisational and social aspects and consequences of the work, from the present until far into the distant future

  2. Focusing on SSI's risk and radiation protection criteria. A report based on discussions in focus groups in Oesthammar and Oskarshamn municipalities

    Drottz-Sjoeberg, Britt-Marie [BMD Research (Sweden)

    2003-11-01

    consists of a presentation of the questions that need to be clarified but also contains the participants' comments and advice to SSI. The material is summarised in a more overarching way in the discussion and there is a brief evaluation of the main results of the project. The conclusion is that there is still a strong commitment in the site selection municipalities to contribute to and develop the work in the process of creating a Swedish repository for spent nuclear fuel and nuclear waste. The discussions in the focus groups in the municipalities of Oskarshamn and Oesthammar showed a) that people have substantial points of view on the content and formulation of the general guidelines that can be useful for SSI in the ongoing work, and b) that the need for knowledge and points of view of committed people now extend far beyond the framework specifying the work with the general guidelines. They include questions both about general concepts and detailed technical calculations as well as legal, health, organisational and social aspects and consequences of the work, from the present until far into the distant future.

  3. Minimizing waste in environmental restoration

    Thuot, J.R.; Moos, L.

    1996-01-01

    Environmental restoration, decontamination and decommissioning, and facility dismantlement projects are not typically known for their waste minimization and pollution prevention efforts. Typical projects are driven by schedules and milestones with little attention given to cost or waste minimization. Conventional wisdom in these projects is that the waste already exists and cannot be reduced or minimized; however, there are significant areas where waste and cost can be reduced by careful planning and execution. Waste reduction can occur in three ways: beneficial reuse or recycling, segregation of waste types, and reducing generation of secondary waste

  4. Environmental restoration using horizontal wells

    Looney, B.B.; Kaback, D.S.; Hazen, T.C.; Corey, J.C.

    1992-01-01

    This paper reports that under sponsorship from the U.S. Department of Energy, technical personnel from the Savannah River Laboratory and other DOE laboratories, universities and private industry have completed a full scale demonstration of environmental remediation using horizontal wells. The test successfully removed approximately 7250 kg of contaminants. A large amount of characterization and monitoring data was collected to aid in interpretation of the test and to provide the information needed for future environmental restorations that employ directionally drilled wells as extraction or delivery systems

  5. Contribution of genetics to ecological restoration.

    Mijangos, Jose Luis; Pacioni, Carlo; Spencer, Peter B S; Craig, Michael D

    2015-01-01

    Ecological restoration of degraded ecosystems has emerged as a critical tool in the fight to reverse and ameliorate the current loss of biodiversity and ecosystem services. Approaches derived from different genetic disciplines are extending the theoretical and applied frameworks on which ecological restoration is based. We performed a search of scientific articles and identified 160 articles that employed a genetic approach within a restoration context to shed light on the links between genetics and restoration. These articles were then classified on whether they examined association between genetics and fitness or the application of genetics in demographic studies, and on the way the studies informed restoration practice. Although genetic research in restoration is rapidly growing, we found that studies could make better use of the extensive toolbox developed by applied fields in genetics. Overall, 41% of reviewed studies used genetic information to evaluate or monitor restoration, and 59% provided genetic information to guide prerestoration decision-making processes. Reviewed studies suggest that restoration practitioners often overlook the importance of including genetic aspects within their restoration goals. Even though there is a genetic basis influencing the provision of ecosystem services, few studies explored this relationship. We provide a view of research gaps, future directions and challenges in the genetics of restoration. © 2014 John Wiley & Sons Ltd.

  6. Process to identify and evaluate restoration options

    Strand, J.; Senner, S.; Weiner, A.; Rabinowitch, S.; Brodersen, M.; Rice, K.; Klinge, K.; MacMullin, S.; Yender, R.; Thompson, R.

    1993-01-01

    The restoration planning process has yielded a number of possible alternatives for restoring resources and services injured by the Exxon Valdez oil spill. They were developed by resource managers, scientists, and the public, taking into consideration the results of damage assessment and restoration studies and information from the scientific literature. The alternatives thus far identified include no action natural recovery, management of human uses, manipulation of resources, habitat protection and acquisition, acquisition of equivalent resources, and combinations of the above. Each alternative consists of a different mix of resource- or service-specific restoration options. To decide whether it was appropriate to spend restoration funds on a particular resource or service, first criteria had to be developed that evaluated available evidence for consequential injury and the adequacy and rate of natural recovery. Then, recognizing the range of effective restoration options, a second set of criteria was applied to determine which restoration options were the most beneficial. These criteria included technical feasibility, potential to improve the rate or degree of recovery, the relationship of expected costs to benefits, cost effectiveness, and the potential to restore the ecosystem as a whole. The restoration options considered to be most beneficial will be grouped together in several or more of the above alternatives and presented in a draft restoration plan. They will be further evaluated in a companion draft environmental impact statement

  7. Antibacterial agents in composite restorations for the prevention of dental caries.

    Pereira-Cenci, Tatiana; Cenci, Maximiliano S; Fedorowicz, Zbys; Azevedo, Marina

    2013-12-17

    Dental caries is a multifactorial disease in which the fermentation of food sugars by bacteria from the biofilm (dental plaque) leads to localised demineralisation of tooth surfaces, which may ultimately result in cavity formation. Resin composites are widely used in dentistry to restore teeth. These restorations can fail for a number of reasons, such as secondary caries, and restorative material fracture and other minor reasons. From these, secondary caries, which are caries lesions developed adjacent to restorations, is the main cause for restorations replacement. The presence of antibacterials in both the filling material and the bonding systems would theoretically be able to affect the initiation and progression of caries adjacent to restorations. This is an update of the Cochrane review published in 2009. To assess the effects of antibacterial agents incorporated into composite restorations for the prevention of dental caries. We searched the following electronic databases: the Cochrane Oral Health Group's Trials Register (to 23 July 2013), the Cochrane Central Register of Controlled Trials (CENTRAL) (The Cochrane Library 2013, Issue 6), MEDLINE via OVID (1946 to 23 July 2013) and EMBASE via OVID (1980 to 23 July 2013). We searched the US National Institutes of Health Trials Register (http://clinicaltrials.gov), the metaRegister of Controlled Trials (www.controlled-trials.com) and the World Health Organization International Clinical Trials Registry platform (www.who.int/trialsearch) for ongoing trials. No restrictions were placed on the language or date of publication when searching the electronic databases. Randomised controlled trials comparing resin composite restorations containing antibacterial agents with composite restorations not containing antibacterial agents. Two review authors conducted screening of studies in duplicate and independently, and although no eligible trials were identified, the two authors had planned to extract data independently and

  8. Carbon dynamics in wetland restoration

    Kovalenko, K.; Ciborowski, J.; Gardner-Costa, J.; Slama, C. [Windsor Univ., ON (Canada); Daly, C.; Hornung, J. [Suncor Energy, Calgary, AB (Canada); Dixon, G.; Farwell, A. [Waterloo Univ., ON (Canada); Foote, L.; Frederick, K.; Roy, M. [Alberta Univ., Edmonton, AB (Canada); Liber, K. [Saskatchewan Univ., Saskatoon, SK (Canada); Smits, J. [Calgary Univ., AB (Canada); Wytrykush, C. [Syncrude Canada Ltd., Edmonton, AB (Canada)

    2010-07-01

    This study focused on the reclamation of wetland ecosystems impacted by oil sands development in the boreal wetlands. Although these wetlands play an important role in global carbon balance, their ecosystem function is compromised by direct and regional anthropogenic disturbance and climate change. Large oil sand mining areas that require reclamation generate substantial quantities of extraction process-affected materials. In order to determine if the reclaimed wetlands were restored to equivalent ecosystem function, this study evaluated carbon flows and food web structure in oil sands-affected wetlands. The purpose was to determine whether a prescribed reclamation strategy or topsoil amendment accelerates reclaimed wetland development to produce self-sustaining peatlands. In addition to determining carbon fluxes, this study measured compartment standing stocks for residual hydrocarbons, organic substrate, bacterioplankton, phytoplankton, biofilm, macrophytes, detritus, zoobenthos and aquatic-terrestrial exports. Most biotic 28 compartments differed between oil-sands-affected and reference wetlands, but the difference lessened with age. Macroinvertebrate trophic diversity was lower in oil sands-affected wetlands. Peat amendment seemed to speed convergence for some compartments but not others. These results were discussed in the context of restoration of ecosystem function and optimization of reclamation strategies.

  9. Shame and Guilt in Restorative Justice

    Rodogno, Raffaele

    2008-01-01

    In this article, I examine the relevance and desirability of shame and guilt to restorative justice conferences. I argue that a careful study of the psychology of shame and guilt reveals that both emotions possess traits that can be desirable and traits that can be undesirable for restoration. More...... in particular, having presented the aims of restorative justice, the importance of face-to-face conferences in reaching these aims, the emotional dynamics that take place within such conferences, and the relevant parts of the empirical psychology of shame and guilt, I argue that restorative justice...... practitioners have to take account of a rather more complex picture than it had hitherto been thought. Restorative conferences are not simply about "shame management," though practitioners must certainly avoid shaming and humiliation. Given the nature of shame, guilt, and restorative conferences...

  10. Can Viral Videos Help Beaver Restore Streams?

    Castro, J. M.; Pollock, M. M.; Lewallen, G.; Jordan, C.; Woodruff, K.

    2015-12-01

    Have you watched YouTube lately? Did you notice the plethora of cute animal videos? Researchers, including members of our Beaver Restoration Research team, have been studying the restoration potential of beaver for decades, yet in the past few years, beaver have gained broad acclaim and some much deserved credit for restoration of aquatic systems in North America. Is it because people can now see these charismatic critters in action from the comfort of their laptops? While the newly released Beaver Restoration Guidebook attempts to answer many questions, sadly, this is not one of them. We do, however, address the use of beaver (Castor canadensis) in stream, wetland, and floodplain restoration and discuss the many positive effects of beaver on fluvial ecosystems. Our team, composed of researchers from NOAA National Marine Fisheries Service, US Fish and Wildlife Service, US Forest Service, and Portland State University, has developed a scientifically rigorous, yet accessible, practitioner's guide that provides a synthesis of the best available science for using beaver to improve ecosystem functions. Divided into two broad sections -- Beaver Ecology and Beaver Restoration and Management -- the guidebook focuses on the many ways in which beaver improve habitat, primarily through the construction of dams that impound water and retain sediment. In Beaver Ecology, we open with a discussion of the general effects that beaver dams have on physical and biological processes, and we close with "Frequently Asked Questions" and "Myth Busters". In Restoration and Management, we discuss common emerging restoration techniques and methods for mitigating unwanted beaver effects, followed by case studies from pioneering practitioners who have used many of these beaver restoration techniques in the field. The lessons they have learned will help guide future restoration efforts. We have also included a comprehensive beaver ecology library of over 1400 references from scientific journals

  11. Restoration of variable density film soundtracks

    Hassaïne , Abdelâali; Decencière , Etienne; Besserer , Bernard

    2009-01-01

    Full text available at http://www.eurasip.org/Proceedings/Eusipco/Eusipco2009/contents/papers/1569192297.pdf; International audience; The restoration of motion picture films has been an active research field for many years. The restoration of the soundtrack however has mainly been performed at the audio domain in spite of the fast that it is recorded as a continuous image on the film stock. In this paper, we propose a new restoration method for variable density soundtracks. The method first d...

  12. Landscaping Considerations for Urban Stream Restoration Projects

    Bailey, Pam

    2004-01-01

    ... after restoration and its functionality for public use. The landscaping component of such stream and riparian restoration projects must be emphasized given its importance of visual success and public perception. The purpose of this technical note is to address landscaping considerations associated with urban stream and riparian restoration projects, and provide ideas to managers for enhancing the visual appeal and aesthetic qualities of urban projects.

  13. Conservation and restoration of ornamental elements

    Carmen Rallo Gruss

    1999-12-01

    Full Text Available Intervention on a building as complex and rich in ornamentation as the Palacio del Marqués de Dos Aguas requires special attention as regards the restoration of all the singular elements, both inside and outside, and the different finishes and furnishings. Within this methodology of integral restoration, it is worth pointing out especially the consolidation and cleaning of the emblematic alabaster portal, the restoration of the paintings and the treatment of the different collections of tiles.

  14. Posterior bulk-filled resin composite restorations.

    van Dijken, Jan WV; Pallesen, Ulla

    2016-01-01

    up to 4mm as needed to fill the cavity 2mm short of the occlusal cavosurface. The occlusal part was completed with the nano-hybrid resin composite (Ceram X mono+). In the other cavity, the resin composite-only (Ceram X mono+) was placed in 2mm increments. The restorations were evaluated using...... Class II, 4 SDR-CeramX mono+ and 6 CeramXmono+-only restorations. The main reasons for failurewere tooth fracture (6) and secondary caries (4). The annual failure rate (AFR) for all restorations (Class I and II) was for the bulk-filled-1.1% and for the resin composite-only restorations 1...

  15. Shame and Guilt in Restorative Justice

    Rodogno, Raffaele

    2008-01-01

    In this article, I examine the relevance and desirability of shame and guilt to restorative justice conferences. I argue that a careful study of the psychology of shame and guilt reveals that both emotions possess traits that can be desirable and traits that can be undesirable for restoration. More...... in particular, having presented the aims of restorative justice, the importance of face-to-face conferences in reaching these aims, the emotional dynamics that take place within such conferences, and the relevant parts of the empirical psychology of shame and guilt, I argue that restorative justice...

  16. The land value impacts of wetland restoration.

    Kaza, Nikhil; BenDor, Todd K

    2013-09-30

    U.S. regulations require offsets for aquatic ecosystems damaged during land development, often through restoration of alternative resources. What effect does large-scale wetland and stream restoration have on surrounding land values? Restoration effects on real estate values have substantial implications for protecting resources, increasing tax base, and improving environmental policies. Our analysis focuses on the three-county Raleigh-Durham-Chapel Hill, North Carolina region, which has experienced rapid development and extensive aquatic ecological restoration (through the state's Ecosystem Enhancement Program [EEP]). Since restoration sites are not randomly distributed across space, we used a genetic algorithm to match parcels near restoration sites with comparable control parcels. Similar to propensity score analysis, this technique facilitates statistical comparison and isolates the effects of restoration sites on surrounding real estate values. Compared to parcels not proximate to any aquatic resources, we find that, 1) natural aquatic systems steadily and significantly increase parcel values up to 0.75 mi away, and 2) parcels 0.5 mi from EEP sites gain substantial amenity value. When we control for intervening water bodies (e.g. un-restored streams and wetlands), we find a similar inflection point whereby parcels points to the need for higher public visibility of aquatic ecosystem restoration programs and increased public information about their value. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. Governing Forest Landscape Restoration: Cases from Indonesia

    Cora van Oosten

    2014-05-01

    Full Text Available Forest landscape restoration includes both the planning and implementation of measures to restore degraded forests within the perspective of the wider landscape. Governing forest landscape restoration requires fundamental considerations about the conceptualisation of forested landscapes and the types of restoration measures to be taken, and about who should be engaged in the governance process. A variety of governance approaches to forest landscape restoration exist, differing in both the nature of the object to be governed and the mode of governance. This paper analyses the nature and governance of restoration in three cases of forest landscape restoration in Indonesia. In each of these cases, both the original aim for restoration and the initiators of the process differ. The cases also differ in how deeply embedded they are in formal spatial planning mechanisms at the various political scales. Nonetheless, the cases show similar trends. All cases show a dynamic process of mobilising the landscape’s stakeholders, plus a flexible process of crafting institutional space for conflict management, negotiation and decision making at the landscape level. As a result, the landscape focus changed over time from reserved forests to forested mosaic lands. The cases illustrate that the governance of forest landscape restoration should not be based on strict design criteria, but rather on a flexible governance approach that stimulates the creation of novel public-private institutional arrangements at the landscape level.

  18. The Use of Nerve Transfers to Restore Upper Extremity Function in Cervical Spinal Cord Injury.

    Fox, Ida K; Novak, Christine B; Krauss, Emily M; Hoben, Gwendolyn M; Zaidman, Craig; Ruvinskaya, Rimma; Juknis, Neringa; Winter, Anke C; Mackinnon, Susan E

    2018-03-15

    Nerve transfer surgery to restore upper extremity function in cervical spinal cord injury (SCI) is novel and may transform treatment. Determining candidacy even years post-SCI is ill defined and deserves investigation. To develop a diagnostic algorithm, focusing on electrodiagnostic (EDX) studies, to determine eligibility for nerve transfer surgery. Retrospective descriptive case series. Tertiary university-based institution. Individuals with cervical SCI (n = 45). The electronic medical records of people referred to the Plastic Surgery Multidisciplinary Upper Extremity Surgery unit in the SCI clinic from 2010-2015 were reviewed. People were considered for nerve transfers to restore elbow extension or finger flexion and/or extension. Data including demographic, clinical evaluation, EDX results, surgery, and outcomes were collected and analyzed. EDX data, including nerve conduction studies and electromyography, for bilateral upper extremities of each patient examined was used to assess for the presence of lower motor neuron injury, which would preclude late nerve transfer. Based on our criteria and the results of EDX testing, a substantial number of patients presenting even years post-SCI were candidates for nerve transfers. Clinical outcome results are heterogeneous but promising and suggest that further refinement of eligibility, long-term follow-up, and standardized assessment will improve our understanding of the role of nerve transfer surgery to restore function in people with midcervical SCI. Many patients living with SCI are candidates for nerve transfer surgery to restore upper extremity function. Although the ultimate efficacy of these surgeries is not yet determined, this study attempts to report the criteria we are using and may ultimately determine the timing for intervention and which transfers are most useful for this heterogeneous population. IV. Copyright © 2018 American Academy of Physical Medicine and Rehabilitation. Published by Elsevier Inc. All

  19. Forward-looking farmers owning multiple potential wetland restoration sites: implications for efficient restoration

    Schroder (Kushch), Svetlana; Lang, Zhengxin; Rabotyagov, Sergey

    2018-04-01

    Wetland restoration can increase the provision of multiple non-market ecosystem services. Environmental and socio-economic factors need to be accounted for when land is withdrawn from agriculture and wetlands are restored. We build multi-objective optimization models to provide decision support for wetland restoration in the Le Sueur river watershed in Southern Minnesota. We integrate environmental objectives of sediment reduction and habitat protection with socio-economic factors associated with the overlap of private land with potential wetland restoration sites in the watershed and the costs representing forward-looking farmers voluntarily taking land out of agricultural production in favor of wetland restoration. Our results demonstrate that the inclusion of these factors early on in the restoration planning process affects both the total costs of the restoration project and the spatial distribution of optimally selected wetland restoration sites.

  20. Anterior provisional restorations used to determine form, function, and esthetics for complex restorative situations, using all-ceramic restorative systems.

    Reshad, Mamaly; Cascione, Domenico; Kim, Tae

    2010-02-01

    A technique is proposed for the restoration of a large and visible maxillary anterior defect. The importance of proper diagnosis, treatment planning, and communication is emphasized. Irreversible treatment should only be rendered once patient approval has been obtained through objective evaluation with provisional restorations. The techniques presented in this article use a combination of ceramic systems currently available to satisfy functional demands while achieving acceptable esthetics. A controlled series of steps, where the provisional restorative components are being replaced by the definitive ones is planned. The only difference between the provisional and definitive restorative components is the material used. The definitive restorations consisted of an implant-supported zirconium oxide framework. Individual pressed porcelain restorations were luted to the framework and a natural tooth. CLINICAL SIGNIFICANCE Provisional restorations allow an objective form of communication. Vertical and horizontal transitional lines can be effectively masked with appropriate treatment planning and a skilled ceramist. Many traditional dental laboratory steps may be eliminated or simplified without compromising the definitive restorations.

  1. Ecological restoration success is higher for natural regeneration than for active restoration in tropical forests

    Crouzeilles, Renato; Ferreira, Mariana S.; Chazdon, Robin L.; Lindenmayer, David B.; Sansevero, Jerônimo B. B.; Monteiro, Lara; Iribarrem, Alvaro; Latawiec, Agnieszka E.; Strassburg, Bernardo B. N.

    2017-01-01

    Is active restoration the best approach to achieve ecological restoration success (the return to a reference condition, that is, old-growth forest) when compared to natural regeneration in tropical forests? Our meta-analysis of 133 studies demonstrated that natural regeneration surpasses active restoration in achieving tropical forest restoration success for all three biodiversity groups (plants, birds, and invertebrates) and five measures of vegetation structure (cover, density, litter, biom...

  2. BAYESIAN IMAGE RESTORATION, USING CONFIGURATIONS

    Thordis Linda Thorarinsdottir

    2011-05-01

    Full Text Available In this paper, we develop a Bayesian procedure for removing noise from images that can be viewed as noisy realisations of random sets in the plane. The procedure utilises recent advances in configuration theory for noise free random sets, where the probabilities of observing the different boundary configurations are expressed in terms of the mean normal measure of the random set. These probabilities are used as prior probabilities in a Bayesian image restoration approach. Estimation of the remaining parameters in the model is outlined for salt and pepper noise. The inference in the model is discussed in detail for 3 X 3 and 5 X 5 configurations and examples of the performance of the procedure are given.

  3. Clinch River Environmental Restoration Program

    Cook, R.B.

    1992-01-01

    This report consists of tables and listings from the results of the Phase I data gathering activities of the Clinch River Environmental Restoration Program (CR-ERP). The table of contents outlines the presentation of the material and has been annotated to indicate the key fields used to order the printing of each data table. Definitions of selected column headings are provided. Sample collection information is shown first and then more specific information for each matrix type is presented. The analytical results have been reviewed by independent validators and the qualifiers shown are the results of their efforts. No data that were rejected by the validation process are included in this listing. Only results of routine samples are listed; quality control sample results were excluded. All data, both detected and nondetected values, were used to calculated the summary table values. However, only Detected values are given on the analyte specific listings

  4. 75 FR 32877 - Financial Assistance: Wildlife Restoration, Sport Fish Restoration, Hunter Education and Safety

    2010-06-10

    ... resources, aquatic-life forms, and sport fishing; and (e) develop responsible attitudes and ethics toward..., Sport Fish Restoration, Hunter Education and Safety AGENCY: Fish and Wildlife Service, Interior. ACTION... governing the Wildlife Restoration, Sport Fish Restoration, and Hunter Education and Safety (Enhanced Hunter...

  5. Restorative Mediation: The Application of Restorative Justice Practice and Philosophy to Clergy Sexual Abuse Cases

    Noll, Douglas E.; Harvey, Linda

    2008-01-01

    This article will present the restorative justice model and examine how the restorative justice philosophy and process can be applied to clergy-perpetrated sexual abuse and religious sexual misconduct to resolve legal claims and allow the process of healing to begin. Restorative justice is a holistic approach to criminal, civil, and church law…

  6. 15 CFR 990.53 - Restoration selection-developing restoration alternatives.

    2010-01-01

    ... OIL POLLUTION ACT REGULATIONS NATURAL RESOURCE DAMAGE ASSESSMENTS Restoration Planning Phase § 990.53... justify restoration, trustees may proceed with the Restoration Planning Phase. Otherwise, trustees may not... discount all service quantities and/or values to the date the demand is presented to the responsible...

  7. 24 CFR 982.628 - Homeownership option: Eligible units.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Homeownership option: Eligible units. 982.628 Section 982.628 Housing and Urban Development Regulations Relating to Housing and Urban... Types Homeownership Option § 982.628 Homeownership option: Eligible units. (a) Initial requirements...

  8. 34 CFR 691.17 - Determination of eligible majors.

    2010-07-01

    ... ACCESS TO RETAIN TALENT GRANT (NATIONAL SMART GRANT) PROGRAMS Application Procedures § 691.17... list of eligible majors identified by CIP code. (d) Designation of an additional eligible major. (1... include— (i) The CIP code and program title of the additional major; (ii) The reason or reasons the...

  9. 9 CFR 54.3 - Animals eligible for indemnity payments.

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animals eligible for indemnity payments. 54.3 Section 54.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... SCRAPIE Scrapie Indemnification Program § 54.3 Animals eligible for indemnity payments. (a) Indemnity may...

  10. 5 CFR 9901.323 - Eligibility for general salary increase.

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Eligibility for general salary increase... NATIONAL SECURITY PERSONNEL SYSTEM (NSPS) Pay and Pay Administration Rate Ranges and General Salary Increases § 9901.323 Eligibility for general salary increase. (a) Employees with a current rating of record...

  11. 34 CFR 21.20 - Types of eligible applicants.

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Types of eligible applicants. 21.20 Section 21.20 Education Office of the Secretary, Department of Education EQUAL ACCESS TO JUSTICE How Is Eligibility... employees. (d) A cooperative association— (1) As defined in section 15(a) of the Agricultural Marketing Act...

  12. 32 CFR 99.5 - Eligibility for indemnification.

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Eligibility for indemnification. 99.5 Section 99.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN PROCEDURES FOR STATES AND LOCALITIES TO REQUEST INDEMNIFICATION § 99.5 Eligibility for...

  13. The Administration of Eligibility for Community Long-Term Care.

    Leutz, Walter; And Others

    1993-01-01

    Eligibility assessment systems for community long-term care vary widely across programs funded by states and Medicaid and in proposals to expand federal funding. Improved equity and efficiency will require better specification of eligibility criteria, timing and setting of assessments, language of assessment items, training of assessors,…

  14. 24 CFR 1005.107 - What is eligible collateral?

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What is eligible collateral? 1005... URBAN DEVELOPMENT LOAN GUARANTEES FOR INDIAN HOUSING § 1005.107 What is eligible collateral? (a) In general. A loan guaranteed under section 184 may be secured by any collateral authorized under and not...

  15. 5 CFR 335.104 - Eligibility for career ladder promotion.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Eligibility for career ladder promotion... REGULATIONS PROMOTION AND INTERNAL PLACEMENT General Provisions § 335.104 Eligibility for career ladder promotion. No employee shall receive a career ladder promotion unless his or her current rating of record...

  16. 45 CFR 1308.15 - Eligibility criteria: Autism.

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Eligibility criteria: Autism. 1308.15 Section 1308... Services Performance Standards § 1308.15 Eligibility criteria: Autism. A child is classified as having autism when the child has a developmental disability that significantly affects verbal and non-verbal...

  17. 28 CFR 545.25 - Eligibility for performance pay.

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Eligibility for performance pay. 545.25... WORK AND COMPENSATION Inmate Work and Performance Pay Program § 545.25 Eligibility for performance pay. (a) An inmate may receive performance pay for accomplishments in one or more of the following areas...

  18. 14 CFR 152.109 - Project eligibility: Airport planning.

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Project eligibility: Airport planning. 152....109 Project eligibility: Airport planning. (a) Airport master planning. A proposed project for airport master planning is not approved unless— (1) The location of the existing or proposed airport is included...

  19. 12 CFR 926.3 - Housing associate eligibility requirements.

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Housing associate eligibility requirements. 926.3 Section 926.3 Banks and Banking FEDERAL HOUSING FINANCE BOARD FEDERAL HOME LOAN BANK MEMBERS AND HOUSING ASSOCIATES FEDERAL HOME LOAN BANK HOUSING ASSOCIATES § 926.3 Housing associate eligibility...

  20. 19 CFR 212.04 - Eligibility of applicants.

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Eligibility of applicants. 212.04 Section 212.04 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT General Provisions § 212.04 Eligibility of...

  1. 12 CFR 926.4 - Satisfaction of eligibility requirements.

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Satisfaction of eligibility requirements. 926.4 Section 926.4 Banks and Banking FEDERAL HOUSING FINANCE BOARD FEDERAL HOME LOAN BANK MEMBERS AND HOUSING ASSOCIATES FEDERAL HOME LOAN BANK HOUSING ASSOCIATES § 926.4 Satisfaction of eligibility requirements. (a...

  2. 10 CFR 490.804 - Eligible reductions in petroleum consumption.

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Eligible reductions in petroleum consumption. 490.804... Alternative Compliance § 490.804 Eligible reductions in petroleum consumption. (a) Motor vehicles. Demonstrated reductions in petroleum consumption during the model year for which a waiver is requested that are...

  3. 13 CFR 315.6 - Firm eligibility for Adjustment Assistance.

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Firm eligibility for Adjustment..., DEPARTMENT OF COMMERCE TRADE ADJUSTMENT ASSISTANCE FOR FIRMS General Provisions § 315.6 Firm eligibility for Adjustment Assistance. (a) Firms participate in the Trade Adjustment Assistance for Firms program in...

  4. 12 CFR 263.103 - Eligibility of applicants.

    2010-01-01

    ... will be presumed to have been made for this purpose. (3) The net worth of a financial institution shall... guidelines on the financial institution's financial report to its supervisory agency for the last reporting....103 Eligibility of applicants. (a) General rule. To be eligible for an award under this subpart, an...

  5. 45 CFR 1308.16 - Eligibility criteria: Traumatic brain injury.

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Eligibility criteria: Traumatic brain injury. 1308... DISABILITIES Health Services Performance Standards § 1308.16 Eligibility criteria: Traumatic brain injury. A child is classified as having traumatic brain injury whose brain injuries are caused by an external...

  6. 44 CFR 78.12 - Eligible types of projects.

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY INSURANCE AND HAZARD MITIGATION National Flood Insurance Program FLOOD MITIGATION ASSISTANCE § 78.12 Eligible types of projects. The following types of projects are eligible for.... (g) Minor physical flood mitigation projects that reduce localized flooding problems and do not...

  7. 13 CFR 120.612 - Loans eligible to back Certificates.

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Loans eligible to back Certificates. 120.612 Section 120.612 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Certificates § 120.612 Loans eligible to back Certificates. (a) Pool Certificates...

  8. 24 CFR 1003.201 - Basic eligible activities.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Basic eligible activities. 1003.201... Activities § 1003.201 Basic eligible activities. ICDBG funds may be used for the following activities: (a... interest rates and mortgage principal amounts for low-and moderate-income homebuyers; (2) Finance the...

  9. 34 CFR 303.4 - Limitation on eligible children.

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Limitation on eligible children. 303.4 Section 303.4 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION... eligible children. This part 303 does not apply to any child with disabilities receiving a free appropriate...

  10. 76 FR 4550 - Income Level for Individuals Eligible for Assistance

    2011-01-26

    ... LEGAL SERVICES CORPORATION 45 CFR Part 1611 Income Level for Individuals Eligible for Assistance... (``Corporation'') is required by law to establish maximum income levels for individuals eligible for legal assistance. This document updates the specified income levels to reflect the annual amendments to the Federal...

  11. 77 FR 4909 - Income Level for Individuals Eligible for Assistance

    2012-02-01

    ... LEGAL SERVICES CORPORATION 45 CFR Part 1611 Income Level for Individuals Eligible for Assistance... (``Corporation'') is required by law to establish maximum income levels for individuals eligible for legal assistance. This document updates the specified income levels to reflect the annual amendments to the Federal...

  12. 78 FR 7679 - Income Level for Individuals Eligible for Assistance

    2013-02-04

    ... LEGAL SERVICES CORPORATION 45 CFR Part 1611 Income Level for Individuals Eligible for Assistance... (``Corporation'') is required by law to establish maximum income levels for individuals eligible for legal assistance. This document updates the specified income levels to reflect the annual amendments to the Federal...

  13. 76 FR 5289 - Income Level for Individuals Eligible for Assistance

    2011-01-31

    ... LEGAL SERVICES CORPORATION 45 CFR Part 1611 Income Level for Individuals Eligible for Assistance... Corporation (``Corporation'') is required by law to establish maximum income levels for individuals eligible for legal assistance. This document updates the specified income levels to reflect the annual...

  14. 75 FR 47487 - Income Level for Individuals Eligible for Assistance

    2010-08-06

    ... LEGAL SERVICES CORPORATION 45 CFR Part 1611 Income Level for Individuals Eligible for Assistance... (``Corporation'') is required by law to establish maximum income levels for individuals eligible for legal assistance. This document updates the specified income levels to reflect the annual amendments to the Federal...

  15. The electricity market in Croatia and eligible customers

    Kucic, D.; Baric, A.; Tomasic-Skevin, S.

    2003-01-01

    The paper first presents the model and main characteristics of the Croatian electricity market concerning eligible customers. The first phase of the market opening and the estimated inclusion of eligible customers as well as independent suppliers are also described. Presumed steps of opening of the electricity market are given.(author)

  16. 47 CFR 90.115 - Foreign government and alien eligibility.

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Foreign government and alien eligibility. 90... government and alien eligibility. (a) No station authorization in the radio services governed by this part....9(c) of this chapter) if such entity is: (1) An alien or the representative of any alien; (2) A...

  17. 45 CFR 1626.5 - Alien status and eligibility.

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Alien status and eligibility. 1626.5 Section 1626... RESTRICTIONS ON LEGAL ASSISTANCE TO ALIENS § 1626.5 Alien status and eligibility. Subject to all other... may provide legal assistance to an alien who is present in the United States and who is within one of...

  18. 49 CFR 22.27 - Eligible reimbursements to participating lenders.

    2010-10-01

    ... reimbursement. Prior written approval from DOT OSDBU is required. Attorney fees will be reimbursed on a pro-rata... 49 Transportation 1 2010-10-01 2010-10-01 false Eligible reimbursements to participating lenders... PROGRAM (STLP) Participating Lenders § 22.27 Eligible reimbursements to participating lenders...

  19. 7 CFR 760.305 - Eligible grazing losses.

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligible grazing losses. 760.305 Section 760.305... grazing losses. (a) A grazing loss due to drought is eligible for LFP only if the grazing loss for the... period for the specific type of grazing land or pastureland for the county.) (b) A grazing loss is not...

  20. 42 CFR 495.104 - Incentive payments to eligible hospitals.

    2010-10-01

    ... denominator of the Medicare share fraction using the charity care charges reported on the hospital's Medicare... eligible hospital's charges, not including any charges that are attributable to charity care, divided by... 42 Public Health 5 2010-10-01 2010-10-01 false Incentive payments to eligible hospitals. 495.104...

  1. 7 CFR 3570.61 - Eligibility for grant assistance

    2010-01-01

    ... rural area, and the median household income of the population to be served by the proposed facility must be below the higher of the poverty line or the eligible percentage (60, 70, 80, or 90) of the State nonmetropolitan median household income (see § 3570.63(b)). (a) Eligible applicant. An applicant must be a: (1...

  2. 15 CFR 923.93 - Eligible implementation costs.

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Eligible implementation costs. 923.93... MANAGEMENT COASTAL ZONE MANAGEMENT PROGRAM REGULATIONS Applications for Program Development or Implementation Grants § 923.93 Eligible implementation costs. (a) Costs claimed must be beneficial and necessary to the...

  3. 7 CFR 1424.4 - General eligibility rules.

    2010-01-01

    ... OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS BIOENERGY PROGRAM § 1424.4 General eligibility... be eligible for program payments, a producer must maintain records indicating for all relevant FY's.... (d) For producers not purchasing raw commodity inputs, the production must equal or exceed that...

  4. 49 CFR 37.123 - ADA paratransit eligibility: Standards.

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA... complementary paratransit service shall provide the service to the ADA paratransit eligible individuals...

  5. 49 CFR 37.125 - ADA paratransit eligibility: Process.

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Process. 37.125... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.125 ADA... § 37.121 of this part shall establish a process for determining ADA paratransit eligibility. (a) The...

  6. 12 CFR 652.35 - Eligible non-program investments.

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Eligible non-program investments. 652.35... MORTGAGE CORPORATION FUNDING AND FISCAL AFFAIRS Investment Management § 652.35 Eligible non-program investments. (a) You may hold only the types, quantities, and qualities of non-program investments listed in...

  7. SSI and the Environmental Code

    Loefgren, T.

    1997-12-01

    Radiation is, to some extent, included in the environmental code being prepared by the government. As a consequence both the Radiation Protection Institute and the proposed Environmental Court may set legal conditions concerning radiation protection for the proponent. Legal and other matters related to this issue are discussed in the report

  8. Mechanical site preparation for forest restoration

    Magnus Lof; Daniel C. Dey; Rafael M. Navarro; Douglass F. Jacobs

    2012-01-01

    Forest restoration projects have become increasingly common around the world and planting trees is almost always a key component. Low seedling survival and growth may result in restoration failures and various mechanical site preparation techniques for treatment of soils and vegetation are important tools used to help counteract this. In this article, we synthesize the...

  9. Nuclear plant requirements during power system restoration

    Adamski, G.; Jenkins, R.; Gill, P.

    1995-01-01

    This paper is one of a series presented on behalf of the System Operation Subcommittee with the intent of focusing industry attention on power system restoration issues. This paper discusses a number of nuclear power plant requirements that require special attention during power system restoration

  10. Changing trends in hair restoration surgery

    Venkataram Mysore

    2006-01-01

    Full Text Available Androgenetic alopecia is an important and common cause for baldness. Despite recent advances, the drug therapy of this condition remains unsatisfactory. Surgical hair restoration is the only permanent method of treating this condition. Introduction of recent techniques such as follicular unit transplantation have improved the cosmetic results and patient satisfaction. This article discusses the latest trends in hair restoration surgery.

  11. Psychological Restoration Practices among College Students

    Altaher, Yara; Runnerstrom, Miryha G.

    2018-01-01

    This study investigates the restoration practices and the different types of environments sought out by college students during times of stress and also explores the potential for restorative experiences in built environments. In February 2015, 407 matriculated undergraduates at a large public research university voluntarily participated in this…

  12. Restoring Nature: Human Actions, Interactions and reactions

    Paul H. Gobster

    2000-01-01

    Regardless of one's viewpoint, the conflict that erupted in the spring of 1996 and became known as the Chicago restoration controversy has left an indelible mark on the region's environmental community and has forever changed the way those involved will think about restoration. Its implications extend far beyond Chicago; since its inception, the controversy...

  13. Plant succession and approaches to community restoration

    Bruce A. Roundy

    2005-01-01

    The processes of vegetation change over time, or plant succession, are also the processes involved in plant community restoration. Restoration efforts attempt to use designed disturbance, seedbed preparation and sowing methods, and selection of adapted and compatible native plant materials to enhance ecological function. The large scale of wildfires and weed invasion...

  14. The restoration lines; Les chaines de restauration

    NONE

    2001-07-01

    This conference allowed the restoration sector to discover the advantages of the gas energy for cooking: a cheaper cost, a adequate technology for a maximum of efficiency and safety. Gaz De France presents a great interest in this restoration sector and will continue to invest on this market in the future. (A.L.B.)

  15. Transformational restoration: novel ecosystems in Denmark

    John A. Stanturf; Palle Madsen; Khosro Sagheb-Talebi; Ole K. Hansen

    2018-01-01

    Restoring the estimated 1 billion hectares of degraded forests must consider future climate accompanied by novel ecosystems. Transformational restoration can play a key role in adaptation to climate change but it is conceptually the most divergent from contemporary approaches favoring native species and natural disturbance regimes. Here...

  16. Restoration of the endodontically treated posterior tooth

    Andrea Polesel

    2014-06-01

    Results and conclusions: Direct adhesive restorations, indirect bonded restorations and traditional full crown are three therapeutic options for the single posterior endodontically treated teeth. The amount of remaining sound tooth structure is the most significant factor influencing the therapeutic approach. The clinician's operative skill is a determining aspect for long-term success of adhesive inlays.

  17. Restorative Justice: A Changing Community Response

    Ryan, Thomas G.; Ruddy, Sean

    2015-01-01

    Our purpose herein is to demonstrate how restorative justice continues to unfold globally and we explain how the use of a restorative justice ideology and intervention leads to a common alternative, not only in criminal justice institutions, but also within social agencies, such as elementary schools, and the related social support systems. We…

  18. Wetland restoration, flood pulsing, and disturbance dynamics

    Middleton, Beth A.

    1999-01-01

    While it is generally accepted that flood pulsing and disturbance dynamics are critical to wetland viability, there is as yet no consensus among those responsible for wetland restoration about how best to plan for those phenomena or even whether it is really necessary to do so at all. In this groundbreaking book, Dr. Beth Middleton draws upon the latest research from around the world to build a strong case for making flood pulsing and disturbance dynamics integral to the wetland restoration planning process.While the initial chapters of the book are devoted to laying the conceptual foundations, most of the coverage is concerned with demonstrating the practical implications for wetland restoration and management of the latest ecological theory and research. It includes a fascinating case history section in which Dr. Middleton explores the restoration models used in five major North American, European, Australian, African, and Asian wetland projects, and analyzes their relative success from the perspective of flood pulsing and disturbance dynamics planning.Wetland Restoration also features a wealth of practical information useful to all those involved in wetland restoration and management, including: * A compendium of water level tolerances, seed germination, seedling recruitment, adult survival rates, and other key traits of wetland plant species * A bibliography of 1,200 articles and monographs covering all aspects of wetland restoration * A comprehensive directory of wetland restoration ftp sites worldwide * An extensive glossary of essential terms

  19. 43 CFR 11.21 - Emergency restorations.

    2010-10-01

    ... Preassessment Phase § 11.21 Emergency restorations. (a) Reporting requirements and definition. (1) In the event of a natural resource emergency, the natural resource trustee shall contact the National Response... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Emergency restorations. 11.21 Section 11...

  20. Restoring forest ecosystems: the human dimension

    Bruce R. Hull; Paul H. Gobster

    2000-01-01

    In the past two decades, ecological restoration has moved from an obscure and scientifically suspect craft to a widely practiced and respected profession with considerable scientific knowledge and refined on-the-ground practices. Concurrently, forest restoration has become a valued skill of forestry professionals and a popular goal for forest management. Politics and...

  1. SKI's and SSI's comments on SKB's RandD/RDandD Programme 1986-2007; SKI:s och SSI:s synpunkter paa SKB:s FoU/Fud-program 1986-2007

    Toverud, Oeivind (Bromma Geokonsult (Sweden))

    2010-10-15

    SKB has since 1986 submitted RDandD program every three years to former Nuclear Power Inspectorate (SKI) for review and evaluation. SKI and former Radiation Protection Inst. (SSI) have commented on a large number of issues in connection with the audits. The authorities' goal has been to influence the SKB's design of the RDandD programs, inter alia with a view to future repository applications to fulfill the requirements they are tested against. SKB plans to submit applications for the final repository for spent Fuel first quarter of 2011 and it is therefore important for Radiation Safety Authority (SSM) to follow up on SKB's handling of critical comments on RDandD programs. A starting point for this monitoring is to establish how SKB has dealt with major issues raised by authorities in the audits of the RDandD programs and in consultation process which has been linked to the programs. The follow-up is expected to be an important contribution to the planning and implementation of the examination of applications for nuclear fuel repository

  2. Restoration of traumatized teeth with resin composites

    Pallesen, Ulla; van Dijken, Jan WV

    2018-01-01

    For a long time, the primary choice for initial restoration of a crown-fractured front tooth has been resin composite material. The restoration can in most cases be performed immediately after injury if there is no sign of periodontal injury. The method’s adhesive character is conservative to tooth...... present an aesthetic problem due to exposure of un-aesthetic crown-margins. The invasive permanent crown restorations are therefore often not suc-cessful on a long-term scale. On the other hand, a conservative direct restoration of an extensively fractured incisor crown with resin composite may......-structure and with minimal risk of pulpal complication. In addition, it offers an aesthetic solution to the patient immediately after an injury, which may bring a little comfort in a sad situation. The resin composite build-up is often changed or repaired a couple of times, before the tooth is restored with a porcelain...

  3. Infrastructure system restoration planning using evolutionary algorithms

    Corns, Steven; Long, Suzanna K.; Shoberg, Thomas G.

    2016-01-01

    This paper presents an evolutionary algorithm to address restoration issues for supply chain interdependent critical infrastructure. Rapid restoration of infrastructure after a large-scale disaster is necessary to sustaining a nation's economy and security, but such long-term restoration has not been investigated as thoroughly as initial rescue and recovery efforts. A model of the Greater Saint Louis Missouri area was created and a disaster scenario simulated. An evolutionary algorithm is used to determine the order in which the bridges should be repaired based on indirect costs. Solutions were evaluated based on the reduction of indirect costs and the restoration of transportation capacity. When compared to a greedy algorithm, the evolutionary algorithm solution reduced indirect costs by approximately 12.4% by restoring automotive travel routes for workers and re-establishing the flow of commodities across the three rivers in the Saint Louis area.

  4. Techniques of forest restoration in restingas

    Liliane Garcia da Silva Morais Rodrigues

    2016-03-01

    Full Text Available Restinga is an ecosystem of the Atlantic Forest Biome vegetation which has ecological functions and is undergoing anthropogenic occupations that result in the disturbance and its suppression of these environments. But to be the restoration of degraded restinga is necessary to know the different formations of the ecosystem and their respective characteristics. From this diagnosis, one can choose the most appropriate techniques to apply for its restoration. Thus, this study aims to conduct a literature on restoration techniques in restinga environments. It was found that forest restoration on restinga, in most cases there is use of natural regeneration techniques nucleation, and these studies highlight the successional advances and establishments of life forms preserved features of the area, thus making the restoration in these environments.

  5. Restoration and repair of Earth's damaged ecosystems.

    Jones, Holly P; Jones, Peter C; Barbier, Edward B; Blackburn, Ryan C; Rey Benayas, Jose M; Holl, Karen D; McCrackin, Michelle; Meli, Paula; Montoya, Daniel; Mateos, David Moreno

    2018-02-28

    Given that few ecosystems on the Earth have been unaffected by humans, restoring them holds great promise for stemming the biodiversity crisis and ensuring ecosystem services are provided to humanity. Nonetheless, few studies have documented the recovery of ecosystems globally or the rates at which ecosystems recover. Even fewer have addressed the added benefit of actively restoring ecosystems versus allowing them to recover without human intervention following the cessation of a disturbance. Our meta-analysis of 400 studies worldwide that document recovery from large-scale disturbances, such as oil spills, agriculture and logging, suggests that though ecosystems are progressing towards recovery following disturbances, they rarely recover completely. This result reinforces conservation of intact ecosystems as a key strategy for protecting biodiversity. Recovery rates slowed down with time since the disturbance ended, suggesting that the final stages of recovery are the most challenging to achieve. Active restoration did not result in faster or more complete recovery than simply ending the disturbances ecosystems face. Our results on the added benefit of restoration must be interpreted cautiously, because few studies directly compared different restoration actions in the same location after the same disturbance. The lack of consistent value added of active restoration following disturbance suggests that passive recovery should be considered as a first option; if recovery is slow, then active restoration actions should be better tailored to overcome specific obstacles to recovery and achieve restoration goals. We call for a more strategic investment of limited restoration resources into innovative collaborative efforts between scientists, local communities and practitioners to develop restoration techniques that are ecologically, economically and socially viable. © 2018 The Author(s).

  6. Fracture Resistance and Failure Mode of Endodontically Treated Premolars Restored with Different Adhesive Restorations

    Nasrin Sarabi

    2015-03-01

    Full Text Available Introduction: The restoration of endodontically treated teeth is a topic that has been studied extensively but it is still a challenge for dental practitioners. The aim of this study was to evaluate fracture resistance, fracture patterns and fracture location of endodontically treated human maxillary premolars restored with direct and indirect composite resin and ceramic restoration. Methods: Eighty non-carious maxillary premolars were selected and divided into four groups (n=20. Endodontic treatment and mesio-occluso-distal preparations were carried out in all the groups except for the control group (group I. Subsequently, the prepared teeth were restored as follows: group II: indirect composite restoration; group III: ceramic restoration; group IV: direct composite restoration. The specimens were subjected to compressive axial loading until fracture occurred. The mode of failure was also recorded. Results: Group I had higher fracture resistance (1196.82±241.74 than the other groups (P

  7. Environnmental Restoration and Waste Management

    1991-08-01

    In the first Five-Year Plan, written in 1989, the Department of Energy (DOE) committed to rapidly bringing all operating facilities into compliance with applicable laws and regulations and to cleaning up the 1989 inventory of contaminated inactive sites and facilities by the year 2019. This FY 1993--1997 Five-Year Plan moves the Office of Environmental Restoration and Waste Management (EM) one step closer to this 30-year goal. The overall EM strategy has three thrusts. First, where risk assessment shows an actual or potential threat to human health and safety -- do immediately whatever is possible to reduce, mitigate, stabilize, and confine the threat. Second, where nobody knows how to solve a problem (as distinct from merely preventing it from getting worse) -- act decisively to develop methods to do it right the first time. Third, where compliance and cleanup must proceed with or without next-generation technologies -- plan, with affected parties and within the provisions of Interagency Agreements, the work to be accomplished and its schedule. This third Five-Year Plan discusses current EM program accomplishments, what the program intends to achieve over the next 5 years, and where it needs to be heading in order to meet its 30-year and other environmental goals

  8. Environmental restoration and waste management

    Middleman, L.I.

    1989-01-01

    The purpose of this Five-Year Plan is to establish an agenda for compliance and cleanup against which progress will be measured. DOE is committed to an open and participatory process for developing a national priority system for expenditure of funds. This system will be based on scientific principles and risk reduction in terms that are understandable to the public. The Plan will be revised annually, with a five-year planning horizon. For FY 1991--1995, this Plan encompasses total program activities and costs for DOE Corrective Activities, Environmental Restoration, Waste Management Operations, and Applied R ampersand D. It addresses hazardous wastes, radioactive wastes, mixed wastes (radioactive and hazardous), and sanitary wastes. It also addresses facilities and sites contaminated with or used in the management of those wastes. The Plan does not include the Safety and Health Program (Office of the Assistant Secretary for Environment, Safety, and Health) or programs of the Office of Civilian Radioactive Waste Management. It does include the annual Defense Programs contribution to the Nuclear Waste Fund for disposal of defense high-level waste and research toward characterizing the defense waste form for repository disposal

  9. Hydrological classification, a practical tool for mangrove restoration

    Loon, van Anne F.; Brake, te Bram; Huijgevoort, Van Marjolein H.J.; Dijksma, Roel

    2016-01-01

    Mangrove restoration projects, aimed at restoring important values of mangrove forests after degradation, often fail because hydrological conditions are disregarded. We present a simple, but robust methodology to determine hydrological suitability for mangrove species, which can guide restoration

  10. Genetic analysis of fertility restoration under CGMS system in rice ...

    restore complete fertility of a certain CMS line by various restorer lines (Tan et ... Keywords. rice; heterosis; three-way test cross; fertility restoration genetics. Journal of ..... plants indicating a strong genetic load of maintenance in. DE2. Table 8.

  11. Atraumatic restorative treatment in atypical cavities

    Letícia Simino Carvalho

    2009-10-01

    Full Text Available The atraumatic restorative treatment has been widely divulged among professionals in the area of Pediatric Dentistry. This restorative technique is included in the philosophy of Minimal Intervention and is considered one of the most conservative treatments, because only the layer of infected dentin caries is removed. Moreover, the atraumatic restorative treatment has been shown to be less painful than conventional approaches, and local anesthesia is rarely required. After the removal of the infected dentin, the cavities are filled with glass ionomer cement, a material that has antimicrobial capacity, good marginal sealing and constant fluorine release and recharge. In spite of the increasing number of studies about atraumatic restorative treatment, only studies related to restorations in occlusal cavities have shown scientific evidences about the technique. The aim of this study was to evaluate the feasibility of atraumatic restorative treatment in cavities with 3 or more surfaces involved, by means of a clinical case report of a patient with extensive dstruction in primary teeth, who was submitted to atraumatic restorative treatment, and observe the result of the treatment after one year of clinical and radiographic control.

  12. Integrating ecological restoration into CDM forestry projects

    Ma, Maohua; Haapanen, Toni; Singh, Ram Babu; Hietala, Reija

    2014-01-01

    Highlights: • Concerns and issues in sustainability of CDM forestry projects are reviewed. • Ecological restoration is suggested to be integrated in the CDM framework. • As an ecosystem supporting service, soil restoration on degraded land is of primary importance. • Regenerating forests naturally rather than through monoculture plantations is suggested. • Potential social impacts of ecological restoration are discussed. - Abstract: The Clean Development Mechanism (CDM) is proposed to reduce greenhouse gas emissions and promote sustainable development. CDM forestry projects should contribute to mitigation of climate change through afforestation and reforestation (A/R) activities on degraded land in developing countries. However, like other types of CDM projects, the forestry projects have encountered a number of concerns and critiques. Appropriate approaches and concrete aims to achieve long-term sustainability have been lacking, and reforms have therefore been called for. The aims of this paper are to examine the published information relevant to these concerns, and frame appropriate approaches for a more sustainable CDM. In this review, as a first step to tackle some of these issues, ecological restoration is suggested for integration into the CDM framework. Essentially, this involves the restoration of ecosystem supporting service (soil restoration), upon which forests regenerate naturally rather than establishing monoculture plantations. In this way, forestry projects would bring cost-effective opportunities for multiple ecosystem services. Potential approaches, necessary additions to the monitoring plans, and social impacts of ecological restoration in CDM projects are discussed

  13. Restoration of biogeochemical function in mangrove forests

    McKee, K.L.; Faulkner, P.L.

    2000-01-01

    Forest structure of mangrove restoration sites (6 and 14 years old) at two locations (Henderson Creek [HC] and Windstar [WS]) in southwest Florida differed from that of mixed-basin forests (>50 years old) with which they were once contiguous. However, the younger site (HC) was typical of natural, developing forests, whereas the older site (WS) was less well developed with low structural complexity. More stressful physicochemical conditions resulting from incomplete tidal flushing (elevated salinity) and variable topography (waterlogging) apparently affected plant survival and growth at the WS restoration site. Lower leaf fall and root production rates at the WS restoration site, compared with that at HC were partly attributable to differences in hydroedaphic conditions and structural development. However, leaf and root inputs at each restoration site were not significantly different from that in reference forests within the same physiographic setting. Macrofaunal consumption of tethered leaves also did not differ with site history, but was dramatically higher at HC compared with WS, reflecting local variation in leaf litter processing rates, primarily by snails (Melampus coffeus). Degradation of leaves and roots in mesh bags was slow overall at restoration sites, however, particularly at WS where aerobic decomposition may have been more limited. These findings indicate that local or regional factors such as salinity regime act together with site history to control primary production and turnover rates of organic matter in restoration sites. Species differences in senescent leaf nitrogen content and degradation rates further suggest that restoration sites dominated by Laguncularia racemosa and Rhizophora mangle should exhibit slower recycling of nutrients compared with natural basin forests where Avicennia germinans is more abundant. Structural development and biogeochemical functioning of restored mangrove forests thus depend on a number of factors, but site

  14. Dental lesions and restorative treatment in molars

    Gheorghiu Irina-Maria

    2017-08-01

    Full Text Available This article review specific clinical issues of the molar teeth, as well as the therapeutic approach of their pathology. The dental pathology we face in the group of molars is related to: dental caries, dental trauma (crown and crown-root fractures, dental wear phenomena. The therapeutic approach of the molar teeth is represented by: restoration of the loss of hard dental tissues; endodontic treatments of pulpal and periapical complications; surgical treatment. The restorative treatments in molars are: direct restorations, with or without supplementary anchorage for obturations; inlay, onlay; prosthetic crown.

  15. Cost-benefit analysis of wetland restoration

    Dubgaard, Alex

    2004-01-01

    The purpose of cost-benefit analysis (CBA) is to identify value for money solutions to government policies or projects. Environmental policy appraisal is typically complicated by the fact that thre are a number of feasible solutions to a decision problem - each yielding a different mix of environ...... is to illustrate the application of CBA within the field of river restoration. The Skjern River restoration project in Denmark is used as an empirical example of how these methods can be applied in the wetland restoration context....

  16. Conservation, management, and restoration of coral reefs.

    Chavanich, Suchana; Soong, Keryea; Zvuloni, Assaf; Rinkevich, Baruch; Alino, Porfirio

    2015-04-01

    The 8th International Conference on Coelenterate Biology (ICCB 8) was held in Eilat, Israel from December 1st to 5th 2013. The conference included 15 sessions, one of which discussed the latest information on the conservation, management, and restoration of Coelenterata in different parts of the world. A total of 16 oral presentations and 5 posters were presented in this session. Of these 21 papers, 11 were related to conservation issues, 7 described management, and 3 discussed restoration. This session provided insights on the current conservation, management, and restoration of coelenterates in different parts of the world. Copyright © 2015 Elsevier GmbH. All rights reserved.

  17. Modelling chestnut biogeography for American chestnut restoration

    Fei, Songlin; Liang, Liang; Paillet, Frederick L.

    2012-01-01

    Aim Chestnuts (Castanea spp.) are ecologically and economically important species. We studied the general biology, distribution and climatic limits of seven chestnut species from around the world. We provided climatic matching of Asiatic species to North America to assist the range-wide restoration...... American chestnut appears feasible if a sufficiently diverse array of Chinese chestnut germplasm is used as a source of blight resistance. Our study provided a between-continent climate matching approach to facilitate the range-wide species restoration, which can be readily applied in planning...... the restoration of other threatened or endangered species....

  18. Current Concepts in Restorative Implant Dentistry

    Prof.Marchack

    2009-01-01

    Patients today are incteasingly aware of dental implants.and their expectations are for esthetically and functionally pleasingimplant restorations that mimic natural teeth.This presentation will give both the experienced and novice practitioner a better understand-ing of how restorative implant dentistry has evolved.Treatment planning and restorative options for single implants.multiple implants andfully edentulons arches will be discussed,and the use of modern materials and CADCAM technology in fabricating the most contemporaryfixed implant supported prostheses will be demonstrated.

  19. Restoration of opencast coal mining sites

    Brent-Jones, E.

    1983-10-01

    The paper describes the measures taken by the NCB Opencast Executive in the restoration of opencast sites on completion of mining. Soil surveys are carried out before mining and these, together with geological information, enable a comprehensive soil restoration strategy to be worked out. The soils replacement plan shows the location and thickness of soils to be replaced, and whether special treatment is required to improve the condition of the soil. The equipment that has been developed to cope with the heavy restoration work is described and the conditions under which it is used are given.

  20. Water Awareness Through Environmental Restoration

    Davis-Caldwell, K.

    2012-04-01

    and negative effects of human presence on the local and global water supply. Student research scientifically tested ways to slow down the effects of run-off contaminants. Students also revisit water analysis and plant trees as buffers as part of their stream preservation efforts in a culminating activity. Oyster Reef Restoration Project: As a result of changes in climate, pollution and human consumption, the oyster population in the Chesapeake Bay had previously been on a rapid decline. The Oyster Reef Restoration Project allows students to understand the creatures of the bay and the cause of this decline. They explore the domino effect this has had on the quality of the water in the bay and future implications on the environment when the oyster population fluctuates significantly. Students construct concrete reefs and study the components of its contents and the reef's impact on the bay. Students are responsible for mixing, pouring and preparing the reef for its eventual drop in the bay. Wetlands Recovery: Following the elimination of a substantial amount of the natural wetlands behind the elementary and middle schools, a wetlands area was erected on the school grounds. This pond has been used to learn about habitats and the role humans, plants and organisms play in the preservation of the earth soil and water supply. This wetland is used by both the elementary and middle schools as a place for hands-on inquiry based learning. Students maintain the upkeep of the pond and teach other students at lower grades.

  1. Terrorism, Forgiveness and Restorative Justice

    Antony Pemberton

    2014-07-01

    Full Text Available This paper is intended to enhance understanding of the complexities of restorative justice in cases of terrorism from a victimological perspective. It does so first by analysing what separates terrorism from other forms of crime. The author argues that the main distinction concerns the peculiarly public nature of terrorism, in which the attack on the direct victims is intended to influence a (far larger group of so-called vicarious victims. This means that the public is likely to experience terrorist attacks as attacks on themselves. As a consequence the public can feel entitled to processes of forgiveness which in turn can conflict with the direct victims’ own experience. To illuminate this issue the paper proposes a novel distinction in third party forgiveness processes: between public forgiveness, i.e. forgiveness relating to the public wrongfulness inherent in crime, and vicarious forgiveness, i.e. the public’s experience of forgiveness itself. The complexities for restorative justice after terrorism can be then be viewed in terms of the tensions between the direct victims’ private and the publics’ vicarious forgiveness processes. Este artículo pretende facilitar la comprensión de las complejidades de la justicia restaurativa en casos de terrorismo desde una perspectiva victimológica. Lo hace primero mediante el análisis de lo que separa el terrorismo de otras formas de delincuencia. El autor sostiene que la distinción principal se refiere a la naturaleza pública específica del terrorismo, ya que mediante el ataque a las víctimas directas se pretende influir en el grupo (mucho más grande de las llamadas víctimas vicarias. Esto significa que es probable que el público sienta los ataques terroristas como ataques contra ellos mismos. De esta forma, el público puede sentirse con derecho sobre los procesos de perdón, lo que, a su vez, puede entrar en conflicto con la propia experiencia de las víctimas directas. Para iluminar

  2. Initial Readability Assessment of Clinical Trial Eligibility Criteria

    Kang, Tian; Elhadad, Noémie; Weng, Chunhua

    2015-01-01

    Various search engines are available to clinical trial seekers. However, it remains unknown how comprehensible clinical trial eligibility criteria used for recruitment are to a lay audience. This study initially investigated this problem. Readability of eligibility criteria was assessed according to (i) shallow and lexical characteristics through the use of an established, generic readability metric; (ii) syntactic characteristics through natural language processing techniques; and (iii) health terminological characteristics through an automated comparison to technical and lay health texts. We further stratified clinical trials according to various study characteristics (e.g., source country or study type) to understand potential factors influencing readability. Mainly caused by frequent use of technical jargons, a college reading level was found to be necessary to understand eligibility criteria text, a level much higher than the average literacy level of the general American population. The use of technical jargons should be minimized to simplify eligibility criteria text. PMID:26958204

  3. Express Lane Eligibility for Medicaid and CHIP Coverage

    U.S. Department of Health & Human Services — States may rely on eligibility information from "Express Lane" agency programs to streamline and simplify enrollment and renewal in Medicaid and CHIP. Express Lane...

  4. Eligible Applicants for IDRC-NIH Collaborative funding

    Andres Sanchez

    middle-income,” and. “upper-middle-income” countries, with the exceptions noted below. Countries that are not eligible: Cuba, Iran, Iraq, Korea (Democratic People's Republic of), Somalia, and countries from Eastern Europe or Central Asia.

  5. Determination of eligibility to antiretroviral therapy in resource ...

    admin

    Objective: This study was to determine eligibility for antiretroviral therapy in resource-limited settings using total lymphocyte .... ART until CD4+ T cell counts fall below 200 cells/mm3 ... (Abbott Cell Dyne Operators manual) were checked for.

  6. 48 CFR 932.304-2 - Certificate of eligibility.

    2010-10-01

    ... CONTRACTING REQUIREMENTS CONTRACT FINANCING Loan Guarantees for Defense Production 932.304-2 Certificate of eligibility. (h) Guaranteed loan applications shall be authorized and transmitted to the Federal Reserve Bank only by the Secretary or designee specified for that purpose. ...

  7. 28 CFR 104.51 - Payments to eligible individuals.

    2010-07-01

    ... COMPENSATION FUND OF 2001 Payment of Claims § 104.51 Payments to eligible individuals. Not later than 20 days... compensation due a claimant under the Fund, the Special Master shall authorize payment to such claimant of the...

  8. Discriminative Transfer Learning for General Image Restoration

    Xiao, Lei

    2018-04-30

    Recently, several discriminative learning approaches have been proposed for effective image restoration, achieving convincing trade-off between image quality and computational efficiency. However, these methods require separate training for each restoration task (e.g., denoising, deblurring, demosaicing) and problem condition (e.g., noise level of input images). This makes it time-consuming and difficult to encompass all tasks and conditions during training. In this paper, we propose a discriminative transfer learning method that incorporates formal proximal optimization and discriminative learning for general image restoration. The method requires a single-pass discriminative training and allows for reuse across various problems and conditions while achieving an efficiency comparable to previous discriminative approaches. Furthermore, after being trained, our model can be easily transferred to new likelihood terms to solve untrained tasks, or be combined with existing priors to further improve image restoration quality.

  9. Models for Patch-Based Image Restoration

    Petrovic Nemanja

    2009-01-01

    Full Text Available Abstract We present a supervised learning approach for object-category specific restoration, recognition, and segmentation of images which are blurred using an unknown kernel. The novelty of this work is a multilayer graphical model which unifies the low-level vision task of restoration and the high-level vision task of recognition in a cooperative framework. The graphical model is an interconnected two-layer Markov random field. The restoration layer accounts for the compatibility between sharp and blurred images and models the association between adjacent patches in the sharp image. The recognition layer encodes the entity class and its location in the underlying scene. The potentials are represented using nonparametric kernel densities and are learnt from training data. Inference is performed using nonparametric belief propagation. Experiments demonstrate the effectiveness of our model for the restoration and recognition of blurred license plates as well as face images.

  10. Models for Patch-Based Image Restoration

    Mithun Das Gupta

    2009-01-01

    Full Text Available We present a supervised learning approach for object-category specific restoration, recognition, and segmentation of images which are blurred using an unknown kernel. The novelty of this work is a multilayer graphical model which unifies the low-level vision task of restoration and the high-level vision task of recognition in a cooperative framework. The graphical model is an interconnected two-layer Markov random field. The restoration layer accounts for the compatibility between sharp and blurred images and models the association between adjacent patches in the sharp image. The recognition layer encodes the entity class and its location in the underlying scene. The potentials are represented using nonparametric kernel densities and are learnt from training data. Inference is performed using nonparametric belief propagation. Experiments demonstrate the effectiveness of our model for the restoration and recognition of blurred license plates as well as face images.

  11. Comparison of active and passive stream restoration

    Kristensen, Esben Astrup; Thodsen, Hans; Dehli, Bjarke

    2013-01-01

    Modification and channelization of streams and rivers have been conducted extensively throughout the world during the past century. Subsequently, much effort has been directed at re-creating the lost habitats and thereby improving living conditions for aquatic organisms. However, as restoration...... methods are plentiful, it is difficult to determine which one to use to get the anticipated result. The aim of this study was to compare two commonly used methods in small Danish streams to improve the physical condition: re-meandering and passive restoration through cease of maintenance. Our...... investigation included measurement of the physical conditions in 29 stream reaches covering four different groups: (1) re-meandered streams, (2) LDC streams (the least disturbed streams available), (3) passively restored streams (>10 years stop of aintenance) and (4) channelized and non-restored streams. The in...

  12. Habitat Analysis - Trinity River Restoration Potential

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of the Trinity River project is to identify the potential positive effects of large-scale restoration actions in a 63 kilometer reach of the Trinity River...

  13. Development of The Harmony Restoration Measurement Scale ...

    Development of The Harmony Restoration Measurement Scale (Cosmogram) Part 1. ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search ... is one, who is in harmony or at peace with his world of relationships (Cosmos).

  14. Channel Restoration Design for Meandering Rivers

    Soar, Philip

    2001-01-01

    .... A geomorphic engineering approach is presented, which recognizes that the river is ultimately the best restorer of its natural morphology and should be allowed to participate in its own recovery...

  15. Discriminative Transfer Learning for General Image Restoration

    Xiao, Lei; Heide, Felix; Heidrich, Wolfgang; Schö lkopf, Bernhard; Hirsch, Michael

    2018-01-01

    Recently, several discriminative learning approaches have been proposed for effective image restoration, achieving convincing trade-off between image quality and computational efficiency. However, these methods require separate training for each restoration task (e.g., denoising, deblurring, demosaicing) and problem condition (e.g., noise level of input images). This makes it time-consuming and difficult to encompass all tasks and conditions during training. In this paper, we propose a discriminative transfer learning method that incorporates formal proximal optimization and discriminative learning for general image restoration. The method requires a single-pass discriminative training and allows for reuse across various problems and conditions while achieving an efficiency comparable to previous discriminative approaches. Furthermore, after being trained, our model can be easily transferred to new likelihood terms to solve untrained tasks, or be combined with existing priors to further improve image restoration quality.

  16. ROV Based Underwater Blurred Image Restoration

    LIU Zhishen; DING Tianfu; WANG Gang

    2003-01-01

    In this paper, we present a method of ROV based image processing to restore underwater blurry images from the theory of light and image transmission in the sea. Computer is used to simulate the maximum detection range of the ROV under different water body conditions. The receiving irradiance of the video camera at different detection ranges is also calculated. The ROV's detection performance under different water body conditions is given by simulation. We restore the underwater blurry images using the Wiener filter based on the simulation. The Wiener filter is shown to be a simple useful method for underwater image restoration in the ROV underwater experiments. We also present examples of restored images of an underwater standard target taken by the video camera in these experiments.

  17. Generalized probabilistic scale space for image restoration.

    Wong, Alexander; Mishra, Akshaya K

    2010-10-01

    A novel generalized sampling-based probabilistic scale space theory is proposed for image restoration. We explore extending the definition of scale space to better account for both noise and observation models, which is important for producing accurately restored images. A new class of scale-space realizations based on sampling and probability theory is introduced to realize this extended definition in the context of image restoration. Experimental results using 2-D images show that generalized sampling-based probabilistic scale-space theory can be used to produce more accurate restored images when compared with state-of-the-art scale-space formulations, particularly under situations characterized by low signal-to-noise ratios and image degradation.

  18. Geomorphic Analysis - Trinity River Restoration Potential

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of the Trinity River project is to identify the potential positive effects of large-scale restoration actions in a 63 kilometer reach of the Trinity River...

  19. Fisheries Restoration Grant Program Projects [ds168

    California Natural Resource Agency — This shapefile (FRGP_All_020209.shp) represents the locations of all ongoing and completed salmonid restoration projects in California with existing records in the...

  20. Project Rio Blanco: site restoration. Final report

    1978-01-01

    Project Rio Blanco was a joint Government-industry experiment using nuclear explosives to stimulate the flow of natural gas from low permeability formations which could not be economically produced through conventional methods. The project consisted of the simultaneous detonation of three nuclear explosives on May 17, 1973, in a 7,000 foot well in northwestern Colorado. Gas production testing and project evaluation continued through June 1976. The site cleanup and restoration planning phase began in December 1975 and was concluded with the issuance of an operational plan, Project Rio Blanco Site Cleanup and Restoration Plan, NVO-173, in May 1976. Actual site restoration activities were conducted during the period from July to November 1976. The activities throughout the restoration period are summarized and the final site status, including the disposition of all project facilities and the status of all project related wells after plug and abandonment and recompletion work are described

  1. Review: Mangrove ecosystem in Java: 2. Restoration

    PURIN CANDRA PURNAMA

    2004-07-01

    Full Text Available R E V I E W:Ekosistem Mangrove di Jawa: 2. RestorasiThe restoration of mangroves has received a lot of attentions world wide for several reasons. Mangrove ecosystem is very important in term of socio-economic and ecology functions. Because of its functions, wide range of people paid attention whenever mangrove restoration taken place. Mangrove restoration potentially increases mangrove resource value, protect the coastal area from destruction, conserve biodiversity, fish production and both of directly and indirectly support the life of surrounding people. This paper outlines the activities of mangrove restoration on Java island. The extensive research has been carried out on the ecology, structure and functioning of the mangrove ecosystem. However, the findings have not been interpreted in a management framework, thus mangrove forests around the world continue to be over-exploited, converted to aquaculture ponds, and polluted. We strongly argue that links between research and sustainable management of mangrove ecosystem should be established.

  2. Urban gardens: catalysts for restorative commons infrastructure

    John Seitz

    2009-01-01

    One of 18 articles inspired by the Meristem 2007 Forum, "Restorative Commons for Community Health." The articles include interviews, case studies, thought pieces, and interdisciplinary theoretical works that explore the relationship between human health and the urban...

  3. Forest restoration, biodiversity and ecosystem functioning

    2011-01-01

    Globally, forests cover nearly one third of the land area and they contain over 80% of terrestrial biodiversity. Both the extent and quality of forest habitat continue to decrease and the associated loss of biodiversity jeopardizes forest ecosystem functioning and the ability of forests to provide ecosystem services. In the light of the increasing population pressure, it is of major importance not only to conserve, but also to restore forest ecosystems. Ecological restoration has recently started to adopt insights from the biodiversity-ecosystem functioning (BEF) perspective. Central is the focus on restoring the relation between biodiversity and ecosystem functioning. Here we provide an overview of important considerations related to forest restoration that can be inferred from this BEF-perspective. Restoring multiple forest functions requires multiple species. It is highly unlikely that species-poor plantations, which may be optimal for above-ground biomass production, will outperform species diverse assemblages for a combination of functions, including overall carbon storage and control over water and nutrient flows. Restoring stable forest functions also requires multiple species. In particular in the light of global climatic change scenarios, which predict more frequent extreme disturbances and climatic events, it is important to incorporate insights from the relation between biodiversity and stability of ecosystem functioning into forest restoration projects. Rather than focussing on species per se, focussing on functional diversity of tree species assemblages seems appropriate when selecting tree species for restoration. Finally, also plant genetic diversity and above - below-ground linkages should be considered during the restoration process, as these likely have prominent but until now poorly understood effects at the level of the ecosystem. The BEF-approach provides a useful framework to evaluate forest restoration in an ecosystem functioning context, but

  4. 30 CFR 879.11 - Land eligible for acquisition.

    2010-07-01

    ... INTERIOR ABANDONED MINE LAND RECLAMATION ACQUISITION, MANAGEMENT, AND DISPOSITION OF LANDS AND WATER § 879... provide open space benefits after restoration, reclamation, abatement, control, or prevention of the... land for the restoration, reclamation, abatement, control, or prevention of the adverse effects of past...

  5. Thermal Energy Transfer Through All Ceramic Restorations

    2016-06-01

    correlate to a histological status or disease process. A positive response only expresses that there is a viable nerve fibers located within the pulp ...INTRODUCTION: The literature has demonstrated that cold testing with 1,1,1,2- tetrafluoroethane (TFE) can be used to assess the pulp vitality of teeth restored...restorative materials to natural teeth. MATERIALS AND METHODS: Thermoprobes (T-type, Omega) were inserted into the pulp chamber of 3 extracted human

  6. 3.10. Habitat restoration and creation

    2016-01-01

    1.12.1 Terrestrial habitat Based on the collated evidence, what is the current assessment of the effectiveness of interventions for terrestrial habitat restoration and creation? Beneficial ● Replant vegetation Likely to be beneficial ● Clear vegetation● Create artificial hibernacula or aestivation sites● Create refuges● Restore habitat connectivity Unknown effectiveness (limited evidence) ● Change mowing regime No evidence found (no assessment) ● Create habitat connectivity Beneficial Repla...

  7. Deer Island Aquatic Ecosystem Restoration Project

    2015-07-01

    across the U.S. Army Corps of Engineers (USACE) requires that a broad base of EWN understanding and support be built . The Deer Island Aquatic...USACE) requires that a broad base of EWN understanding and support be built . The Deer Island Aquatic Ecosystem Restoration Project (Deer Island AERP...Mississippi Wetlands Restoration Projects). The project received additional funding through several public laws in response to hurricane damages

  8. Soil disturbance as a grassland restoration measure

    Schnoor, Tim; Bruun, Hans Henrik; Olsson, Pål Axel

    2015-01-01

    Soil disturbance is recognized as an important driver of biodiversity in dry grasslands, and can therefore be implemented as a restoration measure. However, because community re-assembly following disturbance includes stochastic processes, a focus only on species richness or establishment success...... to experimental disturbance treatments (ploughing or rotavation), and the vegetation was surveyed during four subsequent years of succession. Treated plots were compared with control plots representing untreated grassland, as well as nearby plots characterized by plant communities representing the restoration...

  9. Nd: YAG laser in art works restoration

    Flores, T.; Ponce, L.; Arronte, M.; Moreno, B.; Fernandez, M.; Garcia, C.

    1998-01-01

    Laser cleaning in works of art has a number of advantages over traditional techniques of restoration. In this article, the technique used and the physical mechanisms that explain the process of ablation of pollutants are described. The results obtained in the cleaning of statues of marble and alabaster are exposed as well as oil-painting restoration. In this last specific case, the Nd: YAG laser is used with successful results. (Author) 6 refs

  10. Leadership success within disaster restoration projects.

    Rapp, Randy R; Baroudi, Bassam

    2014-01-01

    Successful project managers draw their performance from essential leadership traits, as guided by their core values.Within disaster recovery, contractors who mitigate, repair, and reconstruct the built environment are often faced with challenges exceeding the norm. The effective leader is commonly expected to consider stakeholder motivations within distressing situations as well as other external and environmental factors when seeking to lead the project team to successful outcomes. This research is most concerned with leadership within the context of disaster restoration of the built environment. Its stimulus comes from the Restoration Industry Association (RIA)'s efforts to highlight leadership traits and core values for its Certified Restorer Body of Knowledge but would be of value to others associated with disaster recovery operations. Among organizations whose membership includes thousands of practitioners who restore and reconstruct the built environment after disasters, the RIA is the only one yet to formally and substantially research which core values and leader traits are deemed critical for the success of efforts to manage the means and methods applied on recovery job sites. Forty-six seasoned disaster restoration industry project professionals voluntarily responded to a survey questionnaire that sought their opinions about the traits and core values that they consider most important for successful disaster restoration project leadership. The most important leader traits were effective communication, professional competence, and leadership by example. The most important restoration industry values were integrity, compassion, and trustworthiness. The recognized imperative of compassion was unexpected in light of stereotypes often associated with construction-related contractors. This and other findings permit disaster response and recovery stakeholders to better understand qualities they should wish to see in leaders of contractor organizations, which

  11. Environmental Restoration Program Management Control Plan

    1991-09-01

    This Management Control Plan has been prepared to define the Energy Systems approach to managing its participation in the US DOE's Environmental Restoration (ER) Program in a manner consistent with DOE/ORO 931: Management Plan for the DOE Field Office, Oak Ridge, Decontamination and Decommissioning Program; and the Energy Systems Environmental Restoration Contract Management Plan (CMP). This plan discusses the systems, procedures, methodology, and controls to be used by the program management team to attain these objectives

  12. Marginal microfiltration in amalgam restorations. Review

    Lahoud Salem, Víctor

    2014-01-01

    The present articule is review references from phenomenon of microfiltration in restorations with amalgam and yours consecuents in changes of color in the interface tooth-restorations, margin deterioted , sensitivity dentinarea postoperate, caries secondary and pulp inflamation. Besides naming the mechanicals for to reduce microfiltration, and yours effects for use of sealers dentinaries representation for the varnish cavitys and adhesive systens Conclusive indicate wath the amalgam is the ma...

  13. STRATIFICATION TECHNIQUE IN MAXILLARY ANTERIOR INCISORS RESTORATION

    Janet Kirilova

    2014-08-01

    Full Text Available Background: Because of their main characteristics: transparency, opalescence and color density, the tooth structures are extremely difficult to restore by means of completely inconspicuous restorations of the natural tooth tissue characteristics. The aim is to show successful aesthetic restoration of III Class dental lesions in upper incisors by means of high quality composites. Materials and method: A female patient visited the clinic being not satisfied with the esthetics of her front teeth. The intraoral examination showed previous restorations and carious lesions in 12, 11, 21, 22. After defining the tooth color a silicone key was made. The treatment was performed under anesthesia, the existing restorations were removed and the carious lesions in teeth 11, 12, 21, 22 were treated with restorations using Vanini edge preparation. The teeth were restored by means of stratification technique. After etching and rinsing, bonding was applied for 20 sec. and then polymerized. After fixing the silicone key enamel shade was applied and then dentine shades UD2, UD3, UD4 of 0.5mm thickness each. The polymerization was done layer by layer. Applied were 10 to 15 layers in total. The composite material was preheated in oven up to 55. Teeth 21 and 22 are restored with Enamel Plus HRi (Micerium. Results and Discussion: Excellent aesthetics is achieved with composite material. They have enamel and dentine shades and allow high quality aesthetics. The polishing is excellent in Enamel Plus HRi (Micerium which is typical for this type of composite. The result of the carious lesion treatment in this patient is real improvement of the dental appearance of her anterior incisors. Conclusion: Materials show excellent aesthetic results due to their characteristics and the stratification technique used.

  14. Remote sensing for restoration ecology: Application for restoring degraded, damaged, transformed, or destroyed ecosystems.

    Reif, Molly K; Theel, Heather J

    2017-07-01

    Restoration monitoring is generally perceived as costly and time consuming, given the assumptions of successfully restoring ecological functions and services of a particular ecosystem or habitat. Opportunities exist for remote sensing to bolster the restoration science associated with a wide variety of injured resources, including resources affected by fire, hydropower operations, chemical releases, and oil spills, among others. In the last decade, the role of remote sensing to support restoration monitoring has increased, in part due to the advent of high-resolution satellite sensors as well as other sensor technology, such as lidar. Restoration practitioners in federal agencies require monitoring standards to assess restoration performance of injured resources. This review attempts to address a technical need and provides an introductory overview of spatial data and restoration metric considerations, as well as an in-depth review of optical (e.g., spaceborne, airborne, unmanned aerial vehicles) and active (e.g., radar, lidar) sensors and examples of restoration metrics that can be measured with remotely sensed data (e.g., land cover, species or habitat type, change detection, quality, degradation, diversity, and pressures or threats). To that end, the present article helps restoration practitioners assemble information not only about essential restoration metrics but also about the evolving technological approaches that can be used to best assess them. Given the need for monitoring standards to assess restoration success of injured resources, a universal monitoring framework should include a range of remote sensing options with which to measure common restoration metrics. Integr Environ Assess Manag 2017;13:614-630. Published 2016. This article is a US Government work and is in the public domain in the USA. Published 2016. This article is a US Government work and is in the public domain in the USA.

  15. A Policy Analysis Perspective on Ecological Restoration

    Susan Baker

    2013-06-01

    Full Text Available Using a simple stages model of the policy process, we explore the politics of ecological restoration using an array of examples drawn across sector, different size and scale, and from different countries. A policy analysis perspective reveals how, at both the program and project levels, ecological restoration operates within a complex and dynamic interplay between technical decision making, ideologies, and interest politics. Viewed through the stages model, restoration policy involves negotiating nature across stages in the policy making process, including agenda setting, policy formulation, implementation, and evaluation. The stages model is a useful heuristic devise; however, this linear model assumes that policy makers approach the issue rationally. In practice, ecological restoration policy takes place in the context of different distributions of power between the various public and private actors involved at the different stages of restoration policy making. This allows us to reiterate the point that ecological restoration is best seen not only as a technical task but as a social and political project.

  16. Exxon Valdez -- Framework for natural resource restoration

    O'Connor, C.R.

    1993-01-01

    Once the task of evaluating the nature and extent of natural resource injuries caused by the Exxon Valdez oil spill neared completion, the equally daunting task of formulating proper restorative measures began. The essence of the natural resource restoration effort is to determine how to utilize the monies received from the criminal and civil settlements to fulfill the natural resource trustees' responsibilities to restore Prince William Sound and the Gulf of Alaska to their condition prior to the spill. Given the magnitude and variety of environmental impact, i.e., natural resource injuries ranging from the death of thousands of sea birds and marine mammals to the persistent sublethal affects of hydrocarbon contamination in intertidal sediments, the field of restorative endeavor is as broad and perplexing as was responding to the spill itself. This paper discusses the policy and legal parameters which give structure to the scientific and technical decisions the natural resource trustees must make in the years to come as they engage in their restoration responsibilities. The discussed policy and legal parameters translate generally to natural resource restoration under such statutes as the Comprehensive Environmental Response, Compensation and Liability Act, the Clean Water Act and the Oil Pollution Act of 1990

  17. Ecological restoration of litter in mined areas

    Teresinha Gonçalves Bizuti, Denise; Nino Diniz, Najara; Schweizer, Daniella; de Marchi Soares, Thaís; Casagrande, José Carlos; Henrique Santin Brancalion, Pedro

    2016-04-01

    The success of ecological restoration projects depends on going monitoring of key ecological variables to determine if a desired trajectory has been established and, in the case of mining sites, nutrient cycling recovery plays an utmost importance. This study aimed to quantify and compare the annual litter production in native forests, and in restoration sites established in bauxite mines. We collected samples in 6 native forest remnants and 6 year-old restoration sites every month for a period of one year, in the city of Poços de Caldas/MG, SE Brazil. 120 wire collectors were used (0,6x0,6) and suspended 30cm above the soil surface. The material was dried until constant weight, weighed and fractionated in leaves, branches and reproductive material. The average annual litter production was 2,6 Mg ha-1 in native forests and 2,1 in forest in restoration sites, differing statistically. Litter production was higher in the rainy season, especially in September. Among the litter components, the largest contributor to total production was the fraction leaves, with 55,4% of the total dry weight of material collected, followed by reproductive material which contributed 24,5% and branches, with 20%. We conclude that the young areas in restoration process already restored important part, but still below the production observed in native areas.

  18. Drivers of Ecological Restoration: Lessons from a Century of Restoration in Iceland

    Ása L. Aradóttir

    2013-12-01

    Full Text Available We analyzed the main drivers for ecological restoration in Iceland from 1907 to 2010 and assessed whether the drivers have changed over time and what factors might explain the changes, if any. Our study was based on a catalogue of 100 restoration projects, programs, and areas, representing 75% to 85% of all restoration activities in Iceland. Catastrophic erosion was an early driver for soil conservation and restoration efforts that still ranked high in the 2000s, reflecting the immense scale of soil erosion and desertification in Iceland. Socioeconomic drivers such as farming and the provision of wood products were strong motivators of ecological restoration over most of the 20th century, although their relative importance decreased with time as the number and diversity of drivers increased. In the 1960s and 1970s, the construction of hard infrastructure, and moral values such as improving the aesthetics of the countryside and "repaying the debt to the land" emerged as motivations for restoration actions. In the late 1990s, the United Nations Climate Change Convention became a driver for restoration, and the importance of nature conservation and recreation increased. Technological development and financial incentives did not show up as drivers of ecological restoration in our study, although there are some indications of their influence. Furthermore, policy was a minor driver, which might reflect weak policy instruments for ecological restoration and some counteractive policies.

  19. Applying Attention Restoration Theory to Understand and Address Clergy's Need to Restore Cognitive Capacity.

    Gill, Chelsea; Packer, Jan; Ballantyne, Roy

    2018-02-06

    Attention Restoration Theory is applied to explore the causes and consequences of mental fatigue in clergy and suggest practical interventions to restore cognitive wellbeing. Previous research has investigated the physical and emotional health and wellbeing of clergy, but has largely neglected clergy cognitive wellbeing. Due to the demanding nature of their work, clergy are particularly susceptible to mental fatigue and depletion of their capacity to maintain attention. Symptoms include inability to focus attention, inhibit distractions, make decisions or solve problems. Mental fatigue can be overcome, and cognitive capacity restored, by spending time in restorative environments that allow directed attention to rest.

  20. Rangeland restoration for Hirola, the world's most endangered antelope

    Rangeland restoration can improve habitat for threatened species such as the hirola antelope (Beatragus hunteri) that inhabit savannas of eastern Kenya. However, restoration success likely varies across soil types and target restoration species, as well as according to restoration approach. We teste...