
Sample records for resonance imaging response

  1. MRI (Magnetic Resonance Imaging) (United States)

    ... Procedures Medical Imaging MRI (Magnetic Resonance Imaging) MRI (Magnetic Resonance Imaging) Share Tweet Linkedin Pin it More sharing options Linkedin Pin it Email Print Magnetic Resonance Imaging (MRI) is a medical imaging procedure for ...

  2. The longitudinal reliability and responsiveness of the OMERACT Hand Osteoarthritis Magnetic Resonance Imaging Scoring System (HOAMRIS)

    DEFF Research Database (Denmark)

    Haugen, Ida K.; Eshed, Iris; Gandjbakhch, Frederique


    Objective. To evaluate the interreader reliability of change scores and the responsiveness of the OMERACT Hand Osteoarthritis (OA) Magnetic Resonance Image (MRI) Scoring System (HOAMRIS). Methods. Paired MRI (baseline and 5-yr followup) from 20 patients with hand OA were scored with known time se...

  3. Pediatric magnetic resonance imaging

    International Nuclear Information System (INIS)

    Cohen, M.D.


    This book defines the current clinical potential of magnetic resonance imaging and focuses on direct clinical work with pediatric patients. A section dealing with the physics of magnetic resonance imaging provides an introduction to enable clinicians to utilize the machine and interpret the images. Magnetic resonance imaging is presented as an appropriate imaging modality for pediatric patients utilizing no radiation

  4. Reliability and responsiveness of dynamic contrast-enhanced magnetic resonance imaging in rheumatoid arthritis

    DEFF Research Database (Denmark)

    Axelsen, M.B.; Poggenborg, R.P.; Stoltenberg, M.


    intraarticular injection with 80 mg methylprednisolone. Using semi-automated image processing software, DCE-MRI parameters, including the initial rate of enhancement (IRE) and maximal enhancement (ME), were generated for three regions of interest (ROIs): ‘Whole slice’, ‘Quick ROI’, and ‘Precise ROI......Objectives: To investigate the responsiveness to treatment and the reliability of dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI) in rheumatoid arthritis (RA) knee joints. Methods: DCE-MRI was performed in 12 clinically active RA knee joints before and 1, 7, 30, and 180 days after......’. The smallest detectable difference (SDD), the smallest detectable change (SDC), and intra- and inter-reader intraclass correlation coefficients (ICCs) were used to assess the reliability of DCE-MRI. Responsiveness to treatment was assessed by the standardized response mean (SRM). Results: In all patients...

  5. Diffusion-Weighted Magnetic Resonance Imaging in Monitoring Rectal Cancer Response to Neoadjuvant Chemoradiotherapy

    International Nuclear Information System (INIS)

    Barbaro, Brunella; Vitale, Renata; Valentini, Vincenzo; Illuminati, Sonia; Vecchio, Fabio M.; Rizzo, Gianluca; Gambacorta, Maria Antonietta; Coco, Claudio; Crucitti, Antonio; Persiani, Roberto; Sofo, Luigi; Bonomo, Lorenzo


    Purpose: To prospectively monitor the response in patients with locally advanced nonmucinous rectal cancer after chemoradiotherapy (CRT) using diffusion-weighted magnetic resonance imaging. The histopathologic finding was the reference standard. Methods and Materials: The institutional review board approved the present study. A total of 62 patients (43 men and 19 women; mean age, 64 years; range, 28–83) provided informed consent. T 2 - and diffusion-weighted magnetic resonance imaging scans (b value, 0 and 1,000 mm 2 /s) were acquired before, during (mean 12 days), and 6–8 weeks after CRT. We compared the median apparent diffusion coefficients (ADCs) between responders and nonresponders and examined the associations with the Mandard tumor regression grade (TRG). The postoperative nodal status (ypN) was evaluated. The Mann-Whitney/Wilcoxon two-sample test was used to evaluate the relationships among the pretherapy ADCs, extramural vascular invasion, early percentage of increases in ADCs, and preoperative ADCs. Results: Low pretreatment ADCs ( −3 mm 2 /s) were correlated with TRG 4 scores (p = .0011) and associated to extramural vascular invasion with ypN+ (85.7% positive predictive value for ypN+). During treatment, the mean percentage of increase in tumor ADC was significantly greater in the responders than in the nonresponders (p 23% ADC increase had a 96.3% negative predictive value for TRG 4. In 9 of 16 complete responders, CRT-related tumor downsizing prevented ADC evaluations. The preoperative ADCs were significantly different (p = .0012) between the patients with and without downstaging (preoperative ADC ≥1.4 × 10 −3 mm 2 /s showed a positive and negative predictive value of 78.9% and 61.8%, respectively, for response assessment). The TRG 1 and TRG 2–4 groups were not significantly different. Conclusion: Diffusion-weighted magnetic resonance imaging seems to be a promising tool for monitoring the response to CRT.

  6. Diffusion-weighted magnetic resonance imaging in monitoring rectal cancer response to neoadjuvant chemoradiotherapy. (United States)

    Barbaro, Brunella; Vitale, Renata; Valentini, Vincenzo; Illuminati, Sonia; Vecchio, Fabio M; Rizzo, Gianluca; Gambacorta, Maria Antonietta; Coco, Claudio; Crucitti, Antonio; Persiani, Roberto; Sofo, Luigi; Bonomo, Lorenzo


    To prospectively monitor the response in patients with locally advanced nonmucinous rectal cancer after chemoradiotherapy (CRT) using diffusion-weighted magnetic resonance imaging. The histopathologic finding was the reference standard. The institutional review board approved the present study. A total of 62 patients (43 men and 19 women; mean age, 64 years; range, 28-83) provided informed consent. T(2)- and diffusion-weighted magnetic resonance imaging scans (b value, 0 and 1,000 mm(2)/s) were acquired before, during (mean 12 days), and 6-8 weeks after CRT. We compared the median apparent diffusion coefficients (ADCs) between responders and nonresponders and examined the associations with the Mandard tumor regression grade (TRG). The postoperative nodal status (ypN) was evaluated. The Mann-Whitney/Wilcoxon two-sample test was used to evaluate the relationships among the pretherapy ADCs, extramural vascular invasion, early percentage of increases in ADCs, and preoperative ADCs. Low pretreatment ADCs (23% ADC increase had a 96.3% negative predictive value for TRG 4. In 9 of 16 complete responders, CRT-related tumor downsizing prevented ADC evaluations. The preoperative ADCs were significantly different (p = .0012) between the patients with and without downstaging (preoperative ADC ≥1.4 × 10(-3)mm(2)/s showed a positive and negative predictive value of 78.9% and 61.8%, respectively, for response assessment). The TRG 1 and TRG 2-4 groups were not significantly different. Diffusion-weighted magnetic resonance imaging seems to be a promising tool for monitoring the response to CRT. Copyright © 2012 Elsevier Inc. All rights reserved.

  7. Magnetic resonance imaging in the evaluation of treatment response of lateral epicondylitis of the elbow

    International Nuclear Information System (INIS)

    Savnik, Anette; Jensen, Bente; Noerregaard, Jesper; Danneskiold-Samsoee, Bente; Bliddal, Henning; Egund, Niels


    The purpose of this study was to investigate the treatment response in lateral epicondylitis (tennis elbow) by MRI. Magnetic resonance imaging was obtained in 30 patients with clinical symptoms of lateral epicondylitis of the elbow using T1-, T2- and T2-weighted fat-saturated (FS) sequences. The patients were randomised to either i.m. corticosteroid injection (n=16) or immobilisation in a wrist splint (n=14). Magnetic resonance imaging of the elbow was performed on a 1.5-T MR system at baseline and after 6 weeks. The extensor carpi radialis (ECRB) tendon, the radial collateral ligament, lateral humerus epicondyle at tendon insertion site, joint fluid and signal intensity changes within brachio-radialis and anconeus muscles were evaluated on the MR unit's workstation before and after 6 weeks of treatment. The MRI was performed once in 22 healthy controls for comparison and all images evaluated by an investigator blinded to the clinical status of the subjects. The MR images showed thickening with separation of the ECRB tendon from the radial collateral ligament and abnormal signal change in 25 of the 30 patients on the T1-weighted sequences at inclusion. The signal intensity of the ECRB tendon was increased in 24 of the 30 patients with lateral epicondylitis of the elbow on the T2-weighted FS sequences. (orig.)

  8. Magnetic resonance imaging in the evaluation of treatment response of lateral epicondylitis of the elbow

    Energy Technology Data Exchange (ETDEWEB)

    Savnik, Anette [Parker Institute, Frederiksberg Hospital, Nordre Fasanvej 57, 2000, Frederiksberg (Denmark); Department of Radiology, Frederiksberg Hospital, Nordre Fasanvej 57, 2000, Frederiksberg (Denmark); Hovmarksvej 39, 2920, Charlottenlund (Denmark); Jensen, Bente; Noerregaard, Jesper; Danneskiold-Samsoee, Bente; Bliddal, Henning [Parker Institute, Frederiksberg Hospital, Nordre Fasanvej 57, 2000, Frederiksberg (Denmark); Egund, Niels [Department of Radiology, Aarhus University Hospital, 8000, Aarhus C (Denmark)


    The purpose of this study was to investigate the treatment response in lateral epicondylitis (tennis elbow) by MRI. Magnetic resonance imaging was obtained in 30 patients with clinical symptoms of lateral epicondylitis of the elbow using T1-, T2- and T2-weighted fat-saturated (FS) sequences. The patients were randomised to either i.m. corticosteroid injection (n=16) or immobilisation in a wrist splint (n=14). Magnetic resonance imaging of the elbow was performed on a 1.5-T MR system at baseline and after 6 weeks. The extensor carpi radialis (ECRB) tendon, the radial collateral ligament, lateral humerus epicondyle at tendon insertion site, joint fluid and signal intensity changes within brachio-radialis and anconeus muscles were evaluated on the MR unit's workstation before and after 6 weeks of treatment. The MRI was performed once in 22 healthy controls for comparison and all images evaluated by an investigator blinded to the clinical status of the subjects. The MR images showed thickening with separation of the ECRB tendon from the radial collateral ligament and abnormal signal change in 25 of the 30 patients on the T1-weighted sequences at inclusion. The signal intensity of the ECRB tendon was increased in 24 of the 30 patients with lateral epicondylitis of the elbow on the T2-weighted FS sequences. (orig.)

  9. Heterogenous migraine aura symptoms correlate with visual cortex functional magnetic resonance imaging responses

    DEFF Research Database (Denmark)

    Arngrim, Nanna; Hougaard, Anders; Ahmadi, Khazar


    Objective: Migraine aura is sparsely studied due to the highly challenging task of capturing patients during aura. Cortical spreading depression (CSD) is likely the underlying phenomenon of aura. The possible correlation between the multifaceted phenomenology of aura symptoms and the effects of CSD...... on the brain has not been ascertained. Methods: Five migraine patients were studied during various forms of aura symptoms induced by hypoxia, sham hypoxia, or physical exercise with concurrent photostimulation. The blood oxygenation level–dependent (BOLD) functional magnetic resonance imaging (fMRI) signal...... response to visual stimulation was measured in retinotopic mapping–defined visual cortex areas V1 to V4. Results: We found reduced BOLD response in patients reporting scotoma and increased response in patients who only experienced positive symptoms. Furthermore, patients with bilateral visual symptoms had...

  10. Cardiac magnetic resonance imaging

    African Journals Online (AJOL)


    Mar 6, 2011 ... Cardiac magnetic resonance imaging. Cardiovascular magnetic resonance imaging is becoming a routine diagnostic technique. BRUCE s sPOTTiswOOdE, PhD. MRC/UCT Medical Imaging Research Unit, University of Cape Town, and Division of Radiology, Stellenbosch University. Bruce Spottiswoode ...

  11. Magnetic resonance imaging apparatus

    International Nuclear Information System (INIS)

    Ehnholm, G.J.


    This patent describes an electron spin resonance enhanced magnetic resonance (MR) imaging (ESREMRI) apparatus able to generate a primary magnetic field during periods of nuclear spin transition excitation and magnetic resonance signal detection. This allows the generation of ESREMRI images of a subject. A primary magnetic field of a second and higher value generated during periods of nuclear spin transition excitation and magnetic resonance signal detection can be used to generate conventional MR images of a subject. The ESREMRI and native MR images so generated may be combined, (or superimposed). (author)

  12. Magnetic resonance imaging in spondyloarthritis--how to quantify findings and measure response

    DEFF Research Database (Denmark)

    Østergaard, Mikkel; Poggenborg, René Panduro; Axelsen, Mette Bjørndal


    Sensitive and reliable tools for monitoring disease activity and damage, and for prognostication, are essential in the management of patients with spondyloarthritis, including ankylosing spondylitis and psoriatic arthritis. Magnetic resonance imaging (MRI) allows direct visualisation...

  13. Diffusion-Weighted Magnetic Resonance Imaging in Monitoring Rectal Cancer Response to Neoadjuvant Chemoradiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Barbaro, Brunella, E-mail: [Department of Bioimaging and Radiological Sciences, Catholic University School of Medicine, Rome (Italy); Vitale, Renata; Valentini, Vincenzo; Illuminati, Sonia [Department of Bioimaging and Radiological Sciences, Catholic University School of Medicine, Rome (Italy); Vecchio, Fabio M. [Department of Pathology, Catholic University School of Medicine, Rome (Italy); Rizzo, Gianluca [Department of Surgery, Catholic University School of Medicine, Rome (Italy); Gambacorta, Maria Antonietta [Department of Bioimaging and Radiological Sciences, Catholic University School of Medicine, Rome (Italy); Coco, Claudio; Crucitti, Antonio; Persiani, Roberto; Sofo, Luigi [Department of Surgery, Catholic University School of Medicine, Rome (Italy); Bonomo, Lorenzo [Department of Bioimaging and Radiological Sciences, Catholic University School of Medicine, Rome (Italy)


    Purpose: To prospectively monitor the response in patients with locally advanced nonmucinous rectal cancer after chemoradiotherapy (CRT) using diffusion-weighted magnetic resonance imaging. The histopathologic finding was the reference standard. Methods and Materials: The institutional review board approved the present study. A total of 62 patients (43 men and 19 women; mean age, 64 years; range, 28-83) provided informed consent. T{sub 2}- and diffusion-weighted magnetic resonance imaging scans (b value, 0 and 1,000 mm{sup 2}/s) were acquired before, during (mean 12 days), and 6-8 weeks after CRT. We compared the median apparent diffusion coefficients (ADCs) between responders and nonresponders and examined the associations with the Mandard tumor regression grade (TRG). The postoperative nodal status (ypN) was evaluated. The Mann-Whitney/Wilcoxon two-sample test was used to evaluate the relationships among the pretherapy ADCs, extramural vascular invasion, early percentage of increases in ADCs, and preoperative ADCs. Results: Low pretreatment ADCs (<1.0 Multiplication-Sign 10{sup -3}mm{sup 2}/s) were correlated with TRG 4 scores (p = .0011) and associated to extramural vascular invasion with ypN+ (85.7% positive predictive value for ypN+). During treatment, the mean percentage of increase in tumor ADC was significantly greater in the responders than in the nonresponders (p < .0001) and a >23% ADC increase had a 96.3% negative predictive value for TRG 4. In 9 of 16 complete responders, CRT-related tumor downsizing prevented ADC evaluations. The preoperative ADCs were significantly different (p = .0012) between the patients with and without downstaging (preoperative ADC {>=}1.4 Multiplication-Sign 10{sup -3}mm{sup 2}/s showed a positive and negative predictive value of 78.9% and 61.8%, respectively, for response assessment). The TRG 1 and TRG 2-4 groups were not significantly different. Conclusion: Diffusion-weighted magnetic resonance imaging seems to be a promising

  14. Diffusion of responsibility attenuates altruistic punishment: A functional magnetic resonance imaging effective connectivity study. (United States)

    Feng, Chunliang; Deshpande, Gopikrishna; Liu, Chao; Gu, Ruolei; Luo, Yue-Jia; Krueger, Frank


    Humans altruistically punish violators of social norms to enforce cooperation and pro-social behaviors. However, such altruistic behaviors diminish when others are present, due to a diffusion of responsibility. We investigated the neural signatures underlying the modulations of diffusion of responsibility on altruistic punishment, conjoining a third-party punishment task with event-related functional magnetic resonance imaging and multivariate Granger causality mapping. In our study, participants acted as impartial third-party decision-makers and decided how to punish norm violations under two different social contexts: alone (i.e., full responsibility) or in the presence of putative other third-party decision makers (i.e., diffused responsibility). Our behavioral results demonstrated that the diffusion of responsibility served as a mediator of context-dependent punishment. In the presence of putative others, participants who felt less responsible also punished less severely in response to norm violations. Our neural results revealed that underlying this behavioral effect was a network of interconnected brain regions. For unfair relative to fair splits, the presence of others led to attenuated responses in brain regions implicated in signaling norm violations (e.g., AI) and to increased responses in brain regions implicated in calculating values of norm violations (e.g., vmPFC, precuneus) and mentalizing about others (dmPFC). The dmPFC acted as the driver of the punishment network, modulating target regions, such as AI, vmPFC, and precuneus, to adjust altruistic punishment behavior. Our results uncovered the neural basis of the influence of diffusion of responsibility on altruistic punishment and highlighted the role of the mentalizing network in this important phenomenon. Hum Brain Mapp 37:663-677, 2016. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  15. Altered functional magnetic resonance imaging responses to nonpainful sensory stimulation in fibromyalgia patients. (United States)

    López-Solà, Marina; Pujol, Jesus; Wager, Tor D; Garcia-Fontanals, Alba; Blanco-Hinojo, Laura; Garcia-Blanco, Susana; Poca-Dias, Violant; Harrison, Ben J; Contreras-Rodríguez, Oren; Monfort, Jordi; Garcia-Fructuoso, Ferran; Deus, Joan


    Fibromyalgia (FM) is a disorder characterized by chronic pain and enhanced responses to acute noxious events. However, the sensory systems affected in FM may extend beyond pain itself, as FM patients show reduced tolerance to non-nociceptive sensory stimulation. Characterizing the neural substrates of multisensory hypersensitivity in FM may thus provide important clues about the underlying pathophysiology of the disorder. The aim of this study was to characterize brain responses to non-nociceptive sensory stimulation in FM patients and their relationship to subjective sensory sensitivity and clinical pain severity. Functional magnetic resonance imaging (MRI) was used to assess brain response to auditory, visual, and tactile motor stimulation in 35 women with FM and 25 matched controls. Correlation and mediation analyses were performed to establish the relationship between brain responses and 3 types of outcomes: subjective hypersensitivity to daily sensory stimulation, spontaneous pain, and functional disability. Patients reported increased subjective sensitivity (increased unpleasantness) in response to multisensory stimulation in daily life. Functional MRI revealed that patients showed reduced task-evoked activation in primary/secondary visual and auditory areas and augmented responses in the insula and anterior lingual gyrus. Reduced responses in visual and auditory areas were correlated with subjective sensory hypersensitivity and clinical severity measures. FM patients showed strong attenuation of brain responses to nonpainful events in early sensory cortices, accompanied by an amplified response at later stages of sensory integration in the insula. These abnormalities are associated with core FM symptoms, suggesting that they may be part of the pathophysiology of the disease. Copyright © 2014 by the American College of Rheumatology.

  16. Assessment of treatment response in nonalcoholic steatohepatitis using advanced magnetic resonance imaging measures (United States)

    Lin, Steven C.; Heba, Elhamy; Bettencourt, Ricki; Lin, Grace Y.; Valasek, Mark A.; Lunde, Ottar; Hamilton, Gavin; Sirlin, Claude B.; Loomba, Rohit


    Background Magnetic resonance imaging derived measures of liver fat and volume are emerging as accurate, non-invasive imaging biomarkers in non-alcoholic steatohepatitis (NASH). Little is known about these measures in relation to histology longitudinally. Aims This study examines this relationship between MRI-derived proton-density fat-fraction (PDFF), total liver volume (TLV), total liver fat index (TLFI), vs. histology in a NASH trial. Methods This is a secondary analysis of a 24-week randomized, double-blind, placebo-controlled trial of 50 patients with biopsy-proven NASH randomized to oral ezetimibe 10mg daily (n=25) vs. placebo (n=25). Baseline and post-treatment anthropometrics, biochemical profiling, MRI, and biopsies were obtained. Results Baseline mean PDFF correlated strongly with TLFI (Spearman’s ρ=0.94, n=45, PMRI-PDFF vs. TLV indicates that 10% reduction in MRI-PDFF predicts 257 mL reduction in TLV. Conclusions MRI-PDFF and TLV strongly correlated with TLFI. Decreases in steatosis were associated with an improvement in hepatomegaly. Lower values of these measures reflect lower histologic-steatosis grades. MRI-derived measures of liver fat and volume may be used as dynamic and more responsive imaging biomarkers in a NASH trial than histology. number, NCT01766713. PMID:28116801

  17. High-Speed imaging of the plasma response to resonant magnetic perturbations in HBT-EP

    International Nuclear Information System (INIS)

    Angelini, Sarah M; Levesque, Jeffrey P; Mauel, Michael E; Navratil, Gerald A


    A Phantom v7.3 fast digital camera was used to study visible light fluctuations in the High Beta Tokamak–Extended Pulse (HBT–EP). This video data is the first to be used to analyze and understand the behavior of long wavelength kink perturbations in a wall-stabilized tokamak. The light was mostly comprised of Dα 656 nm light. Profiles of the plasma light at the midplane were hollow with a radial scale length of approximately 4 cm at the plasma edge. The fast camera was also used to measure the plasma’s response to applied helical magnetic perturbations. The programmed toroidal phase angle of the resonant magnetic perturbation (RMP) was directly inferred from the resulting images of the plasma response. The plasma response and the intensity of the RMP were compared under different conditions. The resulting amplitude correlations are consistent with previous measurements of the static response using an array of magnetic sensors. (paper)

  18. Magnetic Resonance Imaging Identifies Differential Response to Pro-Oxidant Chemotherapy in a Xenograft Model

    Directory of Open Access Journals (Sweden)

    Terry H. Landowski


    Full Text Available Induction of oxidative stress is a key component of cancer therapy. Pro-oxidant drugs have been demonstrated to enhance the efficacy of radiotherapy and chemotherapy. An emerging concept is that therapeutic outcomes are dictated by the differential redox buffering reserve in subpopulations of malignant cells, indicating the need for noninvasive biomarkers of tumor redox that can be used for dose identification and response assessment in a longitudinal setting. Magnetic resonance imaging (MRI enhanced with the thiol-binding contrast agent Gd-LC6-SH, and hemodynamic response imaging (HRI in combination with hypercapnia and hyperoxia were investigated as biomarkers of the pharmacodynamics of the small molecule pro-oxidant imexon (IMX. Human multiple myeloma cell lines 8226/S and an IMX-resistant variant, 8226/IM10, were established as contralateral tumors in SCID mice. T1slope, an MRI measure of the washout rate of Gd-LC6-SH, was significantly lower post-IMX therapy in 8226/S tumors compared with vehicle controls, indicating treatment-related oxidization of the tumor microenvironment, which was confirmed by analysis of tumor tissue for thiols. T1slope and ex vivo assays for thiols both indicated a more reduced microenvironment in 8226/IM10 tumors following IMX therapy. HRI with hypercapnia challenge revealed IMX inhibition of vascular dilation in 8226/S tumors but not 8226/IM10 tumors, consistent with decreased immunohistochemical staining for smooth muscle actin in treated 8226/S tumors. MRI enhanced with Gd-LC6-SH, and HRI coupled with a hypercapnic challenge provide noninvasive biomarkers of tumor response to the redox modulator imexon.

  19. Magnetic resonance imaging (MRI

    Directory of Open Access Journals (Sweden)

    Takavar A


    Full Text Available Basic physical principles of nuclear magnetic resonance imaging (N.M.R.I, a nonionizing medical imaging technique, are described. Principles of NMRI with other conventional imaging methods, ie, isotope scanning, ultrasonography and radiography have been compared. T1 and T2 and spin density (S.D. factors and different image construction techniques based on their different combinations is discussed and at the end physical properties of some N.M.R images is mentioned.

  20. Magnetic resonance imaging (MRI)


    Takavar A


    Basic physical principles of nuclear magnetic resonance imaging (N.M.R.I), a nonionizing medical imaging technique, are described. Principles of NMRI with other conventional imaging methods, ie, isotope scanning, ultrasonography and radiography have been compared. T1 and T2 and spin density (S.D.) factors and different image construction techniques based on their different combinations is discussed and at the end physical properties of some N.M.R images is mentioned.

  1. Rectal Cancer: Mucinous Carcinoma on Magnetic Resonance Imaging Indicates Poor Response to Neoadjuvant Chemoradiation

    International Nuclear Information System (INIS)

    Oberholzer, Katja; Menig, Matthias; Kreft, Andreas; Schneider, Astrid; Junginger, Theodor; Heintz, Achim; Kreitner, Karl-Friedrich; Hötker, Andreas M.; Hansen, Torsten; Düber, Christoph; Schmidberger, Heinz


    Purpose: To assess response of locally advanced rectal carcinoma to chemoradiation with regard to mucinous status and local tumor invasion found at pretherapeutic magnetic resonance imaging (MRI). Methods and Materials: A total of 88 patients were included in this prospective study of patients with advanced mrT3 and mrT4 carcinomas. Carcinomas were categorized by MRI as mucinous (mucin proportion >50% within the tumor volume), and as nonmucinous. Patients received neoadjuvant chemoradiation consisting of 50.4 Gy (1.8 Gy/fraction) and 5-fluorouracil on Days 1 to 5 and Days 29 to 33. Therapy response was assessed by comparing pretherapeutic MRI with histopathology of surgical specimens (minimum distance between outer tumor edge and circumferential resection margin = CRM, T, and N category). Results: A mucinous carcinoma was found in 21 of 88 patients. Pretherapeutic mrCRM was 0 mm (median) in the mucinous and nonmucinous group. Of the 88 patients, 83 underwent surgery with tumor resection. The ypCRM (mm) at histopathology was significantly lower in mucinous carcinomas than in nonmucinous carcinomas (p ≤ 0.001). Positive resection margins (ypCRM ≤ 1 mm) were found more frequently in mucinous carcinomas than in nonmucinous ones (p ≤ 0.001). Treatment had less effect on local tumor stage in mucinous carcinomas than in nonmucinous carcinomas (for T downsizing, p = 0.012; for N downstaging, p = 0.007). Disease progression was observed only in patients with mucinous carcinomas (n = 5). Conclusion: Mucinous status at pretherapeutic MRI was associated with a noticeably worse response to chemoradiation and should be assessed by MRI in addition to local tumor staging to estimate response to treatment before it is initiated.

  2. Magnetic resonance imaging

    International Nuclear Information System (INIS)

    Robertson, Angus


    An assessment is made of the clinical benefits of expensive diagnostic technology, such as the magnetic resonance imaging. It is concluded that to most radiologists, magnetic resonance imaging has a definite place in the diagnostic scenario, especially for demonstrating central nervous system lesions in multiple sclerosis. While it is recognized that medical and financial resources are limited, it is emphasised that the cost to society must be balanced against the patient benefit. 17 refs

  3. Role of magnetic resonance diffusion-weighted imaging in evaluating response after chemoembolization of hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Yuan Zheng; Ye Xiaodan; Dong Sheng; Xu Lichao; Xu Xueyuan; Liu Shiyuan; Xiao Xiangsheng


    Objective: To investigate the value of hepatocellular carcinoma pretreatment apparent diffusion coefficients (ADCs) and its ADCs changes after treatment in predicting and early monitoring the response after chemoembolization. Materials and methods: Twenty-five responding and nine nonresponding hepatocellular carcinoma lesions were prospectively evaluated with magnetic resonance diffusion-weighted imaging in 24 h before and in 48 h after chemoembolization. Quantitative ADC maps were calculated with images with b values of 0 and 500 s/mm 2 . Results: Nonresponding lesions had a significantly higher pretreatment mean ADC than did responding lesions (1.726 ± 0.323 x 10 -3 mm 2 /s vs.1.294 ± 0.185 10 -3 mm 2 /s, P ≤ 0.001). The results of receiver operator characteristic (ROC) analysis for identification of nonresponding lesions showed that threshold ADC value of 1.618 x 10 -3 mm 2 /s had 96.0% sensitivity and 77.8% specificity. After transarterial chemoembolization, responding lesions had a significant increase in %ADC values than did nonresponding lesions (32.63% vs. 5.24%, P = 0.025). The results of ROC analysis for identification of responding lesions showed that threshold %ADC value of 16.21% had 72% sensitivity and 100% specificity. No significant change was observed in normal liver parenchyma (P = 0.862) and spleen (P = 0.052). Conclusion: High pretreatment mean ADC value of hepatocellular carcinoma was predictive of poor response to chemoembolization. A significant increase in %ADC value was observed in lesions that responded to chemoembolization.

  4. Role of magnetic resonance diffusion-weighted imaging in evaluating response after chemoembolization of hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Yuan Zheng, E-mail: [Department of Radiology, Affiliated Changzheng Hospital, Second Military Medical University, 415 Feng Yang Road, Shanghai 200003 (China); Ye Xiaodan [Department of Radiology, Affiliated Changzheng Hospital, Second Military Medical University, 415 Feng Yang Road, Shanghai 200003 (China); Department of Radiology, Affiliated Shanghai Chest Hospital, Shanghai Jiaotong University, 241 West Huai Hai Road, Shanghai 200030 (China); Dong Sheng, E-mail: [Department of Radiology, Affiliated Changzheng Hospital, Second Military Medical University, 415 Feng Yang Road, Shanghai 200003 (China); Xu Lichao; Xu Xueyuan; Liu Shiyuan; Xiao Xiangsheng [Department of Radiology, Affiliated Changzheng Hospital, Second Military Medical University, 415 Feng Yang Road, Shanghai 200003 (China)


    Objective: To investigate the value of hepatocellular carcinoma pretreatment apparent diffusion coefficients (ADCs) and its ADCs changes after treatment in predicting and early monitoring the response after chemoembolization. Materials and methods: Twenty-five responding and nine nonresponding hepatocellular carcinoma lesions were prospectively evaluated with magnetic resonance diffusion-weighted imaging in 24 h before and in 48 h after chemoembolization. Quantitative ADC maps were calculated with images with b values of 0 and 500 s/mm{sup 2}. Results: Nonresponding lesions had a significantly higher pretreatment mean ADC than did responding lesions (1.726 {+-} 0.323 x 10{sup -3} mm{sup 2}/s vs.1.294 {+-} 0.185 10{sup -3} mm{sup 2}/s, P {<=} 0.001). The results of receiver operator characteristic (ROC) analysis for identification of nonresponding lesions showed that threshold ADC value of 1.618 x 10{sup -3} mm{sup 2}/s had 96.0% sensitivity and 77.8% specificity. After transarterial chemoembolization, responding lesions had a significant increase in %ADC values than did nonresponding lesions (32.63% vs. 5.24%, P = 0.025). The results of ROC analysis for identification of responding lesions showed that threshold %ADC value of 16.21% had 72% sensitivity and 100% specificity. No significant change was observed in normal liver parenchyma (P = 0.862) and spleen (P = 0.052). Conclusion: High pretreatment mean ADC value of hepatocellular carcinoma was predictive of poor response to chemoembolization. A significant increase in %ADC value was observed in lesions that responded to chemoembolization.

  5. Imaging by magnetic resonance

    International Nuclear Information System (INIS)

    Duroure, J.F.; Serpolay, H.; Vallens, D.


    Here are described the advanced technology for nuclear magnetic resonance imaging: reduction of acquisition times, and rebuilding times, images quality improvement. The tendency is to open the machines at low and middle field, on a market being at 10% of NMR I sales, with economical, scientifical and ergonomic reasons broadly developed by constructors

  6. Functional Magnetic Resonance Imaging (United States)

    Voos, Avery; Pelphrey, Kevin


    Functional magnetic resonance imaging (fMRI), with its excellent spatial resolution and ability to visualize networks of neuroanatomical structures involved in complex information processing, has become the dominant technique for the study of brain function and its development. The accessibility of in-vivo pediatric brain-imaging techniques…

  7. Prediction of Individual Response to Electroconvulsive Therapy via Machine Learning on Structural Magnetic Resonance Imaging Data. (United States)

    Redlich, Ronny; Opel, Nils; Grotegerd, Dominik; Dohm, Katharina; Zaremba, Dario; Bürger, Christian; Münker, Sandra; Mühlmann, Lisa; Wahl, Patricia; Heindel, Walter; Arolt, Volker; Alferink, Judith; Zwanzger, Peter; Zavorotnyy, Maxim; Kugel, Harald; Dannlowski, Udo


    Electroconvulsive therapy (ECT) is one of the most effective treatments for severe depression. However, biomarkers that accurately predict a response to ECT remain unidentified. To investigate whether certain factors identified by structural magnetic resonance imaging (MRI) techniques are able to predict ECT response. In this nonrandomized prospective study, gray matter structure was assessed twice at approximately 6 weeks apart using 3-T MRI and voxel-based morphometry. Patients were recruited through the inpatient service of the Department of Psychiatry, University of Muenster, from March 11, 2010, to March 27, 2015. Two patient groups with acute major depressive disorder were included. One group received an ECT series in addition to antidepressants (n = 24); a comparison sample was treated solely with antidepressants (n = 23). Both groups were compared with a sample of healthy control participants (n = 21). Binary pattern classification was used to predict ECT response by structural MRI that was performed before treatment. In addition, univariate analysis was conducted to predict reduction of the Hamilton Depression Rating Scale score by pretreatment gray matter volumes and to investigate ECT-related structural changes. One participant in the ECT sample was excluded from the analysis, leaving 67 participants (27 men and 40 women; mean [SD] age, 43.7 [10.6] years). The binary pattern classification yielded a successful prediction of ECT response, with accuracy rates of 78.3% (18 of 23 patients in the ECT sample) and sensitivity rates of 100% (13 of 13 who responded to ECT). Furthermore, a support vector regression yielded a significant prediction of relative reduction in the Hamilton Depression Rating Scale score. The principal findings of the univariate model indicated a positive association between pretreatment subgenual cingulate volume and individual ECT response (Montreal Neurological Institute [MNI] coordinates x = 8, y = 21, z = -18

  8. Nuclear magnetic resonance imaging

    International Nuclear Information System (INIS)

    Young, I.R.


    In a method of imaging a body in which nuclear magnetic resonance is excited in a region including part of the body, and the free induction decay signal is measured, a known quantity of a material of known nuclear magnetic resonance properties, for example a bag of water, is included in the region so as to enhance the measured free induction decay signal. This then reduces the generation of noise during subsequent processing of the signal. (author)

  9. Magnetic resonance imaging in spondyloarthritis--how to quantify findings and measure response

    DEFF Research Database (Denmark)

    Østergaard, Mikkel; Poggenborg, René Panduro; Axelsen, Mette Bjørndal


    Sensitive and reliable tools for monitoring disease activity and damage, and for prognostication, are essential in the management of patients with spondyloarthritis, including ankylosing spondylitis and psoriatic arthritis. Magnetic resonance imaging (MRI) allows direct visualisation of inflammat...... and clinical practice. The present article reviews key aspects of the status and recent important advances in MRI in spondyloarthritis, focussing on available MRI tools for assessing activity and damage in peripheral and, particularly, axial joints....

  10. Magnetic resonance imaging

    International Nuclear Information System (INIS)



    Magnetic resonance imaging (MRI) is a new and innovative technique that affords anatomic images in multiple planes and that may provide information about tissue characterization. The magnetic resonance images are obtained by placing the patient or the area of interest within a powerful, highly uniform, static magnetic field. Magnetized protons (hydrogen nuclei) within the patient align like small magnets in this field. Radiofrequency pulses are then used to create an oscillating magnetic field perpendicular to the main field. Magnetic resonance images differ from those produced by x-rays: the latter are associated with absorption of x-ray energy while magnetic resonance images are based on proton density and proton relaxation dynamics. Proton characteristics vary according to the tissue under examination and reflect its physical and chemical properties. To resolve issues regarding safety and efficacy, the Warren Grant Magnuson Clinical Center and the Office of Medical Applications of Research of the National Institutes of Health (NIH) convened a consensus conference about MRI Oct 26 through 28, 1987. At the NIH, the Consensus Development Conference brings together investigators in the biomedical sciences, clinical investigators, practicing physicians, and consumer and special interest groups to make a scientific assessment of technologies, including drugs, devices, and procedures, and to seek agreement on their safety and effectiveness

  11. Magnetic resonance imaging

    International Nuclear Information System (INIS)

    Sigal, R.


    This book is an introduction to magnetic resonance imaging (MRI). The basic principles for the interpretation of MR images are developed. The book is divided into five chapters: introduction, tissue, parameters, acquisition parameters, contribution to diagnosis, and practical management of an MR examination. Eight exercises allow the reader to test the knowledge he has acquired. Signal localization and MR artefacts are reviewed in an appendix

  12. Electron Paramagnetic Resonance Imaging

    Indian Academy of Sciences (India)

    Twentieth century bore witness to remarkable scientists whohave advanced our understanding of the brain. Among them,EPR (Electron Paramagnetic Resonance) imaging is particularlyuseful in monitoring hypoxic zones in tumors which arehighly resistant to radiation and chemotherapeutic treatment.This first part of the ...

  13. Nuclear magnetic resonance imaging

    International Nuclear Information System (INIS)


    This report summarises the aspects of nuclear magnetic resonance imaging (NMRI) considered by the National Health Technology Advisory Panel and makes recommendations on its introduction in Australia with particular regard to the need for thorough evaluation of its cost effectiveness. Topics covered are: principles of the technique, equipment required, installation, costs, reliability, performance parameters, clinical indications, training and staff requirements, and safety considerations

  14. Cranial magnetic resonance imaging

    International Nuclear Information System (INIS)

    Elster, A.D.


    Cranial Magnetic Resonance Imaging is comprehensive, well structured, and well written. The material is current and well referenced. The illustrations are good and complement the text well. The overall quality of publication is above average. The greatest attribute of the book is its readability. The author demonstrates ample skill in making complex subjects, such as MR physics and imaging of cerebral hemorrhage, easy to understand. The book closes with a detailed atlas on the anatomic appearance of the brain on MR images in the axial, coronal, and sagittal planes

  15. Dental magnetic resonance imaging

    International Nuclear Information System (INIS)

    Hilgenfeld, Tim; Bendszus, Martin; Haehnel, Stefan


    Growing distribution and utilization of digital volume tomography (DVT) extend the spectrum of clinical dental imaging. Additional diagnostic value, however, comes along with an increasing amount of radiation. In contrast, magnetic resonance imaging is a radiation free imaging technique. Furthermore, it offers a high soft tissue contrast. Morphological and numerical dental anomalies, differentiation of periapical lesions and exclusion of complications of dental diseases are field of applications for dental MRI. In addition, detection of caries and periodontal lesions and injury of inferior alveolar nerve are promising application areas in the future.

  16. Magnetic Resonance Imaging (MRI) Safety (United States)

    ... News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) Safety What is MRI and how ... What is MRI and how does it work? Magnetic resonance imaging, or MRI, is a way of obtaining ...

  17. Magnetic Resonance Imaging of Stroke

    NARCIS (Netherlands)

    Bouts, Mark. J. R. J.; Wu, O.; Dijkhuizen, R. M.


    Magnetic resonance imaging (MRI) provides a powerful (neuro)imaging modality for the diagnosis and outcome prediction after (acute) stroke. Since MRI allows noninvasive, longitudinal, and three-dimensional assessment of vessel occlusion (with magnetic resonance angiography (MRA)), tissue injury

  18. Children's (Pediatric) Magnetic Resonance Imaging (United States)

    ... Physician Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic Resonance Imaging Children’s magnetic resonance imaging (MRI) ... limitations of Children’s (Pediatric) MRI? What is Children’s (Pediatric) MRI? Magnetic resonance imaging (MRI) is a noninvasive ...

  19. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Physician Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic Resonance Imaging Children’s magnetic resonance imaging (MRI) ... limitations of Children’s (Pediatric) MRI? What is Children’s (Pediatric) MRI? Magnetic resonance imaging (MRI) is a noninvasive ...

  20. Magnetic Resonance Imaging (MRI) -- Head (United States)

    ... News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) - Head Magnetic resonance imaging (MRI) of the head uses a powerful ... the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is a noninvasive medical test that ...

  1. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic Resonance Imaging Children’s magnetic resonance imaging ( ... the limitations of Children’s (Pediatric) MRI? What is Children’s (Pediatric) MRI? Magnetic resonance imaging (MRI) is a ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) - Head Magnetic resonance imaging (MRI) of the head uses a powerful ... the Head? What is MRI of the Head? Magnetic resonance imaging (MRI) is a noninvasive medical test that ...

  3. Parallel magnetic resonance imaging

    International Nuclear Information System (INIS)

    Larkman, David J; Nunes, Rita G


    Parallel imaging has been the single biggest innovation in magnetic resonance imaging in the last decade. The use of multiple receiver coils to augment the time consuming Fourier encoding has reduced acquisition times significantly. This increase in speed comes at a time when other approaches to acquisition time reduction were reaching engineering and human limits. A brief summary of spatial encoding in MRI is followed by an introduction to the problem parallel imaging is designed to solve. There are a large number of parallel reconstruction algorithms; this article reviews a cross-section, SENSE, SMASH, g-SMASH and GRAPPA, selected to demonstrate the different approaches. Theoretical (the g-factor) and practical (coil design) limits to acquisition speed are reviewed. The practical implementation of parallel imaging is also discussed, in particular coil calibration. How to recognize potential failure modes and their associated artefacts are shown. Well-established applications including angiography, cardiac imaging and applications using echo planar imaging are reviewed and we discuss what makes a good application for parallel imaging. Finally, active research areas where parallel imaging is being used to improve data quality by repairing artefacted images are also reviewed. (invited topical review)

  4. Functional magnetic resonance imaging by visual stimulation

    International Nuclear Information System (INIS)

    Nishimura, Yukiko; Negoro, Kiyoshi; Morimatsu, Mitsunori; Hashida, Masahiro


    We evaluated functional magnetic resonance images obtained in 8 healthy subjects in response to visual stimulation using a conventional clinical magnetic resonance imaging system with multi-slice spin-echo echo planar imaging. Activation in the visual cortex was clearly demonstrated by the multi-slice experiment with a task-related change in signal intensity. In addition to the primary visual cortex, other areas were also activated by a complicated visual task. Multi-slice spin-echo echo planar imaging offers high temporal resolution and allows the three-dimensional analysis of brain function. Functional magnetic resonance imaging provides a useful noninvasive method of mapping brain function. (author)

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... As the hydrogen atoms return to their usual alignment, they emit different amounts of energy that vary ... story about radiology? Share your patient story here Images × Image Gallery Magnetic Resonance Imaging (MRI) procedure View ...

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... it is useful to bring that to the attention of the scheduler before the exam and bring ... Image Gallery Magnetic Resonance Imaging (MRI) procedure View full size with caption Pediatric Content Some imaging tests ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... for Brain Tumors Radiation Therapy for Head and Neck Cancer Others : American Stroke Association National Stroke Association ... MRA) Magnetic Resonance, Functional (fMRI) - Brain Head and Neck Cancer Treatment Brain Tumor Treatment Magnetic Resonance Imaging ( ...

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic Resonance Imaging Children’s magnetic resonance imaging (MRI) uses ... identify and accurately characterize diseases than other imaging methods. This detail makes MRI an invaluable tool in ...

  9. Neural responses to visual food cues according to weight status: a systematic review of functional magnetic resonance imaging studies. (United States)

    Pursey, Kirrilly M; Stanwell, Peter; Callister, Robert J; Brain, Katherine; Collins, Clare E; Burrows, Tracy L


    Emerging evidence from recent neuroimaging studies suggests that specific food-related behaviors contribute to the development of obesity. The aim of this review was to report the neural responses to visual food cues, as assessed by functional magnetic resonance imaging (fMRI), in humans of differing weight status. Published studies to 2014 were retrieved and included if they used visual food cues, studied humans >18 years old, reported weight status, and included fMRI outcomes. Sixty studies were identified that investigated the neural responses of healthy weight participants (n = 26), healthy weight compared to obese participants (n = 17), and weight-loss interventions (n = 12). High-calorie food images were used in the majority of studies (n = 36), however, image selection justification was only provided in 19 studies. Obese individuals had increased activation of reward-related brain areas including the insula and orbitofrontal cortex in response to visual food cues compared to healthy weight individuals, and this was particularly evident in response to energy dense cues. Additionally, obese individuals were more responsive to food images when satiated. Meta-analysis of changes in neural activation post-weight loss revealed small areas of convergence across studies in brain areas related to emotion, memory, and learning, including the cingulate gyrus, lentiform nucleus, and precuneus. Differential activation patterns to visual food cues were observed between obese, healthy weight, and weight-loss populations. Future studies require standardization of nutrition variables and fMRI outcomes to enable more direct comparisons between studies.

  10. Magnetic resonance imaging. 1

    International Nuclear Information System (INIS)

    Wall, E.E. van der; Roos, A.A. de; Doornbos, J.; Dijkman, P.R.M. van; Matheijssen, N.A.A.; Laarse, A. van der; Krauss, X.H.; Blokland, J.A.k.; Manger Cats, V.; Voorthuisen, A.E. van; Bruschke, A.V.G.


    The cardiovascular applications of MRI in coronary artery disease have considerably increased in recent years. Although many applications overlap those of other more cost-effective techniques, such as echocardiography, radionuclide angiography, and CT, MRI offers unique features not shared by the conventional techniques. Technical advantages are the excellent spatial resolution, the characterization of myocardial tissue, and the potential for three-dimensional imaging. This allows the accurate assessment of left ventricular mass and volume, the differentiation of infarcted tissue from normal myocardial tissue, and the determination of systolic wall thickening and regional wall motion abnormalities. Also inducible myocardial ischemia using pharmacological stress (dipyramidole or dobutamine) may be assessed by magnetic resonance imaging. Future technical developments include real-time imaging and noninvasive visualization of the coronary arteries. These advantages will have a major impact on the application of MRI in coronary artery disease, potentially unsurpassed by other techniques and certainly justifying the expenses. Consequently, the clinical use of MRI for the detection of coronary artery disease largely depends on the progress of technical developments. (author). 134 refs.; 10 figs.; 2 tabs

  11. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... As the hydrogen atoms return to their usual alignment, they emit different amounts of energy that vary ... story about radiology? Share your patient story here Images × Image Gallery Radiologist prepping patient for magnetic resonance ...

  12. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... by the interpreting radiologist. Frequently, the differentiation of abnormal (diseased) tissue from normal tissues is better with ... Tumor Treatment Magnetic Resonance Imaging (MRI) Safety Alzheimer's Disease Head Injury Brain Tumors Images related to Magnetic ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... it is useful to bring that to the attention of the technologist or scheduler before the exam. ... patient for magnetic resonance imaging (MRI) exam. View full size with caption Pediatric Content Some imaging tests ...

  14. Magnetic Resonance Imaging. Chapter 15

    Energy Technology Data Exchange (ETDEWEB)

    Leach, M. O. [The Institute of Cancer Research and The Royal Marsden Hospital, London (United Kingdom)


    In Chapter 14, the principles of nuclear magnetic resonance were presented, along with an introduction to image forming processes. In this chapter, magnetic resonance imaging (MRI) will be reviewed, beginning with the hardware needed and its impact on image quality. The acquisition processes and image reconstruction will be discussed, as well as the artefacts that are possible, with discussion of the important area of safety and bioeffects completing the chapter.

  15. Magnetic resonance imaging methodology

    International Nuclear Information System (INIS)

    Moser, Ewald; Stadlbauer, Andreas; Windischberger, Christian; Quick, Harald H.; Ladd, Mark E.


    Magnetic resonance (MR) methods are non-invasive techniques to provide detailed, multi-parametric information on human anatomy, function and metabolism. Sensitivity, specificity, spatial and temporal resolution may, however, vary depending on hardware (e.g., field strength, gradient strength and speed) and software (optimised measurement protocols and parameters for the various techniques). Furthermore, multi-modality imaging may enhance specificity to better characterise complex disease patterns. Positron emission tomography (PET) is an interesting, largely complementary modality, which might be combined with MR. Despite obvious advantages, combining these rather different physical methods may also pose challenging problems. At this early stage, it seems that PET quality may be preserved in the magnetic field and, if an adequate detector material is used for the PET, MR sensitivity should not be significantly degraded. Again, this may vary for the different MR techniques, whereby functional and metabolic MR is more susceptible than standard anatomical imaging. Here we provide a short introduction to MR basics and MR techniques, also discussing advantages, artefacts and problems when MR hardware and PET detectors are combined. In addition to references for more detailed descriptions of MR fundamentals and applications, we provide an early outlook on this novel and exciting multi-modality approach to PET/MR. (orig.)

  16. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic Resonance Imaging Children’s magnetic resonance imaging (MRI) uses a powerful ... for an MRI exam contains a metal called gadolinium . Gadolinium can be used in patients with iodine ...

  17. Visualizing arthritic inflammation and therapeutic response by fluorine-19 magnetic resonance imaging (19F MRI

    Directory of Open Access Journals (Sweden)

    Balducci Anthony


    Full Text Available Abstract Background Non-invasive imaging of inflammation to measure the progression of autoimmune diseases, such as rheumatoid arthritis (RA, and to monitor responses to therapy is critically needed. V-Sense, a perfluorocarbon (PFC contrast agent that preferentially labels inflammatory cells, which are then recruited out of systemic circulation to sites of inflammation, enables detection by 19F MRI. With no 19F background in the host, detection is highly-specific and can act as a proxy biomarker of the degree of inflammation present. Methods Collagen-induced arthritis in rats, a model with many similarities to human RA, was used to study the ability of the PFC contrast agent to reveal the accumulation of inflammation over time using 19F MRI. Disease progression in the rat hind limbs was monitored by caliper measurements and 19F MRI on days 15, 22 and 29, including the height of clinically symptomatic disease. Naïve rats served as controls. The capacity of the PFC contrast agent and 19F MRI to assess the effectiveness of therapy was studied in a cohort of rats administered oral prednisolone on days 14 to 28. Results Quantification of 19F signal measured by MRI in affected limbs was linearly correlated with disease severity. In animals with progressive disease, increases in 19F signal reflected the ongoing recruitment of inflammatory cells to the site, while no increase in 19F signal was observed in animals receiving treatment which resulted in clinical resolution of disease. Conclusion These results indicate that 19F MRI may be used to quantitatively and qualitatively evaluate longitudinal responses to a therapeutic regimen, while additionally revealing the recruitment of monocytic cells involved in the inflammatory process to the anatomical site. This study may support the use of 19F MRI to clinically quantify and monitor the severity of inflammation, and to assess the effectiveness of treatments in RA and other diseases with an inflammatory

  18. Quantitative correlational study of microbubble-enhanced ultrasound imaging and magnetic resonance imaging of glioma and early response to radiotherapy in a rat model

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Chen [Department of Ultrasound, Zhejiang Cancer Hospital, Hangzhou, Zhejiang 310022 (China); Lee, Dong-Hoon; Zhang, Kai; Li, Wenxiao; Zhou, Jinyuan [Division of MR Research, Department of Radiology, Johns Hopkins University, School of Medicine, Baltimore, Maryland 21287 (United States); Mangraviti, Antonella; Tyler, Betty [Department of Neurosurgery, Johns Hopkins University, School of Medicine, Baltimore, Maryland 21287 (United States); Su, Lin; Zhang, Yin; Zhang, Bin; Wong, John; Wang, Ken Kang-Hsin; Velarde, Esteban; Ding, Kai, E-mail: [Department of Radiation Oncology and Molecular Radiation Sciences, Johns Hopkins University, School of Medicine, Baltimore, Maryland 21231 (United States)


    Purpose: Radiotherapy remains a major treatment method for malignant tumors. Magnetic resonance imaging (MRI) is the standard modality for assessing glioma treatment response in the clinic. Compared to MRI, ultrasound imaging is low-cost and portable and can be used during intraoperative procedures. The purpose of this study was to quantitatively compare contrast-enhanced ultrasound (CEUS) imaging and MRI of irradiated gliomas in rats and to determine which quantitative ultrasound imaging parameters can be used for the assessment of early response to radiation in glioma. Methods: Thirteen nude rats with U87 glioma were used. A small thinned skull window preparation was performed to facilitate ultrasound imaging and mimic intraoperative procedures. Both CEUS and MRI with structural, functional, and molecular imaging parameters were performed at preradiation and at 1 day and 4 days postradiation. Statistical analysis was performed to determine the correlations between MRI and CEUS parameters and the changes between pre- and postradiation imaging. Results: Area under the curve (AUC) in CEUS showed significant difference between preradiation and 4 days postradiation, along with four MRI parameters, T{sub 2}, apparent diffusion coefficient, cerebral blood flow, and amide proton transfer-weighted (APTw) (all p < 0.05). The APTw signal was correlated with three CEUS parameters, rise time (r = − 0.527, p < 0.05), time to peak (r = − 0.501, p < 0.05), and perfusion index (r = 458, p < 0.05). Cerebral blood flow was correlated with rise time (r = − 0.589, p < 0.01) and time to peak (r = − 0.543, p < 0.05). Conclusions: MRI can be used for the assessment of radiotherapy treatment response and CEUS with AUC as a new technique and can also be one of the assessment methods for early response to radiation in glioma.

  19. Magnetic resonance imaging of hypophysis

    International Nuclear Information System (INIS)

    Malla Huesh, I. V.


    Hypothalamic-pituitary diseases represent with wide variety of symptoms in regard with changes in the endocrine function. Magnetic resonance imaging has a crucial role in detecting the morphologic appearance in physiologic conditions, malformative diseases and acquired pathologies. The MR-imaging is established as the method of choice in assessing the changes in the hypothalamic-pituitary axis. The pituitary gland is a complex structure with an important role in the homeostasis of the organism even though it is so small? It is surrounded by bony structures, vessels, nerves and the brain parenchyma. It consists of three parts - anterior called - adenohypophysis, posterior - neurohypophysis and pituitary stalk. The anterior part comprises about 75% of the gland. Computed tomography (CT) has a limited role in detecting the pituitary gland. It is mainly used in cases of elevated intracranial pressure due to suspected apoplexy. The gland's small size, relation to other structures and its soft tissue characteristic make it an accessible region of interest for detecting with MR-imaging. The lack of ionizing energy and the technical advances in the MR-methods are responsible for the creating images with better spatial resolution and signal to noise ratio. The examination is carried out on a standard protocol. It is important that thin slices are executed in sagittal and coronal planes. Performing a sequence, regarding the brain parenchyma is essential, since many malformations of the pituitary gland are associated with other congenital conditions. The examination starts with a T1W sequence to assess the normal anatomic condition of the gland. The intensity of the adenohypophysis is compared to the one in the pons. It is hypointense, whereas the neurohypophysis is hyperintense, due to the lipid neurosecretory granules transported along the hypothalamic-pituitary axis. T2W-images in coronal plane are used to evaluate the hypothalamus, pituitary stalk, optic chiasm, olfactory

  20. Gd-labeled glycol chitosan as a pH-responsive magnetic resonance imaging agent for detecting acidic tumor microenvironments. (United States)

    Nwe, Kido; Huang, Ching-Hui; Tsourkas, Andrew


    Neoplastic lesions can create a hostile tumor microenvironment with low extracellular pH. It is commonly believed that these conditions can contribute to tumor progression as well as resistance to therapy. We report the development and characterization of a pH-responsive magnetic resonance imaging contrast agent for imaging the acidic tumor microenvironment. The preparation included the conjugation of 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid 1-(2,5-dioxo-1-pyrrolidinyl) ester (DOTA-NHS) to the surface of a water-soluble glycol chitosan (GC) polymer, which contains pH-titrable primary amines, followed by gadolinium complexation (GC-NH2-GdDOTA). GC-NH2-GdDOTA had a chelate-to-polymer ratio of approximately1:24 and a molar relaxivity of 9.1 mM(-1) s(-1). GC-NH2-GdDOTA demonstrated pH-dependent cellular association in vitro compared to the control. It also generated a 2.4-fold enhancement in signal in tumor-bearing mice 2 h postinjection. These findings suggest that glycol chitosan coupled with contrast agents can provide important diagnostic information about the tumor microenvironment.

  1. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... work? Unlike conventional x-ray examinations and computed tomography (CT) scans, MRI does not utilize ionizing radiation. Instead, ... Angiography Magnetic Resonance, Functional (fMRI) - Brain Children's (Pediatric) CT (Computed Tomography) Magnetic Resonance Imaging (MRI) Safety Contrast Materials Children ...

  2. Functional magnetic resonance imaging of human hypothalamic responses to sweet taste and calories

    NARCIS (Netherlands)

    Smeets, P.A.M.; Graaf, C. de; Stafleu, A.; Osch, M.J.P. van; Grond, J. van der


    Background: Evidence exists that beverages do not trigger appropriate anticipatory physiologic responses, such as cephalic phase insulin release. Therefore, it is of interest to elucidate the food properties necessary for triggering adaptive responses. Previously, we found a prolonged dose-dependent

  3. Functional magnetic resonance imaging of human hypothalamic responses to sweet taste and calories

    NARCIS (Netherlands)

    Smeets, P.A.M.; Graaf, de C.; Stafleu, A.; Osch, M.J.P.; Grond, van der J.


    BACKGROUND: Evidence exists that beverages do not trigger appropriate anticipatory physiologic responses, such as cephalic phase insulin release. Therefore, it is of interest to elucidate the food properties necessary for triggering adaptive responses. Previously, we found a prolonged dose-dependent

  4. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... is not harmful, but it may cause some medical devices to malfunction. Most orthopedic implants pose no ... Head? Magnetic resonance imaging (MRI) is a noninvasive medical test that physicians use to diagnose medical conditions. ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... are the limitations of MRI of the Head? What is MRI of the Head? Magnetic resonance imaging ( ... brain) in routine clinical practice. top of page What are some common uses of the procedure? MR ...

  6. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... magnetic resonance imaging (MRI) uses a powerful magnetic field, radio waves and a computer to produce detailed ... problems, medications, recent surgeries and allergies. The magnetic field is not harmful, but it may cause some ...

  7. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... MRI) exam. View full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy bear denotes child-specific content. Related Articles and Media Catheter Angiography Magnetic Resonance, ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... be necessary. Your doctor will explain the exact reason why another exam is requested. Sometimes a follow- ... necessary in trauma situations. Although there is no reason to believe that magnetic resonance imaging harms the ...

  9. Magnetic resonance imaging the basics

    CERN Document Server

    Constantinides, Christakis


    Magnetic resonance imaging (MRI) is a rapidly developing field in basic applied science and clinical practice. Research efforts in this area have already been recognized with five Nobel prizes awarded to seven Nobel laureates in the past 70 years. Based on courses taught at The Johns Hopkins University, Magnetic Resonance Imaging: The Basics provides a solid introduction to this powerful technology. The book begins with a general description of the phenomenon of magnetic resonance and a brief summary of Fourier transformations in two dimensions. It examines the fundamental principles of physics for nuclear magnetic resonance (NMR) signal formation and image construction and provides a detailed explanation of the mathematical formulation of MRI. Numerous image quantitative indices are discussed, including (among others) signal, noise, signal-to-noise, contrast, and resolution. The second part of the book examines the hardware and electronics of an MRI scanner and the typical measurements and simulations of m...

  10. Presurgical functional magnetic resonance imaging

    International Nuclear Information System (INIS)

    Stippich, C.


    Functional magnetic resonance imaging (fMRI) is an important and novel neuroimaging modality for patients with brain tumors. By non-invasive measurement, localization and lateralization of brain activiation, most importantly of motor and speech function, fMRI facilitates the selection of the most appropriate and sparing treatment and function-preserving surgery. Prerequisites for the diagnostic use of fMRI are the application of dedicated clinical imaging protocols and standardization of the respective imaging procedures. The combination with diffusion tensor imaging (DTI) also enables tracking and visualization of important fiber bundles such as the pyramidal tract and the arcuate fascicle. These multimodal MR data can be implemented in computer systems for functional neuronavigation or radiation treatment. The practicability, accuracy and reliability of presurgical fMRI have been validated by large numbers of published data. However, fMRI cannot be considered as a fully established modality of diagnostic neuroimaging due to the lack of guidelines of the responsible medical associations as well as the lack of medical certification of important hardware and software components. This article reviews the current research in the field and provides practical information relevant for presurgical fMRI. (orig.) [de

  11. Diffusion-weighted magnetic resonance imaging: biomarker for treatment response in oncology

    Directory of Open Access Journals (Sweden)

    Maria Luiza Testa


    Full Text Available The authors report a case where a quantitative assessment of the apparent diffusion coefficient (ADC of liver metastasis in a patient undergoing chemotherapy has shown to be an effective early marker for predicting therapeutic response, anticipating changes in tumor size. A lesion with lower initial ADC value and early increase in such value in the course of the treatment tends to present a better therapeutic response.

  12. The dose-response relationship between cumulative lifting load and lumbar disk degeneration based on magnetic resonance imaging findings. (United States)

    Hung, Yu-Ju; Shih, Tiffany T-F; Chen, Bang-Bin; Hwang, Yaw-Huei; Ma, Li-Ping; Huang, Wen-Chuan; Liou, Saou-Hsing; Ho, Ing-Kang; Guo, Yue L


    Lumbar disk degeneration (LDD) has been related to heavy physical loading. However, the quantification of the exposure has been controversial, and the dose-response relationship with the LDD has not been established. The purpose of this study was to investigate the dose-response relationship between lifetime cumulative lifting load and LDD. This was a cross-sectional study. Every participant received assessments with a questionnaire, magnetic resonance imaging (MRI) of the lumbar spine, and estimation of lumbar disk compression load. The MRI assessments included assessment of disk dehydration, annulus tear, disk height narrowing, bulging, protrusion, extrusion, sequestration, degenerative and spondylolytic spondylolisthesis, foramina narrowing, and nerve root compression on each lumbar disk level. The compression load was predicted using a biomechanical software system. A total of 553 participants were recruited in this study and categorized into tertiles by cumulative lifting load (ie, lifting load. The best dose-response relationships were found at the L5-S1 disk level, in which high cumulative lifting load was associated with elevated odds ratios of 2.5 (95% confidence interval [95% CI]=1.5, 4.1) for dehydration and 4.1 (95% CI=1.9, 10.1) for disk height narrowing compared with low lifting load. Participants exposed to intermediate lifting load had an increased odds ratio of 2.1 (95% CI=1.3, 3.3) for bulging compared with low lifting load. The tests for trend were significant. There is no "gold standard" assessment tool for measuring the lumbar compression load. The results suggest a dose-response relationship between cumulative lifting load and LDD. © 2014 American Physical Therapy Association.

  13. Superresolution Imaging Using Resonant Multiples

    KAUST Repository

    Guo, Bowen


    A resonant multiple is defined as a multiple reflection that revisits the same subsurface location along coincident reflection raypaths. We show that resonant first-order multiples can be migrated with either Kirchhoff or wave-equation migration methods to give images with approximately twice the spatial resolution compared to post-stack primary-reflection images. A moveout-correction stacking method is proposed to enhance the signal-to-noise ratios (SNRs) of the resonant multiples before superresolution migration. The effectiveness of this procedure is validated by synthetic and field data tests.

  14. Superresolution Imaging Using Resonant Multiples

    KAUST Repository

    Guo, Bowen; Schuster, Gerard T.


    A resonant multiple is defined as a multiple reflection that revisits the same subsurface location along coincident reflection raypaths. We show that resonant first-order multiples can be migrated with either Kirchhoff or wave-equation migration methods to give images with approximately twice the spatial resolution compared to post-stack primary-reflection images. A moveout-correction stacking method is proposed to enhance the signal-to-noise ratios (SNRs) of the resonant multiples before superresolution migration. The effectiveness of this procedure is validated by synthetic and field data tests.

  15. Magnetic resonance imaging

    International Nuclear Information System (INIS)

    Murphy, W.A.


    After only a few years, MR imaging has proved to be an important method for imaging disorders of the musculoskeletal tissues. The images are characterized by great inherent contrast, excellent spatial resolution, and exquisite anatomic display - major reasons why MR imaging compares favorably with other imaging methods, such as radionuclide bone scanning and CT. MR imaging is particularly sensitive to bone marrow alterations and is very effective for detection and characterization of a wide variety of soft tissue conditions. Advances in surface coil technology will increase the usefulness of MR imaging in the evaluation of articular disease. In addition, chemical shift imaging and spectroscopy will add physiologic information to the anatomic features demonstrated by proton imaging

  16. Magnetic resonance vascular imaging

    International Nuclear Information System (INIS)

    Axel, L


    The basis principles of MRI are reviewed in order to understand how blood flow effects arise in conventional imaging. Then some of the ways these effects have ben used in MRI techniques specifically designed for vascular imaging, are considered. (author)

  17. Myositis ossificans: magnetic resonance images

    International Nuclear Information System (INIS)

    Dosda, R.; Marti-Bonmati, L.; Concepcion, L.; Galant, J.


    Myositis ossificans is characterized by a benign, self-limiting, ossifying mass of the white tissue. In the present report, we describe the magnetic resonance (MR) images in three cases of myositis ossificans in pediatric patients, correlating the MR findings with those obtained with other radiological studies. The lesions were detected in three patients, two boys and one girl, ranging in age between 10 and 14 years. The nature of the lesion was confirmed histologically in all three cases. The MR images were obtained using superconductive units at 0.5 Teslas, with T1 and T2-weighted spin-echo and STIR sequences. In two patients, gadolinium-enhanced T1-weighted images were also obtained. As in any process of maturation, the proliferation/maturation ratio depends on the moment in the course of the lesion, which affects its MR features,. In acute phases, the soft tissue mass with an intraosseous, perilesional adematous reaction predominates, while annular calcification and lesser edema are characteristic of subacute episode. Myositis ossificans is very rare in children. The inflammatory response may present a radiological pattern difficult to distinguish from that of aggressive tumor or infection, especially in the acute phase. (Author) 7 refs

  18. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Magnetic Resonance Imaging (MRI) - ...

  19. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician ... Magnetic resonance imaging (MRI) is a noninvasive medical test that physicians use to diagnose medical conditions. MRI ...

  20. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician ... Magnetic resonance imaging (MRI) is a noninvasive medical test that physicians use to diagnose medical conditions. MRI ...

  1. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... of which shows a thin slice of the body. The images can then be studied from different angles by ... about radiology? Share your patient story here Images ... Articles and Media Catheter Angiography Magnetic Resonance, Functional (fMRI) - Brain Children's ( ...

  2. Synovial response to intraarticular injections of hyaluronate in frozen shoulder. A quantitative assessment with dynamic magnetic resonance imaging

    International Nuclear Information System (INIS)

    Tamai, Kazuya; Mashitori, Hirotaka; Ohno, Wataru; Hamada, Jun'ichiro; Sakai, Hiroya; Saotome, Koichi


    To clarify the response of frozen shoulder (FS) to intraarticular injections of high-molecular-weight sodium hyaluronate (HA), a mixture of 2.5 ml of HA and 1.5 ml of 1% lidocaine was injected into the glenohumeral joint of 11 patients with FS, 8 of whom received five weekly injections. The patients were assessed using the Japanese Orthopaedic Association shoulder score (JOA score) before the first injection, 1 week after the first injection, and 1 week after the final injection. Following each clinical evaluation, the patients underwent dynamic magnetic resonance imaging enhanced with Gd-DTPA, and the coefficient of enhancement (CE) in the glenohumeral synovium was calculated, with the examiners blinded to the clinical information. The JOA score tended to be greater and the CE smaller after injection than before injection. The changes in the CE following both single and repeated injections were negatively correlated with changes in the JOA score. Thus, clinical improvement in patients with FS was associated with a decrease in the CE. Because the CE depends on the degree of synovitis, the therapeutic effect of intraarticular HA injection for FS results, at least in part, from suppression of synovitis in the glenohumeral joint through an antiinflammatory effect. (author)

  3. Quantitative Multi-Parametric Magnetic Resonance Imaging of Tumor Response to Photodynamic Therapy.

    Directory of Open Access Journals (Sweden)

    Tom J L Schreurs

    Full Text Available The aim of this study was to characterize response to photodynamic therapy (PDT in a mouse cancer model using a multi-parametric quantitative MRI protocol and to identify MR parameters as potential biomarkers for early assessment of treatment outcome.CT26.WT colon carcinoma tumors were grown subcutaneously in the hind limb of BALB/c mice. Therapy consisted of intravenous injection of the photosensitizer Bremachlorin, followed by 10 min laser illumination (200 mW/cm2 of the tumor 6 h post injection. MRI at 7 T was performed at baseline, directly after PDT, as well as at 24 h, and 72 h. Tumor relaxation time constants (T1 and T2 and apparent diffusion coefficient (ADC were quantified at each time point. Additionally, Gd-DOTA dynamic contrast-enhanced (DCE MRI was performed to estimate transfer constants (Ktrans and volume fractions of the extravascular extracellular space (ve using standard Tofts-Kermode tracer kinetic modeling. At the end of the experiment, tumor viability was characterized by histology using NADH-diaphorase staining.The therapy induced extensive cell death in the tumor and resulted in significant reduction in tumor growth, as compared to untreated controls. Tumor T1 and T2 relaxation times remained unchanged up to 24 h, but decreased at 72 h after treatment. Tumor ADC values significantly increased at 24 h and 72 h. DCE-MRI derived tracer kinetic parameters displayed an early response to the treatment. Directly after PDT complete vascular shutdown was observed in large parts of the tumors and reduced uptake (decreased Ktrans in remaining tumor tissue. At 24 h, contrast uptake in most tumors was essentially absent. Out of 5 animals that were monitored for 2 weeks after treatment, 3 had tumor recurrence, in locations that showed strong contrast uptake at 72 h.DCE-MRI is an effective tool for visualization of vascular effects directly after PDT. Endogenous contrast parameters T1, T2, and ADC, measured at 24 to 72 h after PDT, are

  4. Analysis of the response of PVA-GTA Fricke-gel dosimeters with clinical magnetic resonance imaging (United States)

    Collura, Giorgio; Gallo, Salvatore; Tranchina, Luigi; Abbate, Boris Federico; Bartolotta, Antonio; d'Errico, Francesco; Marrale, Maurizio


    Fricke gel dosimeters produced with a matrix of Poly-vinyl alcohol (PVA) cross-linked with glutaraldehyde (GTA) were analyzed with magnetic resonance imaging (MRI). Previous studies based on spectrophotometry showed valuable dosimetric features of these gels in terms of X-ray sensitivity and diffusion of the ferric ions produced after irradiation. In this study, MRI was performed on the gels at 1.5 T with a clinical scanner in order to optimize the acquisition parameters and obtain high contrast between irradiated and non-irradiated samples. The PVA gels were found to offer good linearity in the range of 0-10 Gy and a stable signal for several hours after irradiation. The sensitivity was about 40% higher compared to gels produced with agarose as gelling agent. The effect of xylenol orange (XO) on the MRI signal was also investigated: gel dosimeters made without XO show higher sensitivity to x-rays than those made with XO. The dosimetric accuracy of the 3D gels was investigated by comparing their MRI response to percentage depth dose and transversal dose profile measurements made with an ionization chamber in a water phantom. The comparison of PVA-GTA gels with and without XO showed that the chelating agent reduces the MRI sensitivity of the gels. Depth-dose and transversal dose profiles acquired by PVA-GTA gels without XO are more accurate and consistent with the ionization chamber data. However, diffusion effects hinder accurate measurements in the steep dose gradient regions and they should be further reduced by modifying the gel matrix and/or by minimizing the delay between irradiation and imaging.

  5. Magnetic resonance imaging

    International Nuclear Information System (INIS)

    Beer, A.; Bielke, G.; Bockenheimer, S.; Brenner, G.; Dieringer, H.; Esswein, H.; Hopf, H.; Koch, H.; Meves, M.; Nagel, F.; Oberstein, A.; Ostheimer, E.; Pfaff, M.; Schlaps, D.; Schopka, H.J.; Seiderer, M.


    The study investigates three points of main interest: (1) The clinical efficacy of MR imaging as a routine method, if possible to be assessed in comparison to comparable imaging methods, and referring to a broad spectrum of available types of equipment and modes of operation, to be expressed in terms of diagnostic value and indication of therapy. (2) Specific economic aspects, considering different sites of operation and application conditions. (3) Results of clinical application with regard to individual cases (patient careers), in order to establish a nationwide basis for economic cost-benefit assessment of this diagnostic tool. Another aspect taken into account whenever available data allow so, is substitutional or additional application of MR imaging. The survey is performed on the basis of data accumulated by more than 21.000 MR examinations, and of data describing the application environment, furnished by 25 users from university hospitals, general hospitals, or private practice. (orig./HP) [de

  6. Interventional magnetic resonance imaging

    International Nuclear Information System (INIS)

    Debatin, J.F.; Adam, G.


    With the advent of open configuration MR imaging systems, the vision of MRI-based guidance, control, and monitoring of minimally invasive interventions has evolved from a hypothetical concept to a practical possibility. This book provides a comprehensive overview of the very exciting emerging field of interventional MRI. The international authorship provides firsthand experience of all relevant topics. This book will familiarize the reader with the basic principles underlying currently available hardware and software configurations. In addition, technical aspects of thermosensitive imaging, techniques for instrument visualization, and safety aspects are covered. Finally, the book emphasizes both existing and future clinical applications. (orig.)

  7. Electron Paramagnetic Resonance Imaging

    Indian Academy of Sciences (India)

    IAS Admin

    is Professor of Chemistry at. IIT Madras. ... speeding up the CW imaging by special novel methods. How- ever, the ... presence of gradients which are applied in two or three dimen- sions and ... optics and mechanical engineer- ing stands for ...

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic Resonance ...

  9. Low field magnetic resonance imaging (United States)

    Pines, Alexander; Sakellariou, Dimitrios; Meriles, Carlos A.; Trabesinger, Andreas H.


    A method and system of magnetic resonance imaging does not need a large homogenous field to truncate a gradient field. Spatial information is encoded into the spin magnetization by allowing the magnetization to evolve in a non-truncated gradient field and inducing a set of 180 degree rotations prior to signal acquisition.

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Magnetic Resonance Imaging Sponsored by Please note is not a medical facility. Please contact your ... links: For the convenience of our users, RadiologyInfo .org provides links to relevant websites. , ACR ...

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... structures of the brain and can also provide functional information (fMRI) in selected cases. MR images of ... Articles and Media MR Angiography (MRA) Magnetic Resonance, Functional (fMRI) - Brain Head and Neck Cancer Treatment Brain ...

  12. Magnetic resonance imaging-detected tumor response for locally advanced rectal cancer predicts survival outcomes: MERCURY experience. (United States)

    Patel, Uday B; Taylor, Fiona; Blomqvist, Lennart; George, Christopher; Evans, Hywel; Tekkis, Paris; Quirke, Philip; Sebag-Montefiore, David; Moran, Brendan; Heald, Richard; Guthrie, Ashley; Bees, Nicola; Swift, Ian; Pennert, Kjell; Brown, Gina


    To assess magnetic resonance imaging (MRI) and pathologic staging after neoadjuvant therapy for rectal cancer in a prospectively enrolled, multicenter study. In a prospective cohort study, 111 patients who had rectal cancer treated by neoadjuvant therapy were assessed for response by MRI and pathology staging by T, N and circumferential resection margin (CRM) status. Tumor regression grade (TRG) was also assessed by MRI. Overall survival (OS) was estimated by using the Kaplan-Meier product-limit method, and Cox proportional hazards models were used to determine associations between staging of good and poor responders on MRI or pathology and survival outcomes after controlling for patient characteristics. On multivariate analysis, the MRI-assessed TRG (mrTRG) hazard ratios (HRs) were independently significant for survival (HR, 4.40; 95% CI, 1.65 to 11.7) and disease-free survival (DFS; HR, 3.28; 95% CI, 1.22 to 8.80). Five-year survival for poor mrTRG was 27% versus 72% (P = .001), and DFS for poor mrTRG was 31% versus 64% (P = .007). Preoperative MRI-predicted CRM independently predicted local recurrence (LR; HR, 4.25; 95% CI, 1.45 to 12.51). Five-year survival for poor post-treatment pathologic T stage (ypT) was 39% versus 76% (P = .001); DFS for the same was 38% versus 84% (P = .001); and LR for the same was 27% versus 6% (P = .018). The 5-year survival for involved pCRM was 30% versus 59% (P = .001); DFS, 28 versus 62% (P = .02); and LR, 56% versus 10% (P = .001). Pathology node status did not predict outcomes. MRI assessment of TRG and CRM are imaging markers that predict survival outcomes for good and poor responders and provide an opportunity for the multidisciplinary team to offer additional treatment options before planning definitive surgery. Postoperative histopathology assessment of ypT and CRM but not post-treatment N status were important postsurgical predictors of outcome.

  13. Noninvasive monitoring of radiation-induced treatment response using proton magnetic resonance spectroscopy and diffusion-weighted magnetic resonance imaging in a colorectal tumor model

    International Nuclear Information System (INIS)

    Seierstad, Therese; Roe, Kathrine; Olsen, Dag Rune


    Background and purpose: To examine whether in vivo proton magnetic resonance spectroscopy ( 1 H MRS) and diffusion-weighted magnetic resonance imaging (DW-MRI) can monitor radiation-induced changes in HT29 xenografts in mice. Materials and methods: HT29 xenografts in mice received a dose of 15 Gy. In vivo 1 H MRS and DW-MRI were acquired pretreatment and 1, 3, 6 and 10 days post-irradiation. After imaging, tumors were excised for histological analysis. The amounts of necrosis, fibrosis and viable cells in the cross sections were scored and compared to changes in apparent diffusion coefficient (ADC) and choline/water ratio. Results: Radiation-induced necrosis in the xenografts was observed as increased tumor ADC. In-growth of fibrosis three days post-irradiation restricting water mobility was accompanied by decreased tumor ADC. Choline/water ratio correlated with metabolic activity and tumor growth. Conclusions: ADC and choline/water ratio assessed by in vivo DW-MRI and 1 H MRS depicts radiation-induced changes in HT29 xenografts following irradiation

  14. Principles of magnetic resonance imaging

    International Nuclear Information System (INIS)

    Mlynarik, V.; Tkac, I.; Srbecky, M.


    The aim of this review is to describe and explain the basic principles of magnetic resonance imaging. The first part of the text is devoted to the phenomenon of magnetic resonance (the interaction of RF magnetic field with the set of magnetic moments in the homogeneous magnetic field) and to relaxation processes. Then, the creation of MR image is described (slice selection, phase and frequency encoding of spatial information). The basic and the most frequently used techniques are explained (spin echo, gradient echo). The way the repetition and echo times influence the image quality and contrast (T1 or T2 weighing) is described. The part with the technical description of the MR equipment is included in the review. The MR imagination examination are compared with X-ray computer tomography technique

  15. Anal carcinomas: the role of endoanal ultrasound and magnetic resonance imaging in staging, response evaluation and follow-up

    Energy Technology Data Exchange (ETDEWEB)

    Parikh, Jyoti; Shaw, Aidan; Griffin, Nyree [Guys and St. Thomas' Hospital, Department of Radiology, London (United Kingdom); Grant, Lee A. [Royal Marsden Hospital, Department of Radiology, London (United Kingdom); Schizas, Alexis M.P.; Datta, Vivek; Williams, Andrew B. [Guys and St. Thomas' Hospital, Department of General Surgery, London (United Kingdom)


    Anal carcinoma is an important but rare condition, managed in specialist centres. Both endoanal ultrasound and magnetic resonance imaging (MRI) can be used in the locoregional staging and follow-up of patients with anal cancer, and both may assist in treatment planning and prognosis. Recent guidelines published by the European Society for Medical Oncology have recommended MRI as the technique of choice for assessment of locoregional disease. This paper describes the techniques for both endoanal ultrasound and MRI, and compares the relative merits and disadvantages of each in the local assessment of anal carcinoma. (orig.)

  16. Magnetic Resonance Imaging (MRI): Brain (For Parents) (United States)

    ... Staying Safe Videos for Educators Search English Español Magnetic Resonance Imaging (MRI): Brain KidsHealth / For Parents / Magnetic Resonance Imaging (MRI): Brain What's in this article? What ...

  17. Magnetic resonance imaging in neuroradiology

    International Nuclear Information System (INIS)

    Voigt, K.; Lotx, J.W.


    Magnetic resonance imaging (MRI) is now accepted as an effective method of investigating a wide range of disorders, especially of the brain and spine. A short introduction on image contrast in MRI is given and the advantages and disadvantages for the different diseases of the brain is discussed. Excellent soft-tissue contrast, multiplanar imaging capabilities and lack of ionising radiation are conspicuous advantages, and it is now established as the investigation of choice in a large number of clinical conditions, especially when the central nervous system is involved. However, it remains only one of a series of imaging modalities. A confident provisional clinical diagnosis is essential for establishing an imaging protocol and the intention should always be to reach a definitive diagnosis in the least invasive and most cost-effective way. 7 figs., 19 refs

  18. Bone marrow response in treated patients with Gaucher disease: evaluation by T1-weighted magnetic resonance images and correlation with reduction in liver and spleen volume

    International Nuclear Information System (INIS)

    Terk, M.R.; Dardashti, S.; Liebman, H.A.


    Purpose. To determine whether T1-weighted magnetic resonance (MR) images can demonstrate response in the marrow of patients with type 1 Gaucher disease treated with enzyme replacement therapy (ERT) and to determine whether a relationship exists between liver and spleen volume reductions and visible marrow changes.Patients. Forty-two patients with type 1 Gaucher disease were evaluated on at least two occasions. Thirty-two patients received ERT. Of these patients, 15 had a baseline examination prior to the initiation of ERT. The remaining 10 patients did not receive ERT.Design. T1-weighted and gradient recalled echo (GRE) coronal images of the femurs and hips were obtained. Concurrently, liver and spleen volumes were determined using contiguous breath-hold axial gradient-echo images. T1-weighted images of the hips and femurs were evaluated to determine change or lack of change in the yellow marrow.Results. Of the 32 patients receiving ERT, 14 (44%) demonstrated increased signal on T1-weighted images suggesting an increase in the amount of yellow marrow. If only the 15 patients with a baseline examination were considered, the response rate to ERT was 67%. Using Student's t-test a highly significant correlation (P<0.005) was found between marrow response and reduction in liver and spleen volume.Conclusions. Marrow changes in patients receiving ERT can be detected by T1-weighted images. This response correlated with reductions in visceral volumes (P<0.0005). (orig.)

  19. Endometrial cancer: magnetic resonance imaging. (United States)

    Manfredi, R; Gui, B; Maresca, G; Fanfani, F; Bonomo, L


    Carcinoma of the endometrium is the most common invasive gynecologic malignancy of the female genital tract. Clinically, patients with endometrial carcinoma present with abnormal uterine bleeding. The role of magnetic resonance imaging (MRI) in endometrial carcinoma is disease staging and treatment planning. MRI has been shown to be the most valuable imaging mod-ality in this task, compared with endovaginal ultrasound and computed tomography, because of its intrinsic contrast resolution and multiplanar capability. MRI protocol includes axial T1-weighted images; axial, sagittal, and coronal T2-weighted images; and dynamic gadolinium-enhanced T1-weighted imaging. MR examination is usually performed in the supine position with a phased array multicoil using a four-coil configuration. Endometrial carcinoma is isointense with the normal endometrium and myometrium on noncontrast T1-weighted images and has a variable appearance on T2-weighted images demonstrating heterogeneous signal intensity. The appearance of noninvasive endometrial carcinoma on MRI is characterized by a normal or thickened endometrium, with an intact junctional zone and a sharp tumor-myometrium interface. Invasive endometrial carcinoma is characterized disruption or irregularity of the junctional zone by intermediate signal intensity mass on T2-weighted images. Invasion of the cervical stroma is diagnosed when the low signal intensity cervical stroma is disrupted by the higher signal intensity endometrial carcinoma. MRI in endometrial carcinoma performs better than other imaging modalities in disease staging and treatment planning. Further, the accuracy and the cost of MRI are equivalent to those of surgical staging.

  20. Multidimensionally encoded magnetic resonance imaging. (United States)

    Lin, Fa-Hsuan


    Magnetic resonance imaging (MRI) typically achieves spatial encoding by measuring the projection of a q-dimensional object over q-dimensional spatial bases created by linear spatial encoding magnetic fields (SEMs). Recently, imaging strategies using nonlinear SEMs have demonstrated potential advantages for reconstructing images with higher spatiotemporal resolution and reducing peripheral nerve stimulation. In practice, nonlinear SEMs and linear SEMs can be used jointly to further improve the image reconstruction performance. Here, we propose the multidimensionally encoded (MDE) MRI to map a q-dimensional object onto a p-dimensional encoding space where p > q. MDE MRI is a theoretical framework linking imaging strategies using linear and nonlinear SEMs. Using a system of eight surface SEM coils with an eight-channel radiofrequency coil array, we demonstrate the five-dimensional MDE MRI for a two-dimensional object as a further generalization of PatLoc imaging and O-space imaging. We also present a method of optimizing spatial bases in MDE MRI. Results show that MDE MRI with a higher dimensional encoding space can reconstruct images more efficiently and with a smaller reconstruction error when the k-space sampling distribution and the number of samples are controlled. Copyright © 2012 Wiley Periodicals, Inc.

  1. Caspase-responsive smart gadolinium-based contrast agent for magnetic resonance imaging of drug-induced apoptosis. (United States)

    Ye, Deju; Shuhendler, Adam J; Pandit, Prachi; Brewer, Kimberly D; Tee, Sui Seng; Cui, Lina; Tikhomirov, Grigory; Rutt, Brian; Rao, Jianghong


    Non-invasive detection of caspase-3/7 activity in vivo has provided invaluable predictive information regarding tumor therapeutic efficacy and anti-tumor drug selection. Although a number of caspase-3/7 targeted fluorescence and positron emission tomography (PET) imaging probes have been developed, there is still a lack of gadolinium (Gd)-based magnetic resonance imaging (MRI) probes that enable high spatial resolution detection of caspase-3/7 activity in vivo . Here we employ a self-assembly approach and develop a caspase-3/7 activatable Gd-based MRI probe for monitoring tumor apoptosis in mice. Upon reduction and caspase-3/7 activation, the caspase-sensitive nano-aggregation MR probe (C-SNAM: 1 ) undergoes biocompatible intramolecular cyclization and subsequent self-assembly into Gd-nanoparticles (GdNPs). This results in enhanced r 1 relaxivity-19.0 (post-activation) vs. 10.2 mM -1 s -1 (pre-activation) at 1 T in solution-and prolonged accumulation in chemotherapy-induced apoptotic cells and tumors that express active caspase-3/7. We demonstrate that C-SNAM reports caspase-3/7 activity by generating a significantly brighter T 1 -weighted MR signal compared to non-treated tumors following intravenous administration of C-SNAM, providing great potential for high-resolution imaging of tumor apoptosis in vivo .

  2. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... and pelvic region, MRI is used to: diagnose causes of pain evaluate for injury after trauma diagnose and monitor infectious or inflammatory disorders monitor response to cancer treatment MRI is often the best choice for imaging ...

  3. Smart Contrast Agents for Magnetic Resonance Imaging. (United States)

    Bonnet, Célia S; Tóth, Éva


    By visualizing bioactive molecules or biological parameters in vivo, molecular imaging is searching for information at the molecular level in living organisms. In addition to contributing to earlier and more personalized diagnosis in medicine, it also helps understand and rationalize the molecular factors underlying physiological and pathological processes. In magnetic resonance imaging (MRI), complexes of paramagnetic metal ions, mostly lanthanides, are commonly used to enhance the intrinsic image contrast. They rely either on the relaxation effect of these metal chelates (T(1) agents), or on the phenomenon of paramagnetic chemical exchange saturation transfer (PARACEST agents). In both cases, responsive molecular magnetic resonance imaging probes can be designed to report on various biomarkers of biological interest. In this context, we review recent work in the literature and from our group on responsive T(1) and PARACEST MRI agents for the detection of biogenic metal ions (such as calcium or zinc), enzymatic activities, or neurotransmitter release. These examples illustrate the general strategies that can be applied to create molecular imaging agents with an MRI detectable response to biologically relevant parameters.

  4. No evidence for generalized increased postoperative responsiveness to pain: a combined behavioral and serial functional magnetic resonance imaging study

    DEFF Research Database (Denmark)

    Kupers, Ron; Schneider, Fabien C G; Christensen, Rune


    area and to the lower forearm, a site remote from the surgical area. A group of eight age- and sex-matched control subjects underwent the same two-test procedure except that they were not submitted to an orthopedic surgical intervention. RESULTS: Subjective pain and brain responses to innocuous...... and noxious stimulation were not increased postoperatively. Actually, responses in primary and secondary somatosensory cortex for stimulation of the operated leg were significantly smaller after surgery. Brain responses in the control group did not differ significantly across the two sessions. CONCLUSION......BACKGROUND: Although it is generally accepted that increased pain responsiveness and central sensitization develop after major tissue injury, this claim has not been tested using brain imaging methods in a clinical pain setting. We tested this hypothesis using a postoperative pain model...

  5. Quantitative perfusion imaging in magnetic resonance imaging

    International Nuclear Information System (INIS)

    Zoellner, F.G.; Gaa, T.; Zimmer, F.; Ong, M.M.; Riffel, P.; Hausmann, D.; Schoenberg, S.O.; Weis, M.


    Magnetic resonance imaging (MRI) is recognized for its superior tissue contrast while being non-invasive and free of ionizing radiation. Due to the development of new scanner hardware and fast imaging techniques during the last decades, access to tissue and organ functions became possible. One of these functional imaging techniques is perfusion imaging with which tissue perfusion and capillary permeability can be determined from dynamic imaging data. Perfusion imaging by MRI can be performed by two approaches, arterial spin labeling (ASL) and dynamic contrast-enhanced (DCE) MRI. While the first method uses magnetically labelled water protons in arterial blood as an endogenous tracer, the latter involves the injection of a contrast agent, usually gadolinium (Gd), as a tracer for calculating hemodynamic parameters. Studies have demonstrated the potential of perfusion MRI for diagnostics and also for therapy monitoring. The utilization and application of perfusion MRI are still restricted to specialized centers, such as university hospitals. A broad application of the technique has not yet been implemented. The MRI perfusion technique is a valuable tool that might come broadly available after implementation of standards on European and international levels. Such efforts are being promoted by the respective professional bodies. (orig.) [de

  6. Magnetic resonance imaging of Parkinsonism

    International Nuclear Information System (INIS)

    Mukai, Eiichiro; Makino, Naoki; Fujishiro, Kenichiro.


    We have analyzed magnetic resonance images in 33 patients; 18 patients with Parkinson's disease, 1 patient with diurnally fluctuating progressive dystonia, 1 patient with pure akinesia, 6 patients with multiple system atrophy, 1 patient with flunarizine induced parkinsonism, and 4 patients with unclassified parkinsonism. The MR images were obtained using a 1.5-T GE MR System. A spin-echo pulse sequence was used with a TE of 30 msec and 80 msec and a TR of 2000 msec. No signal abnormalities were seen in any patient with Parkinson's disease but 3 showed slightly decreased signal intensity of the putamen on T2-weighted sequences. Patients with diurnally fluctuating progressive dystonia and pure akinesia evidensed no abnormal findings. All six patients with multiple system atrophy demonstrated decreased signal intensity of the putamen, particularly along their lateral and posterior portions, and an enlarged substantia nigra. Atrophy of the pons and cerebellum was detected in all cases with multiple system atrophy. One case of flunarizine induced parkinsonism showed slightly decreased signal intensity of the putamen. Four cases of unclassified parkinsonism showed decreased signal in the putamen on T2-weighted sequences. Magnetic resonance imaging has the potential to become a useful diagnostic tool in the management of parkinsonism. (author)

  7. Magnetic resonance imaging of Parkinsonism

    Energy Technology Data Exchange (ETDEWEB)

    Mukai, Eiichiro [National Hospital of Nagoya (Japan); Makino, Naoki; Fujishiro, Kenichiro


    We have analyzed magnetic resonance images in 33 patients; 18 patients with Parkinson's disease, 1 patient with diurnally fluctuating progressive dystonia, 1 patient with pure akinesia, 6 patients with multiple system atrophy, 1 patient with flunarizine induced parkinsonism, and 4 patients with unclassified parkinsonism. The MR images were obtained using a 1.5-T GE MR System. A spin-echo pulse sequence was used with a TE of 30 msec and 80 msec and a TR of 2000 msec. No signal abnormalities were seen in any patient with Parkinson's disease but 3 showed slightly decreased signal intensity of the putamen on T2-weighted sequences. Patients with diurnally fluctuating progressive dystonia and pure akinesia evidensed no abnormal findings. All six patients with multiple system atrophy demonstrated decreased signal intensity of the putamen, particularly along their lateral and posterior portions, and an enlarged substantia nigra. Atrophy of the pons and cerebellum was detected in all cases with multiple system atrophy. One case of flunarizine induced parkinsonism showed slightly decreased signal intensity of the putamen. Four cases of unclassified parkinsonism showed decreased signal in the putamen on T2-weighted sequences. Magnetic resonance imaging has the potential to become a useful diagnostic tool in the management of parkinsonism. (author).

  8. Magnetic resonance imaging of chemistry. (United States)

    Britton, Melanie M


    Magnetic resonance imaging (MRI) has long been recognized as one of the most important tools in medical diagnosis and research. However, MRI is also well placed to image chemical reactions and processes, determine the concentration of chemical species, and look at how chemistry couples with environmental factors, such as flow and heterogeneous media. This tutorial review will explain how magnetic resonance imaging works, reviewing its application in chemistry and its ability to directly visualise chemical processes. It will give information on what resolution and contrast are possible, and what chemical and physical parameters can be measured. It will provide examples of the use of MRI to study chemical systems, its application in chemical engineering and the identification of contrast agents for non-clinical applications. A number of studies are presented including investigation of chemical conversion and selectivity in fixed-bed reactors, temperature probes for catalyst pellets, ion mobility during tablet dissolution, solvent dynamics and ion transport in Nafion polymers and the formation of chemical waves and patterns.

  9. Magnetic resonance imaging in psychiatry

    International Nuclear Information System (INIS)

    Mann, K.


    Diagnosis and research in psychiatry are increasingly availing themselves of magnetic resonance imaging (MRI). In comparison to computed tomography (CT), this offers the combined benefits of no exposure to radiation, high resolution, artefact-free display of structures near bone, and a sharp contrast between the grey and white brain matter, with freedom to select the section. With the exception of very anxious patients, MRI will gradually replace CT scans for a wide range of differential diagnostic investigations. Its superiority in systematic studies of psychiatric patients with discrete cerebral parenchyma lesions is already considered proven. This is illustrated on the basis of research into schizophrenia and alcoholism. (orig.) [de

  10. Does a single session of electroconvulsive therapy alter the neural response to emotional faces in depression? A randomised sham-controlled functional magnetic resonance imaging study. (United States)

    Miskowiak, Kamilla W; Kessing, Lars V; Ott, Caroline V; Macoveanu, Julian; Harmer, Catherine J; Jørgensen, Anders; Revsbech, Rasmus; Jensen, Hans M; Paulson, Olaf B; Siebner, Hartwig R; Jørgensen, Martin B


    Negative neurocognitive bias is a core feature of major depressive disorder that is reversed by pharmacological and psychological treatments. This double-blind functional magnetic resonance imaging study investigated for the first time whether electroconvulsive therapy modulates negative neurocognitive bias in major depressive disorder. Patients with major depressive disorder were randomised to one active ( n=15) or sham electroconvulsive therapy ( n=12). The following day they underwent whole-brain functional magnetic resonance imaging at 3T while viewing emotional faces and performed facial expression recognition and dot-probe tasks. A single electroconvulsive therapy session had no effect on amygdala response to emotional faces. Whole-brain analysis revealed no effects of electroconvulsive therapy versus sham therapy after family-wise error correction at the cluster level, using a cluster-forming threshold of Z>3.1 ( p2.3; pelectroconvulsive therapy-induced changes in parahippocampal and superior frontal responses to fearful versus happy faces as well as in fear-specific functional connectivity between amygdala and occipito-temporal regions. Across all patients, greater fear-specific amygdala - occipital coupling correlated with lower fear vigilance. Despite no statistically significant shift in neural response to faces after a single electroconvulsive therapy session, the observed trend changes after a single electroconvulsive therapy session point to an early shift in emotional processing that may contribute to antidepressant effects of electroconvulsive therapy.

  11. Evaluation of Magnetic Resonance Imaging Responsiveness in Active Psoriatic Arthritis at Multiple Timepoints during the First 12 Weeks of Antitumor Necrosis Factor Therapy. (United States)

    Feletar, Marie; Hall, Stephen; Bird, Paul


    To assess the responsiveness of high- and low-field extremity magnetic resonance imaging (MRI) variables at multiple timepoints in the first 12 weeks post-antitumor necrosis factor (anti-TNF) therapy initiation in patients with psoriatic arthritis (PsA) and active dactylitis. Twelve patients with active PsA and clinical evidence of dactylitis involving at least 1 digit were recruited. Patients underwent sequential high-field conventional (1.5 Tesla) and extremity low-field MRI (0.2 Tesla) of the affected hand or foot, pre- and postgadolinium at baseline (pre-TNF), 2 weeks (post-TNF), 6 weeks, and 12 weeks. A blinded observer scored all images on 2 occasions using the PsA MRI scoring system. Eleven patients completed the study, but only 6 patients completed all high-field and low-field MRI assessments. MRI scores demonstrated rapid response to TNF inhibition with score reduction in tenosynovitis, synovitis, and osteitis at 2 weeks. Intraobserver reliability was good to excellent for all variables. High-field MRI demonstrated greater sensitivity to tenosynovitis, synovitis, and osteitis and greater responsiveness to change posttreatment. Treatment responses were maintained to 12 weeks. This study demonstrates the use of MRI in detecting early response to biologic therapy. MRI variables of tenosynovitis, synovitis, and osteitis demonstrated responsiveness posttherapy with high-field scores more responsive to change than low-field scores.

  12. Fetal abdominal magnetic resonance imaging

    International Nuclear Information System (INIS)

    Brugger, Peter C.; Prayer, Daniela


    This review deals with the in vivo magnetic resonance imaging (MRI) appearance of the human fetal abdomen. Imaging findings are correlated with current knowledge of human fetal anatomy and physiology, which are crucial to understand and interpret fetal abdominal MRI scans. As fetal MRI covers a period of more than 20 weeks, which is characterized not only by organ growth, but also by changes and maturation of organ function, a different MR appearance of the fetal abdomen results. This not only applies to the fetal intestines, but also to the fetal liver, spleen, and adrenal glands. Choosing the appropriate sequences, various aspects of age-related and organ-specific function can be visualized with fetal MRI, as these are mirrored by changes in signal intensities. Knowledge of normal development is essential to delineate normal from pathological findings in the respective developmental stages

  13. Fetal abdominal magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Brugger, Peter C. [Center of Anatomy and Cell Biology, Integrative Morphology Group, Medical University of Vienna, Waehringerstrasse 13, 1090 Vienna (Austria)]. E-mail:; Prayer, Daniela [Department of Radiology, Medical University of Vienna, Waehringerguertel 18-20, 1090 Vienna (Austria)


    This review deals with the in vivo magnetic resonance imaging (MRI) appearance of the human fetal abdomen. Imaging findings are correlated with current knowledge of human fetal anatomy and physiology, which are crucial to understand and interpret fetal abdominal MRI scans. As fetal MRI covers a period of more than 20 weeks, which is characterized not only by organ growth, but also by changes and maturation of organ function, a different MR appearance of the fetal abdomen results. This not only applies to the fetal intestines, but also to the fetal liver, spleen, and adrenal glands. Choosing the appropriate sequences, various aspects of age-related and organ-specific function can be visualized with fetal MRI, as these are mirrored by changes in signal intensities. Knowledge of normal development is essential to delineate normal from pathological findings in the respective developmental stages.

  14. The value of diffusion kurtosis magnetic resonance imaging for assessing treatment response of neoadjuvant chemoradiotherapy in locally advanced rectal cancer

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Jing; Xu, Qing; Song, Jia-Cheng; Li, Yan; Dai, Xin; Zhang, Ling; Shi, Hai-Bin [First Affiliated Hospital of Nanjing Medical University, Department of Radiology, Nanjing (China); Huang, Dong-Ya [First Affiliated Hospital of Nanjing Medical University, Department of General Surgery, Nanjing (China); Li, Yang [First Affiliated Hospital of Nanjing Medical University, Department of Pathology, Nanjing (China)


    To evaluate the feasibility and value of diffusion kurtosis (DK) imaging in assessing treatment response to neoadjuvant chemoradiotherapy (CRT) in patients with locally advanced rectal cancer (LARC). Forty-one patients were included. All patients underwent pre- and post-CRT DCE-MRI on a 3.0-Tesla MRI scanner. Imaging indices (D{sub app}, K{sub app} and ADC values) were measured. Change value (∇X) and change ratio (r ∇X) were calculated. Pathological tumour regression grade scores (Mandard) were the standard reference (good responders: pTRG 1-2; poor responders: pTRG 3-5). Diagnostic performance was compared using ROC analysis. For the pre-CRT measurements, pre-D{sub app-10th} was significantly lower in the good responder group than that of the poor responder group (p = 0.036). For assessing treatment response to neoadjuvant CRT, pre-D{sub app-10th} resulted in AUCs of 0.753 (p = 0.036) with a sensitivity of 66.67 % and a specificity of 77.78 %. The r ∇D{sub app} had a relatively high AUC (0.859) and high sensitivity (100 %) compared with other image indices. DKI is feasible for selecting good responders for neoadjuvant CRT for LARC. (orig.)

  15. Magnetic resonance imaging of the prostate

    DEFF Research Database (Denmark)

    Iversen, P; Kjaer, L; Thomsen, C


    Magnetic resonance imaging offers new possibilities in investigation of the prostate gland. Current results of imaging and tissue discrimination in the evaluation of prostatic disease are reviewed. Magnetic resonance imaging may be useful in the staging of carcinoma of the prostate....

  16. Magnetic resonance imaging of the prostate

    DEFF Research Database (Denmark)

    Iversen, P; Kjaer, L; Thomsen, C


    Magnetic resonance imaging offers new possibilities in the investigation of the prostate. The current results of imaging and tissue discrimination in the evaluation of prostatic disease are reviewed. Magnetic resonance imaging may be of value in the staging of carcinoma of the prostate....

  17. Artifacts in Magnetic Resonance Imaging

    International Nuclear Information System (INIS)

    Krupa, Katarzyna; Bekiesińska-Figatowska, Monika


    Artifacts in magnetic resonance imaging and foreign bodies within the patient’s body may be confused with a pathology or may reduce the quality of examinations. Radiologists are frequently not informed about the medical history of patients and face postoperative/other images they are not familiar with. A gallery of such images was presented in this manuscript. A truncation artifact in the spinal cord could be misinterpreted as a syrinx. Motion artifacts caused by breathing, cardiac movement, CSF pulsation/blood flow create a ghost artifact which can be reduced by patient immobilization, or cardiac/respiratory gating. Aliasing artifacts can be eliminated by increasing the field of view. An artificially hyperintense signal on FLAIR images can result from magnetic susceptibility artifacts, CSF/vascular pulsation, motion, but can also be found in patients undergoing MRI examinations while receiving supplemental oxygen. Metallic and other foreign bodies which may be found on and in patients’ bodies are the main group of artifacts and these are the focus of this study: e.g. make-up, tattoos, hairbands, clothes, endovascular embolization, prostheses, surgical clips, intraorbital and other medical implants, etc. Knowledge of different types of artifacts and their origin, and of possible foreign bodies is necessary to eliminate them or to reduce their negative influence on MR images by adjusting acquisition parameters. It is also necessary to take them into consideration when interpreting the images. Some proposals of reducing artifacts have been mentioned. Describing in detail the procedures to avoid or limit the artifacts would go beyond the scope of this paper but technical ways to reduce them can be found in the cited literature

  18. Magnetic Resonance Imaging of Liver Metastasis. (United States)

    Karaosmanoglu, Ali Devrim; Onur, Mehmet Ruhi; Ozmen, Mustafa Nasuh; Akata, Deniz; Karcaaltincaba, Musturay


    Liver magnetic resonance imaging (MRI) is becoming the gold standard in liver metastasis detection and treatment response assessment. The most sensitive magnetic resonance sequences are diffusion-weighted images and hepatobiliary phase images after Gd-EOB-DTPA. Peripheral ring enhancement, diffusion restriction, and hypointensity on hepatobiliary phase images are hallmarks of liver metastases. In patients with normal ultrasonography, computed tomography (CT), and positron emission tomography (PET)-CT findings and high clinical suspicion of metastasis, MRI should be performed for diagnosis of unseen metastasis. In melanoma, colon cancer, and neuroendocrine tumor metastases, MRI allows confident diagnosis of treatment-related changes in liver and enables differential diagnosis from primary liver tumors. Focal nodular hyperplasia-like nodules in patients who received platinum-based chemotherapy, hypersteatosis, and focal fat can mimic metastasis. In cancer patients with fatty liver, MRI should be preferred to CT. Although the first-line imaging for metastases is CT, MRI can be used as a problem-solving method. MRI may be used as the first-line method in patients who would undergo curative surgery or metastatectomy. Current limitation of MRI is low sensitivity for metastasis smaller than 3mm. MRI fingerprinting, glucoCEST MRI, and PET-MRI may allow simpler and more sensitive diagnosis of liver metastasis. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... monitor infectious or inflammatory disorders monitor response to cancer treatment MRI is often the best choice for imaging the joints and bones, where it can help: diagnose sports-related injuries detect ... bone cancer inspect the marrow for leukemia and other diseases ...

  20. Endovascular interventional magnetic resonance imaging

    International Nuclear Information System (INIS)

    Bartels, L W; Bakker, C J G


    Minimally invasive interventional radiological procedures, such as balloon angioplasty, stent placement or coiling of aneurysms, play an increasingly important role in the treatment of patients suffering from vascular disease. The non-destructive nature of magnetic resonance imaging (MRI), its ability to combine the acquisition of high quality anatomical images and functional information, such as blood flow velocities, perfusion and diffusion, together with its inherent three dimensionality and tomographic imaging capacities, have been advocated as advantages of using the MRI technique for guidance of endovascular radiological interventions. Within this light, endovascular interventional MRI has emerged as an interesting and promising new branch of interventional radiology. In this review article, the authors will give an overview of the most important issues related to this field. In this context, we will focus on the prerequisites for endovascular interventional MRI to come to maturity. In particular, the various approaches for device tracking that were proposed will be discussed and categorized. Furthermore, dedicated MRI systems, safety and compatibility issues and promising applications that could become clinical practice in the future will be discussed. (topical review)

  1. Correlation between single-trial visual evoked potentials and the blood oxygenation level dependent response in simultaneously recorded electroencephalography-functional magnetic resonance imaging

    DEFF Research Database (Denmark)

    Fuglø, Dan; Pedersen, Henrik; Rostrup, Egill


    in different occipital and extraoccipital cortical areas not explained by the boxcar regressor. The results suggest that the P1-N2 regressor is the best EEG-based regressor to model the visual paradigm, but when looking for additional effects like habituation or attention modulation that cannot be modeled......To compare different electroencephalography (EEG)-based regressors and their ability to predict the simultaneously recorded blood oxygenation level dependent response during blocked visual stimulation, simultaneous EEG-functional magnetic resonance imaging in 10 healthy volunteers was performed....... The performance of different single-trial EEG regressors was compared in terms of predicting the measured blood oxygenation level dependent response. The EEG-based regressors were the amplitude and latency of the primary positive (P1) and negative (N2) peaks of the visual evoked potential, the combined P1-N2...

  2. Olfactometer for functional resonance imaging

    International Nuclear Information System (INIS)

    Andrieu, Patrice


    The Magnetic Resonance Imaging (fMRI) has been developing for twenty years. Indeed, the marketing of high-resolution MRI (5 Tesla and 7 Tesla recently) allowed the study of brain mechanisms. The research work of this PHD was to develop instrumentation for objective studies of brain behavior during a sensory stimulation. We are interested in the study of olfaction. We have designed and built a six-channel olfactometer, synchronized with breathing and controlled by computer. The originality of our work lies in the modularity of our device, which makes it adaptable to a wide range of studies. We also propose a new method to change the intensity of stimulation delivered: the Pulse Width Modulation (PWM). This device has been used in several studies in fMRI. The effectiveness of the PWM is highlighted in a psychophysical study described in this manuscript. (author)

  3. Pocket atlas of cranial magnetic resonance imaging

    International Nuclear Information System (INIS)

    Haughton, V.M.; Daniels, D.L.


    This atlas illustrates normal cerebral anatomy in magnetic resonance images. From their studies in cerebral anatomy utilizing cryomicrotome and other techniques, the authors selected more than 100 high-resolution images that represent the most clinically useful scans

  4. A Combined Pharmacokinetic and Radiologic Assessment of Dynamic Contrast-Enhanced Magnetic Resonance Imaging Predicts Response to Chemoradiation in Locally Advanced Cervical Cancer

    International Nuclear Information System (INIS)

    Semple, Scott; Harry, Vanessa N. MRCOG.; Parkin, David E.; Gilbert, Fiona J.


    Purpose: To investigate the combination of pharmacokinetic and radiologic assessment of dynamic contrast-enhanced magnetic resonance imaging (MRI) as an early response indicator in women receiving chemoradiation for advanced cervical cancer. Methods and Materials: Twenty women with locally advanced cervical cancer were included in a prospective cohort study. Dynamic contrast-enhanced MRI was carried out before chemoradiation, after 2 weeks of therapy, and at the conclusion of therapy using a 1.5-T MRI scanner. Radiologic assessment of uptake parameters was obtained from resultant intensity curves. Pharmacokinetic analysis using a multicompartment model was also performed. General linear modeling was used to combine radiologic and pharmacokinetic parameters and correlated with eventual response as determined by change in MRI tumor size and conventional clinical response. A subgroup of 11 women underwent repeat pretherapy MRI to test pharmacokinetic reproducibility. Results: Pretherapy radiologic parameters and pharmacokinetic K trans correlated with response (p < 0.01). General linear modeling demonstrated that a combination of radiologic and pharmacokinetic assessments before therapy was able to predict more than 88% of variance of response. Reproducibility of pharmacokinetic modeling was confirmed. Conclusions: A combination of radiologic assessment with pharmacokinetic modeling applied to dynamic MRI before the start of chemoradiation improves the predictive power of either by more than 20%. The potential improvements in therapy response prediction using this type of combined analysis of dynamic contrast-enhanced MRI may aid in the development of more individualized, effective therapy regimens for this patient group.

  5. Investigating the prediction value of multiparametric magnetic resonance imaging at 3 T in response to neoadjuvant chemotherapy in breast cancer

    International Nuclear Information System (INIS)

    Minarikova, Lenka; Bogner, Wolfgang; Zaric, Olgica; Trattnig, Siegfried; Gruber, Stephan; Pinker, Katja; Valkovic, Ladislav; Bago-Horvath, Zsuzsanna; Bartsch, Rupert; Helbich, Thomas H.


    To explore the predictive value of parameters derived from diffusion-weighted imaging (DWI) and contrast-enhanced (CE)-MRI at different time-points during neoadjuvant chemotherapy (NACT) in breast cancer. Institutional review board approval and written, informed consent from 42 breast cancer patients were obtained. The patients were investigated before and at three different time-points during neoadjuvant chemotherapy (NACT) using tumour diameter and volume from CE-MRI and ADC values obtained from drawn 2D and segmented 3D regions of interest. Prediction of pathologic complete response (pCR) was evaluated using the area under the curve (AUC) of receiver operating characteristic analysis. There was no significant difference between pathologic complete response and non-pCR in baseline size measures (p > 0.39). Diameter change was significantly different in pCR (p < 0.02) before the mid-therapy point. The best predictor was lesion diameter change observed before mid-therapy (AUC = 0.93). Segmented volume was not able to differentiate between pCR and non-pCR at any time-point. The ADC values from 3D-ROI were not significantly different from 2D data (p = 0.06). The best AUC (0.79) for pCR prediction using DWI was median ADC measured before mid-therapy of NACT. The results of this study should be considered in NACT monitoring planning, especially in MRI protocol designing and time point selection. (orig.)

  6. Investigating the prediction value of multiparametric magnetic resonance imaging at 3 T in response to neoadjuvant chemotherapy in breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Minarikova, Lenka; Bogner, Wolfgang; Zaric, Olgica; Trattnig, Siegfried; Gruber, Stephan [Medical University of Vienna, High-field MR Centre, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); Christian Doppler Laboratory for Clinical Molecular MR Imaging, Vienna (Austria); Pinker, Katja [Medical University of Vienna, Division of Molecular and Gender Imaging, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); Memorial Sloan-Kettering Cancer Center, Molecular Imaging and Therapy Service, New York, NY (United States); Valkovic, Ladislav [Medical University of Vienna, High-field MR Centre, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); Christian Doppler Laboratory for Clinical Molecular MR Imaging, Vienna (Austria); Slovak Academy of Sciences, Department of Imaging Methods, Institute of Measurement Science, Bratislava (Slovakia); University of Oxford, John Radcliffe Hospital, Oxford Centre for Clinical Magnetic Resonance Research, Oxford (United Kingdom); Bago-Horvath, Zsuzsanna [Medical University of Vienna, Department of Pathology, Comprehensive Cancer Center, Vienna (Austria); Bartsch, Rupert [Medical University of Vienna, Clinical Division of Oncology, Department of Medicine I, Vienna (Austria); Helbich, Thomas H. [Medical University of Vienna, Division of Molecular and Gender Imaging, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria)


    To explore the predictive value of parameters derived from diffusion-weighted imaging (DWI) and contrast-enhanced (CE)-MRI at different time-points during neoadjuvant chemotherapy (NACT) in breast cancer. Institutional review board approval and written, informed consent from 42 breast cancer patients were obtained. The patients were investigated before and at three different time-points during neoadjuvant chemotherapy (NACT) using tumour diameter and volume from CE-MRI and ADC values obtained from drawn 2D and segmented 3D regions of interest. Prediction of pathologic complete response (pCR) was evaluated using the area under the curve (AUC) of receiver operating characteristic analysis. There was no significant difference between pathologic complete response and non-pCR in baseline size measures (p > 0.39). Diameter change was significantly different in pCR (p < 0.02) before the mid-therapy point. The best predictor was lesion diameter change observed before mid-therapy (AUC = 0.93). Segmented volume was not able to differentiate between pCR and non-pCR at any time-point. The ADC values from 3D-ROI were not significantly different from 2D data (p = 0.06). The best AUC (0.79) for pCR prediction using DWI was median ADC measured before mid-therapy of NACT. The results of this study should be considered in NACT monitoring planning, especially in MRI protocol designing and time point selection. (orig.)

  7. Magnetic resonance imaging of radiation optic neuropathy

    International Nuclear Information System (INIS)

    Zimmerman, C.F.; Schatz, N.J.; Glaser, J.S.


    Three patients with delayed radiation optic neuropathy after radiation therapy for parasellar neoplasms underwent magnetic resonance imaging. The affected optic nerves and chiasms showed enlargement and focal gadopentetate dimeglumine enhancement. The magnetic resonance imaging technique effectively detected and defined anterior visual pathway changes of radionecrosis and excluded the clinical possibility of visual loss because of tumor recurrence

  8. Epidural fat image in lumbar magnetic resonance image

    International Nuclear Information System (INIS)

    Nishijima, Yuichiro; Yamasaki, Yasuo; Higashida, Norihiko; Okada, Masato


    To examine epidural fat images, lumbar magnetic resonance (MR) images were retrospectively reviewed in a total of 103 patients with surgically proven lumbar disc herniation (DH, n=57) and lumbar canal stenosis (LCS, n=46). Epidural fat images consisted of middorsal epidural fat (MDF), paramedian ventral fat (PVF) and intervertebral foraminal fat (IFF) ones. In the group of DH, the thickness of MDF image did not correlate with that of subcutaneous fat, suggesting that epidural fat was not affected by body fat. From the pathophysiological point of view, decrease and disappearance of MDF images correlated with compression of the epidural canal. Decrease and disappearance of PVF images lead to suspicious compression of the traversing root. In addition, asymmetrical PVF images were useful for the bilateral diagnosis of herniation. Abnormal findings of IFF images were suggestive of compression of the exiting nerve root at the intervertebral foramen. This was also seen frequently at the non-responsible level in patients over the age of 50. Degenerative and sequentrated spondylolistheses in the group of LCS were more frequently associated with a higher incidence of abnormal findings of IFF images, suggesting the presence of existing nerve root compression. (N.K.)

  9. Composition-property relationships in multifunctional hollow mesoporous carbon nanosystems for PH-responsive magnetic resonance imaging and on-demand drug release (United States)

    Zhang, Shengjian; Qian, Xiaoqing; Zhang, Linlin; Peng, Weijun; Chen, Yu


    The construction of intelligent stimuli-responsive nanosystems can substantially improve the sensitivity/resolution/specificity of diagnostic imaging and enhance the therapeutic efficiency of chemotherapy for cancer treatment. This work reports on a generic construction strategy to achieve a multiple stimuli-responsive theranostic system for cancer simply by optimizing the chemical compositions of inorganic nanoplatforms to avoid the tedious and complicated synthetic procedure for traditional organic or organic/inorganic nanosystems. Based on the ``breaking up'' nature of manganese oxides and specific features of the carbonaceous framework to interact with aromatic drug molecules, manganese oxide nanoparticles were elaborately integrated into hollow mesoporous carbon nanocapsules by a simple in situ framework redox strategy to realize concurrent pH-sensitive T1-weighted magnetic resonance imaging (MRI) and pH-/HIFU-responsive on-demand drug release. The ultrasensitive disease-triggered MRI performance has been successfully demonstrated by a 52.5-fold increase of longitudinal relaxivity (r1 = 10.5 mM-1 s-1) and on nude mice 4T1 xenograft. The pH- and HIFU-triggered doxorubicin release and enhanced therapeutic outcome against multidrug resistance of cancer cells were systematically confirmed. In particular, the fabricated inorganic composite nanocapsules were found to feature unique biological behaviours, such as antimetastasis effect, extremely low hemolysis against red blood cells and high in vivo histocompatibility. This report on the successful construction of a pure inorganic nanosystem with multiple stimuli-responsivenesses may pave the way to new methods for the development of intelligent nanofamilies for cancer therapy.The construction of intelligent stimuli-responsive nanosystems can substantially improve the sensitivity/resolution/specificity of diagnostic imaging and enhance the therapeutic efficiency of chemotherapy for cancer treatment. This work reports

  10. Does a single session of electroconvulsive therapy alter the neural response to emotional faces in depression? A randomised sham-controlled functional magnetic resonance imaging study

    DEFF Research Database (Denmark)

    Miskowiak, Kamilla W; Kessing, Lars V; Ott, Caroline V


    neurocognitive bias in major depressive disorder. Patients with major depressive disorder were randomised to one active ( n=15) or sham electroconvulsive therapy ( n=12). The following day they underwent whole-brain functional magnetic resonance imaging at 3T while viewing emotional faces and performed facial...... expression recognition and dot-probe tasks. A single electroconvulsive therapy session had no effect on amygdala response to emotional faces. Whole-brain analysis revealed no effects of electroconvulsive therapy versus sham therapy after family-wise error correction at the cluster level, using a cluster...... to faces after a single electroconvulsive therapy session, the observed trend changes after a single electroconvulsive therapy session point to an early shift in emotional processing that may contribute to antidepressant effects of electroconvulsive therapy....

  11. Magnetic resonance imaging of the bone marrow

    International Nuclear Information System (INIS)

    Baur-Melnyk, Andrea


    The first book devoted to MRI of the bone marrow. Describes the MRI appearances of normal bone marrows and the full range of bone marrow disorders. Discusses the role of advanced MRI techniques and contrast enhancement. On account of its unrivalled imaging capabilities and sensitivity, magnetic resonance imaging (MRI) is considered the modality of choice for the investigation of physiologic and pathologic processes affecting the bone marrow. This book describes the MRI appearances of both the normal bone marrow, including variants, and the full range of bone marrow disorders. Detailed discussion is devoted to malignancies, including multiple myeloma, lymphoma, chronic myeloproliferative disorders, leukemia, and bone metastases. Among the other conditions covered are benign and malignant compression fractures, osteonecrosis, hemolytic anemia, Gaucher's disease, bone marrow edema syndrome, trauma, and infective and non-infective inflammatory disease. Further chapters address the role of MRI in assessing treatment response, the use of contrast media, and advanced MRI techniques. Magnetic Resonance Imaging of the Bone Marrow represents an ideal reference for both novice and experienced practitioners.

  12. Magnetic Resonance Imaging Evaluation of Cardiac Masses

    International Nuclear Information System (INIS)

    Braggion-Santos, Maria Fernanda; Koenigkam-Santos, Marcel; Teixeira, Sara Reis; Volpe, Gustavo Jardim; Trad, Henrique Simão; Schmidt, André


    Cardiac tumors are extremely rare; however, when there is clinical suspicion, proper diagnostic evaluation is necessary to plan the most appropriate treatment. In this context, cardiovascular magnetic resonance imaging (CMRI) plays an important role, allowing a comprehensive characterization of such lesions. To review cases referred to a CMRI Department for investigation of cardiac and paracardiac masses. To describe the positive case series with a brief review of the literature for each type of lesion and the role of cardiovascular magnetic resonance imaging in evaluation. Between August 2008 and December 2011, all cases referred for CMRI with suspicion of tumor involving the heart were reviewed. Cases with positive histopathological diagnosis, clinical evolution or therapeutic response compatible with the clinical suspicion and imaging findings were selected. Among the 13 cases included in our study, eight (62%) had histopathological confirmation. We describe five benign tumors (myxomas, rhabdomyoma and fibromas), five malignancies (sarcoma, lymphoma, Richter syndrome involving the heart and metastatic disease) and three non-neoplastic lesions (pericardial cyst, intracardiac thrombus and infectious vegetation). CMRI plays an important role in the evaluation of cardiac masses of non-neoplastic and neoplastic origin, contributing to a more accurate diagnosis in a noninvasive manner and assisting in treatment planning, allowing safe clinical follow-up with good reproducibility

  13. Magnetic resonance imaging of the bone marrow

    Energy Technology Data Exchange (ETDEWEB)

    Baur-Melnyk, Andrea (ed.) [Klinikum der Univ. Muenchen (Germany). Inst. fuer Klinische Radiologie


    The first book devoted to MRI of the bone marrow. Describes the MRI appearances of normal bone marrows and the full range of bone marrow disorders. Discusses the role of advanced MRI techniques and contrast enhancement. On account of its unrivalled imaging capabilities and sensitivity, magnetic resonance imaging (MRI) is considered the modality of choice for the investigation of physiologic and pathologic processes affecting the bone marrow. This book describes the MRI appearances of both the normal bone marrow, including variants, and the full range of bone marrow disorders. Detailed discussion is devoted to malignancies, including multiple myeloma, lymphoma, chronic myeloproliferative disorders, leukemia, and bone metastases. Among the other conditions covered are benign and malignant compression fractures, osteonecrosis, hemolytic anemia, Gaucher's disease, bone marrow edema syndrome, trauma, and infective and non-infective inflammatory disease. Further chapters address the role of MRI in assessing treatment response, the use of contrast media, and advanced MRI techniques. Magnetic Resonance Imaging of the Bone Marrow represents an ideal reference for both novice and experienced practitioners.

  14. The assessment of breast cancer response to neoadjuvant chemotherapy: comparison of magnetic resonance imaging and 18F-fluorodeoxyglucose positron emission tomography

    International Nuclear Information System (INIS)

    Park, Jeong Seon; Moon, Woo Kyung; Lyou, Chae Yeon; Cho, Nariya; Kang, Keon Wook; Chung, June-Key


    Background: Neoadjuvant chemotherapy for locally advanced breast cancer is a widely accepted treatment. For assessment of the tumor response after chemotherapy, both magnetic resonance imaging (MRI) and 18 F-fluorodeoxyglucose positron emission tomography (PET) are promising methods. Purpose: To retrospectively compare MRI and PET in the assessment of tumor response to neoadjuvant chemotherapy for primary breast cancer with the pathologic response as the reference standard. Material and Methods: Between August 2006 and May 2008, 32 women with breast cancer underwent concurrent MRI and PET before and after neoadjuvant chemotherapy. For response assessment, we calculated the changes in the maximum diameters of the tumor (ΔDmax) on MRI, and the changes in the standard uptake values (ΔSUV) on PET. The correlation between the ΔDmax and ΔSUV was analyzed using Pearson's correlation coefficient. The correspondence rates between each imaging modality and pathologic assessment were calculated. For prediction of the pathologic complete response (pCR), the sensitivity, specificity, positive predictive value (PPV) and negative predictive value (NPV) were analyzed using the McNemar test. Results: The pathologic assessment of tumor response to neoadjuvant chemotherapy identified eight complete responses (25.0%), 10 partial responses (31.2%), and 14 non-responses (43.8%). The change in size on MRI was moderately correlated with the change in SUV on PET (r = 0.574, p = 0.001). The correspondence rate of response assessment was 75.0% (24/32) between MRI and pathologic response and 53.1% (17/32) between PET and pathologic response. For the pCR, specificity (95.8% vs. 62.5%) and PPV (83.3% vs. 47.1%) were statistically higher on MRI than PET (p < 0.05), while sensitivity (100.0% vs. 62.5%) and NPV (100.0% vs. 88.5%) on PET tended to be higher than MRI. Conclusion: Before and after neoadjuvant chemotherapy for breast cancer, the ΔDmax of MRI correlated moderately with the

  15. Magnetic resonance imaging of Parkinsonism

    International Nuclear Information System (INIS)

    Nakamura, Yusaku; Takahashi, Mitsuo; Kitaguchi, Masataka; Akaneya, Yukio; Mitui, Yoshiyuki; Tanaka, Hisashi


    We studied eighteen patients affected by Parkinsonism with symptoms of tremor, bradykinesia, or rigidity using magnetic resonance imaging (MRI). Patients ranged in age from 34 to 80 years (mean 62.8±11.6 years), and the duration of their disease had been 3.8±3.2 years. MRI examinations were performed with Shimazu and Siemens superconducting magnets, operating at 0.5 and 1.5 T magnetic fields, respectively. Both T 1 - and T 2 -weighted spin echo (SE) pulse sequences were used. In eight patients (44.4%), MRI demonstrated bilateral multiple lacunar infarction of the basal ganglia. The most common abnormality identified was multiple, bilateral lacunar infarcts in the lateral portion of the putamen. The average size of the lacunar infarction of the putamen was less than half that of the entire putamen. Patients with multiple lacunar infarction were significantly older than the other patients and had lower Yahr's scores. The clinical symptoms of patients with bilateral multiple lacunar infarction of the basal ganglia were compatible with the diagnosis of arteriosclerotic Parkinsonism of akinetic rigid type. It has been suggested that multiple lacunar infarction of the basal ganglia may have led to Parkinsonism in these patients. (author)

  16. Magnetic resonance imaging and neurolupus

    International Nuclear Information System (INIS)

    Schott, A.M.; Colson, F.; Tebib, J.; Noel, E.; Bouvier, M.


    Magnetic resonance imaging (MRI) was assessed in the management of neuropsychiatric manifestations occurring in 6 SLE patients. The MRI scans were normal in 3 cases and was associated with remission of the symptoms except for a patient who experienced a chorea at the time of the examination. Abnormal MRI scans always revealed more lesions than CT scan. 2 different patterns of abnormalities seem to correspond to 2 specific disorders. In 2 patients with clinical presentation suggesting a cortical ischemia by vascular thrombosis, both MRI scans showed areas of abnormal high signal intensities located in the subcortical white matter. In one last patient, MRI scan revealed multiple focal areas of high signal intensities (on T 1 weighter scans) disseminated not only in the deep white matter but also in the gray one. These lesions could be depend upon demyelinisation which may occur by a local vascular process. This serie confirms the interest of MRI in the management of SLE brain involvement as well as it points out some problem of interpretation. This suggest further comparative studies especially at the real onset and during the course of neuro-psychiatric manifestations. At last, the coronal sections may be more informative for the diagnosis and patholophysiology than the horizontal ones [fr

  17. Nuclear magnetic resonance imaging method

    International Nuclear Information System (INIS)

    Johnson, G.; MacDonald, J.; Hutchison, S.; Eastwood, L.M.; Redpath, T.W.T.; Mallard, J.R.


    A method of deriving three dimensional image information from an object using nuclear magnetic resonance signals comprises subjecting the object to a continuous, static magnetic field and carrying out the following set of sequential steps: 1) exciting nuclear spins in a selected volume (90deg pulse); 2) applying non-aligned first, second and third gradients of the magnetic field; 3) causing the spins to rephase periodically by reversal of the first gradient to produce spin echoes, and applying pulses of the second gradient prior to every read-out of an echo signal from the object, to differently encode the spin in the second gradient direction for each read-out signal. The above steps 1-3 are then successively repeated with different values of gradient of the third gradient, there being a recovery interval between the repetition of successive sets of steps. Alternate echoes only are read out, the other echoes being time-reversed and ignored for convenience. The resulting signals are appropriately sampled, set out in an array and subjected to three dimensional Fourier transformation. (author)

  18. Effects of chondroitin sulfate on brain response to painful stimulation in knee osteoarthritis patients. A randomized, double-blind, placebo-controlled functional magnetic resonance imaging study. (United States)

    Monfort, Jordi; Pujol, Jesús; Contreras-Rodríguez, Oren; Llorente-Onaindia, Jone; López-Solà, Marina; Blanco-Hinojo, Laura; Vergés, Josep; Herrero, Marta; Sánchez, Laura; Ortiz, Hector; Montañés, Francisco; Deus, Joan; Benito, Pere


    Knee osteoarthritis is causing pain and functional disability. One of the inherent problems with efficacy assessment of pain medication was the lack of objective pain measurements, but functional magnetic resonance imaging (fMRI) has emerged as a useful means to objectify brain response to painful stimulation. We have investigated the effect of chondroitin sulfate (CS) on brain response to knee painful stimulation in patients with knee osteoarthritis using fMRI. Twenty-two patients received CS (800mg/day) and 27 patients placebo, and were assessed at baseline and after 4 months of treatment. Two fMRI tests were conducted in each session by applying painful pressure on the knee interline and on the patella surface. The outcome measurement was attenuation of the response evoked by knee painful stimulation in the brain. fMRI of patella pain showed significantly greater activation reduction under CS compared with placebo in the region of the mesencephalic periaquecductal gray. The CS group, additionally showed pre/post-treatment activation reduction in the cortical representation of the leg. No effects of CS were detected using the interline pressure test. fMRI was sensitive to objectify CS effects on brain response to painful pressure on patellofemoral cartilage, which is consistent with the known CS action on chondrocyte regeneration. The current work yields further support to the utility of fMRI to objectify treatment effects on osteoarthritis pain. Copyright © 2017 Elsevier España, S.L.U. All rights reserved.

  19. Diffusion-Weighted Magnetic Resonance Imaging Early After Chemoradiotherapy to Monitor Treatment Response in Head-and-Neck Squamous Cell Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Vandecaveye, Vincent, E-mail: [Department of Radiology, University Hospitals Leuven (Belgium); Dirix, Piet [Department of Radiation Oncology, Leuven Cancer Institute, University Hospitals Leuven (Belgium); De Keyzer, Frederik; Op de Beeck, Katya [Department of Radiology, University Hospitals Leuven (Belgium); Vander Poorten, Vincent [Department of Otorhinolaryngology, Head and Neck Surgery, University Hospitals Leuven (Belgium); Hauben, Esther [Department of Pathology, University Hospitals Leuven (Belgium); Lambrecht, Maarten; Nuyts, Sandra [Department of Radiation Oncology, Leuven Cancer Institute, University Hospitals Leuven (Belgium); Hermans, Robert [Department of Radiology, University Hospitals Leuven (Belgium)


    Purpose: To evaluate diffusion-weighted imaging (DWI) for assessment of treatment response in head and neck squamous cell carcinoma (HNSCC) three weeks after the end of chemoradiotherapy (CRT). Methods and Materials: Twenty-nine patients with HNSCC underwent magnetic resonance imaging (MRI) prior to and 3 weeks after CRT, including T{sub 2}-weighted and pre- and postcontrast T{sub 1}-weighted sequences and an echo-planar DWI sequence with six b values (0 to 1,000 s/mm{sup 2}), from which the apparent diffusion coefficient (ADC) was calculated. ADC changes 3 weeks posttreatment compared to baseline ( Increment ADC) between responding and nonresponding primary lesions and adenopathies were correlated with 2 years locoregional control and compared with a Mann-Whitney test. In a blinded manner, the Increment ADC was compared to conventional MRI 3 weeks post-CRT and the routinely implemented CT, on average 3 months post-CRT, which used size-related and morphological criteria. Positive and negative predictive values (PPV and NPV, respectively) were compared between the Increment ADC and anatomical imaging. Results: The Increment ADC of lesions with later tumor recurrence was significantly lower than lesions with complete remission for both primary lesions (-2.3% {+-} 0.3% vs. 80% {+-} 41%; p < 0.0001) and adenopathies (19.9% {+-} 32% vs. 63% {+-} 36%; p = 0.003). The Increment ADC showed a PPV of 89% and an NPV of 100% for primary lesions and a PPV of 70% and an NPV of 96% for adenopathies per neck side. DWI improved PPV and NPV compared to anatomical imaging. Conclusion: DWI with the Increment ADC 3 weeks after concluding CRT for HNSCC allows for early assessment of treatment response.

  20. Diffusion-weighted magnetic resonance imaging for pretreatment prediction and monitoring of treatment response of patients with locally advanced breast cancer undergoing neoadjuvant chemotherapy

    International Nuclear Information System (INIS)

    Nilsen, Line; Olsen, Dag Rune; Seierstad, Therese; Fangberget, Anne; Geier, Oliver


    Background. For patients with locally advanced breast cancer (LABC) undergoing neoadjuvant chemotherapy (NACT), the European Guidelines for Breast Imaging recommends magnetic resonance imaging (MRI) to be performed before start of NACT, when half of the NACT has been administered and prior to surgery. This is the first study addressing the value of flow-insensitive apparent diffusion coefficients (ADCs) obtained from diffusion-weighted (DW) MRI at the recommended time points for pretreatment prediction and monitoring of treatment response. Materials and methods. Twenty-five LABC patients were included in this prospective study. DW MRI was performed using single-shot spin-echo echo-planar imaging with b-values of 100, 250 and 800 s/mm 2 prior to NACT, after four cycles of NACT and at the conclusion of therapy using a 1.5 T MR scanner. ADC in the breast tumor was calculated from each assessment. The strength of correlation between pretreatment ADC, ADC changes and tumor volume changes were examined using Spearman's rho correlation test. Results. Mean pretreatment ADC was 1.11 ± 0.21 x 10 -3 mm 2 /s. After 4 cycles of NACT, ADC was significantly increased (1.39 ± 0.36 x 10 -3 mm 2 /s; p=0.018). There was no correlation between individual pretreatment breast tumor ADC and MR response measured after four cycles of NACT (p=0.816) or prior to surgery (p=0.620). Conclusion. Pretreatment tumor ADC does not predict treatment response for patients with LABC undergoing NACT. Furthermore, ADC increase observed mid-way in the course of NACT does not correlate with tumor volume changes.

  1. 3-Dimensional Magnetic Resonance Spectroscopic Imaging at 3 Tesla for Early Response Assessment of Glioblastoma Patients During External Beam Radiation Therapy

    International Nuclear Information System (INIS)

    Muruganandham, Manickam; Clerkin, Patrick P.; Smith, Brian J.; Anderson, Carryn M.; Morris, Ann; Capizzano, Aristides A.; Magnotta, Vincent; McGuire, Sarah M.; Smith, Mark C.; Bayouth, John E.; Buatti, John M.


    Purpose: To evaluate the utility of 3-dimensional magnetic resonance (3D-MR) proton spectroscopic imaging for treatment planning and its implications for early response assessment in glioblastoma multiforme. Methods and Materials: Eighteen patients with newly diagnosed, histologically confirmed glioblastoma had 3D-MR proton spectroscopic imaging (MRSI) along with T2 and T1 gadolinium-enhanced MR images at simulation and at boost treatment planning after 17 to 20 fractions of radiation therapy. All patients received standard radiation therapy (RT) with concurrent temozolomide followed by adjuvant temozolomide. Imaging for response assessment consisted of MR scans every 2 months. Progression-free survival was defined by the criteria of MacDonald et al. MRSI images obtained at initial simulation were analyzed for choline/N-acetylaspartate ratios (Cho/NAA) on a voxel-by-voxel basis with abnormal activity defined as Cho/NAA ≥2. These images were compared on anatomically matched MRSI data collected after 3 weeks of RT. Changes in Cho/NAA between pretherapy and third-week RT scans were tested using Wilcoxon matched-pairs signed rank tests and correlated with progression-free survival, radiation dose and location of recurrence using Cox proportional hazards regression. Results: After a median follow-up time of 8.6 months, 50% of patients had experienced progression based on imaging. Patients with a decreased or stable mean or median Cho/NAA values had less risk of progression (P<.01). Patients with an increase in mean or median Cho/NAA values at the third-week RT scan had a significantly greater chance of early progression (P<.01). An increased Cho/NAA at the third-week MRSI scan carried a hazard ratio of 2.72 (95% confidence interval, 1.10-6.71; P=.03). Most patients received the prescription dose of RT to the Cho/NAA ≥2 volume, where recurrence most often occurred. Conclusion: Change in mean and median Cho/NAA detected at 3 weeks was a significant predictor of

  2. 3-Dimensional Magnetic Resonance Spectroscopic Imaging at 3 Tesla for Early Response Assessment of Glioblastoma Patients During External Beam Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Muruganandham, Manickam; Clerkin, Patrick P. [Department of Radiation Oncology, University of Iowa Hospitals and Clinics, Iowa City, Iowa (United States); Smith, Brian J. [Department of Biostatistics, University of Iowa Hospitals and Clinics, Iowa City, Iowa (United States); Anderson, Carryn M.; Morris, Ann [Department of Radiation Oncology, University of Iowa Hospitals and Clinics, Iowa City, Iowa (United States); Capizzano, Aristides A.; Magnotta, Vincent [Department of Radiology, University of Iowa Hospitals and Clinics, Iowa City, Iowa (United States); McGuire, Sarah M.; Smith, Mark C.; Bayouth, John E. [Department of Radiation Oncology, University of Iowa Hospitals and Clinics, Iowa City, Iowa (United States); Buatti, John M., E-mail: [Department of Radiation Oncology, University of Iowa Hospitals and Clinics, Iowa City, Iowa (United States)


    Purpose: To evaluate the utility of 3-dimensional magnetic resonance (3D-MR) proton spectroscopic imaging for treatment planning and its implications for early response assessment in glioblastoma multiforme. Methods and Materials: Eighteen patients with newly diagnosed, histologically confirmed glioblastoma had 3D-MR proton spectroscopic imaging (MRSI) along with T2 and T1 gadolinium-enhanced MR images at simulation and at boost treatment planning after 17 to 20 fractions of radiation therapy. All patients received standard radiation therapy (RT) with concurrent temozolomide followed by adjuvant temozolomide. Imaging for response assessment consisted of MR scans every 2 months. Progression-free survival was defined by the criteria of MacDonald et al. MRSI images obtained at initial simulation were analyzed for choline/N-acetylaspartate ratios (Cho/NAA) on a voxel-by-voxel basis with abnormal activity defined as Cho/NAA ≥2. These images were compared on anatomically matched MRSI data collected after 3 weeks of RT. Changes in Cho/NAA between pretherapy and third-week RT scans were tested using Wilcoxon matched-pairs signed rank tests and correlated with progression-free survival, radiation dose and location of recurrence using Cox proportional hazards regression. Results: After a median follow-up time of 8.6 months, 50% of patients had experienced progression based on imaging. Patients with a decreased or stable mean or median Cho/NAA values had less risk of progression (P<.01). Patients with an increase in mean or median Cho/NAA values at the third-week RT scan had a significantly greater chance of early progression (P<.01). An increased Cho/NAA at the third-week MRSI scan carried a hazard ratio of 2.72 (95% confidence interval, 1.10-6.71; P=.03). Most patients received the prescription dose of RT to the Cho/NAA ≥2 volume, where recurrence most often occurred. Conclusion: Change in mean and median Cho/NAA detected at 3 weeks was a significant predictor of

  3. 3-Dimensional magnetic resonance spectroscopic imaging at 3 Tesla for early response assessment of glioblastoma patients during external beam radiation therapy. (United States)

    Muruganandham, Manickam; Clerkin, Patrick P; Smith, Brian J; Anderson, Carryn M; Morris, Ann; Capizzano, Aristides A; Magnotta, Vincent; McGuire, Sarah M; Smith, Mark C; Bayouth, John E; Buatti, John M


    To evaluate the utility of 3-dimensional magnetic resonance (3D-MR) proton spectroscopic imaging for treatment planning and its implications for early response assessment in glioblastoma multiforme. Eighteen patients with newly diagnosed, histologically confirmed glioblastoma had 3D-MR proton spectroscopic imaging (MRSI) along with T2 and T1 gadolinium-enhanced MR images at simulation and at boost treatment planning after 17 to 20 fractions of radiation therapy. All patients received standard radiation therapy (RT) with concurrent temozolomide followed by adjuvant temozolomide. Imaging for response assessment consisted of MR scans every 2 months. Progression-free survival was defined by the criteria of MacDonald et al. MRSI images obtained at initial simulation were analyzed for choline/N-acetylaspartate ratios (Cho/NAA) on a voxel-by-voxel basis with abnormal activity defined as Cho/NAA ≥2. These images were compared on anatomically matched MRSI data collected after 3 weeks of RT. Changes in Cho/NAA between pretherapy and third-week RT scans were tested using Wilcoxon matched-pairs signed rank tests and correlated with progression-free survival, radiation dose and location of recurrence using Cox proportional hazards regression. After a median follow-up time of 8.6 months, 50% of patients had experienced progression based on imaging. Patients with a decreased or stable mean or median Cho/NAA values had less risk of progression (P<.01). Patients with an increase in mean or median Cho/NAA values at the third-week RT scan had a significantly greater chance of early progression (P<.01). An increased Cho/NAA at the third-week MRSI scan carried a hazard ratio of 2.72 (95% confidence interval, 1.10-6.71; P=.03). Most patients received the prescription dose of RT to the Cho/NAA ≥2 volume, where recurrence most often occurred. Change in mean and median Cho/NAA detected at 3 weeks was a significant predictor of early progression. The potential impact for risk

  4. Early biomarkers from dynamic contrast-enhanced magnetic resonance imaging to predict the response to antiangiogenic therapy in high-grade gliomas

    Energy Technology Data Exchange (ETDEWEB)

    Piludu, Francesca; Vidiri, Antonello [Regina Elena National Cancer Institute, Radiology and Diagnostic Imaging Department, Rome (Italy); Marzi, Simona [Regina Elena National Cancer Institute, Medical Physics Laboratory, Rome (Italy); Pace, Andrea; Villani, Veronica [Regina Elena National Cancer Institute, Neurology Division, Rome (Italy); Fabi, Alessandra [Regina Elena National Cancer Institute, Oncology Department, Rome (Italy); Carapella, Carmine Maria [Regina Elena National Cancer Institute, Oncologic Surgery Department, Rome (Italy); Terrenato, Irene [Regina Elena National Cancer Institute, Biostatistics-Scientific Direction, Rome (Italy); Antenucci, Anna [Regina Elena National Cancer Institute, Clinical Pathology, Rome (Italy)


    The aim of this study is to investigate whether early changes in tumor volume and perfusion measurements derived from dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI) may predict response to antiangiogenic therapy in recurrent high-grade gliomas. Twenty-seven patients who received bevacizumab every 3 weeks were enrolled in the study. For each patient, three MRI scans were performed: at baseline, after the first dose, and after the fourth dose of bevacizumab. The entire tumor volume (V{sub tot}), as well as contrast-enhanced and noncontrast-enhanced tumor subvolumes (V{sub CE-T1} and V{sub NON-CE-T1}, respectively) were outlined using post-contrast T1-weighted images as a guide for the tumor location. Histogram analysis of normalized IAUGC (nIAUGC) and transfer constant K{sup trans} maps were performed. Each patient was classified as a responder patient if he/she had a partial response or a stable disease or as a nonresponder patient if he/she had progressive disease. Responding patients showed a larger reduction in V{sub NON-CE-T1} after a single dose, compared to nonresponding patients. Tumor subvolumes with increased values of nIAUGC and K{sup trans}, after a single dose, significantly differed between responders and nonresponders. The radiological response was found to be significantly associated to the clinical outcome. After a single dose, V{sub tot} was predictive of overall survival (OS), while V{sub CE-T1} showed a tendency of correlation with OS. Tumor subvolumes with increased nIAUGC and K{sup trans} showed the potential for improving the diagnostic accuracy of DCE. Early assessments of the entire tumor volume, including necrotic areas, may provide complementary information of tumor behavior in response to anti-VEGF therapies and is worth further investigation. (orig.)

  5. Imaging of the hip joint. Computed tomography versus magnetic resonance imaging (United States)

    Lang, P.; Genant, H. K.; Jergesen, H. E.; Murray, W. R.


    The authors reviewed the applications and limitations of computed tomography (CT) and magnetic resonance (MR) imaging in the assessment of the most common hip disorders. Magnetic resonance imaging is the most sensitive technique in detecting osteonecrosis of the femoral head. Magnetic resonance reflects the histologic changes associated with osteonecrosis very well, which may ultimately help to improve staging. Computed tomography can more accurately identify subchondral fractures than MR imaging and thus remains important for staging. In congenital dysplasia of the hip, the position of the nonossified femoral head in children less than six months of age can only be inferred by indirect signs on CT. Magnetic resonance imaging demonstrates the cartilaginous femoral head directly without ionizing radiation. Computed tomography remains the imaging modality of choice for evaluating fractures of the hip joint. In some patients, MR imaging demonstrates the fracture even when it is not apparent on radiography. In neoplasm, CT provides better assessment of calcification, ossification, and periosteal reaction than MR imaging. Magnetic resonance imaging, however, represents the most accurate imaging modality for evaluating intramedullary and soft-tissue extent of the tumor and identifying involvement of neurovascular bundles. Magnetic resonance imaging can also be used to monitor response to chemotherapy. In osteoarthrosis and rheumatoid arthritis of the hip, both CT and MR provide more detailed assessment of the severity of disease than conventional radiography because of their tomographic nature. Magnetic resonance imaging is unique in evaluating cartilage degeneration and loss, and in demonstrating soft-tissue alterations such as inflammatory synovial proliferation.

  6. Contrast agents in magnetic resonance imaging

    International Nuclear Information System (INIS)

    Karadjian, V.


    The origine of nuclear magnetic resonance signal is reminded and different ways for contrast enhancement in magnetic resonance imaging are presented, especially, modifications of tissus relaxation times. Investigations have focused on development of agents incorporating either paramagnetic ions or stable free radicals. Pharmacological and toxicological aspects are developed. The diagnostic potential of these substances is illustrated by the example of gadolinium complexes [fr

  7. Magnetic resonance imaging of cerebellar Schistosomiasis mansoni

    International Nuclear Information System (INIS)

    Braga, Bruno Perocco; Costa Junior, Leodante Batista da; Lambertucci, Jose Roberto


    A 15-year-old boy was admitted to hospital with a history of headache, dizziness, vomiting and double vision that started two weeks before. His parents denied any previous disease. During clinical examination he presented diplopia on lateral gaze to the left and horizontal nystagmus. No major neurological dysfunction was detected. He was well built, mentally responsive and perceptive. Laboratory findings revealed a leukocyte count of 10,000/mL, a normal red blood cell count and no eosinophilia. The magnetic resonance images (MRI) of the brain showed a left cerebellar lesion with mass effect compressing the surrounding tissues. Contrast-enhanced images showed a mass like structure and punctate nodules (Figures A and B: axial and coronal contrast-enhanced T1-weighted MR images showed the nodular - yellow arrows - enhancement pattern of a left cerebellar intraxial lesion). The lesion extended to the vermis and brachium pons and compressed the medulla. There was no hydrocephalus. He was taken to the operating room with the presumptive diagnosis of a neuroglial tumor, and submitted to a lateral suboccipital craniectomy. A brown, brittle tumoral mass without a clearly defined margin with the cerebellar tissue was removed. Microscopic examination revealed schistosomal granulomas in the productive phase in the cerebellum (Figure C). After surgery, treatment with praziquantel (50 mg/kg/dia, single dose) and prednisone (1 mg/kg/day) was offered and the patient improved quickly. Thirty days later he was seen again at the outpatient clinic: he was asymptomatic and with no neurological impairment. This is the eighth case of cerebellar involvement in schistosomiasis mansoni and the second report of a tumoral form of cerebellar schistosomiasis documented by magnetic resonance images. (author)

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... clear images. Patient movement can have the same effect. A very irregular heartbeat may affect the quality of images obtained using techniques that time the imaging based on the electrical activity of ...

  9. Multifunctional reduction-responsive SPIO and DOX-loaded PEGylated polymeric lipid vesicles for magnetic resonance imaging-guided drug delivery

    International Nuclear Information System (INIS)

    Wang, Sheng; Yang, Weitao; Wang, Hanjie; Chang, Jin; Gong, Xiaoqun; Du, Hongli; Guo, Fangfang; Zhang, Bingbo


    Multifunctional superparamagnetic iron-oxide (SPIO)-based nanoparticles have been emerging as candidate nanosystems for cancer diagnosis and therapy. Here, we report the use of reduction- responsive SPIO/doxorubicin (DOX)-loaded poly(ethylene glycol) monomethyl ether (PEG)ylated polymeric lipid vesicles (SPIO and DOX-PPLVs) as a novel theranostic system for tumor magnetic resonance imaging (MRI) diagnosis and controlled drug delivery. These SPIO and DOX-PPLVs are composed of SPIOs that function as MR contrast agents for tumor enhancement and PPLVs as polymer matrices for encapsulating SPIO and antitumor drugs. The in vitro characterizations show that the SPIO and DOX-PPLVs have nanosized structures (∼80 nm), excellent colloidal stability,  good biocompatibility, as well as T _2-weighted MRI capability with a relatively high T _2 relaxivity (r _2 = 213.82 mM"−"1 s"−"1). In vitro drug release studies reveal that the release rate of DOX from the SPIO and DOX-PPLVs is accelerated in the reduction environment. An in vitro cellular uptake study and an antitumor study show that the SPIO and DOX-PPLVs have magnetic targeting properties and effective antitumor activity. In vivo studies show the SPIO and DOX-PPLVs have excellent T _2-weighted tumor targeted MRI capability, image-guided drug delivery capability, and high antitumor effects. These results suggest that the SPIO and DOX-PPLVs are promising nanocarriers for MRI diagnosis and cancer therapy applications. (paper)

  10. Can magnetic resonance imaging differentiate undifferentiated arthritis?

    DEFF Research Database (Denmark)

    Østergaard, Mikkel; Duer, Anne; Hørslev-Petersen, K


    A high sensitivity for the detection of inflammatory and destructive changes in inflammatory joint diseases makes magnetic resonance imaging potentially useful for assigning specific diagnoses, such as rheumatoid arthritis and psoriatic arthritis in arthritides, that remain undifferentiated after...... conventional clinical, biochemical and radiographic examinations. With recent data as the starting point, the present paper describes the current knowledge on magnetic resonance imaging in the differential diagnosis of undifferentiated arthritis....

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... bear denotes child-specific content. Related Articles and Media MR Angiography (MRA) Magnetic Resonance, Functional (fMRI) - Brain ... the web pages found at these links. About Us | Contact Us | FAQ | Privacy | Terms of Use | Links | ...

  12. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... bear denotes child-specific content. Related Articles and Media Catheter Angiography Magnetic Resonance, Functional (fMRI) - Brain Children's ( ... the web pages found at these links. About Us | Contact Us | FAQ | Privacy | Terms of Use | Links | ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... immediately after the exam. A few patients experience side effects from the contrast material, including nausea and local ... Related Articles and Media Catheter Angiography Magnetic Resonance, Functional (fMRI) - Brain Children's (Pediatric) CT (Computed Tomography) Magnetic ...

  14. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... or thyroid problems. Any of these conditions may influence the decision on whether contrast material will be ... bear denotes child-specific content. Related Articles and Media Catheter Angiography Magnetic Resonance, Functional (fMRI) - Brain Children's ( ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Related Articles and Media Catheter Angiography Magnetic Resonance, Functional (fMRI) - Brain Children's (Pediatric) CT (Computed Tomography) Magnetic ... the possible charges you will incur. Web page review process: This Web page is reviewed regularly by ...

  16. Magnetic resonance imaging: hazard, risk and safety

    International Nuclear Information System (INIS)

    Narayan, Pradeep; Suri, S.; Singh, P.


    The hazard and risk associated with magnetic resonance imaging is a matter of concern. In 1982, the Food and Drug Administration (FDA), USA issued guidelines to Hospital's Investigational Review Board (IRBs) in 'Guidelines for Evaluating Electromagnetic Exposure Risks for Trials of Clinical Nuclear Magnetic Resonance (NMR)'. In 1997, the Berufsgenossenschaft (BG), professional association for precision engineering and electronics of Germany, in their preliminary proposal for safety limits extended their concerns on static magnetic field. Owing to both time varying and static magnetic fields applied in Magnetic Resonance Imaging (MRI) this became of immediate concern to user community to assess the potential hazard and risk associated with the NMR system

  17. In vivo measurement of regional brain metabolic response to hyperventilation using magnetic resonance: proton echo planar spectroscopic imaging (PEPSI). (United States)

    Posse, S; Dager, S R; Richards, T L; Yuan, C; Ogg, R; Artru, A A; Müller-Gärtner, H W; Hayes, C


    A new rapid spectroscopic imaging technique with improved sensitivity and lipid suppression, referred to as Proton Echo Planar Spectroscopic Imaging (PEPSI), has been developed to measure the 2-dimensional distribution of brain lactate increases during hyperventilation on a conventional clinical scanner equipped with a head surface coil phased array. PEPSI images (nominal voxel size: 1.125 cm3) in five healthy subjects from an axial section approximately 20 mm inferior to the intercommissural line were obtained during an 8.5-min baseline period of normocapnia and during the final 8.5 min of a 10-min period of capnometry-controlled hyperventilation (end-tidal PCO2 of 20 mmHg). The lactate/N-acetyl aspartate signal increased significantly from baseline during hyperventilation for the insular cortex, temporal cortex, and occipital regions of both the right and left hemisphere, but not in the basal ganglia. Regional or hemispheric right-to-left differences were not found. The study extends previous work using single-voxel MR spectroscopy to dynamically study hyperventilation effects on brain metabolism.

  18. Magnetic resonance imaging of the fetal brain. (United States)

    Tee, L Mf; Kan, E Yl; Cheung, J Cy; Leung, W C


    This review covers the recent literature on fetal brain magnetic resonance imaging, with emphasis on techniques, advances, common indications, and safety. We conducted a search of MEDLINE for articles published after 2010. The search terms used were "(fetal OR foetal OR fetus OR foetus) AND (MR OR MRI OR [magnetic resonance]) AND (brain OR cerebral)". Consensus statements from major authorities were also included. As a result, 44 relevant articles were included and formed the basis of this review. One major challenge is fetal motion that is largely overcome by ultra-fast sequences. Currently, single-shot fast spin-echo T2-weighted imaging remains the mainstay for motion resistance and anatomical delineation. Recently, a snap-shot inversion recovery sequence has enabled robust T1-weighted images to be obtained, which is previously a challenge for standard gradient-echo acquisitions. Fetal diffusion-weighted imaging, diffusion tensor imaging, and magnetic resonance spectroscopy are also being developed. With multiplanar capabilities, superior contrast resolution and field of view, magnetic resonance imaging does not have the limitations of sonography, and can provide additional important information. Common indications include ventriculomegaly, callosum and posterior fossa abnormalities, and twin complications. There are safety concerns about magnetic resonance-induced heating and acoustic damage but current literature showed no conclusive evidence of deleterious fetal effects. The American College of Radiology guideline states that pregnant patients can be accepted to undergo magnetic resonance imaging at any stage of pregnancy if risk-benefit ratio to patients warrants that the study be performed. Magnetic resonance imaging of the fetal brain is a safe and powerful adjunct to sonography in prenatal diagnosis. It can provide additional information that aids clinical management, prognostication, and counselling.

  19. Changes in Male Rat Sexual Behavior and Brain Activity Revealed by Functional Magnetic Resonance Imaging in Response to Chronic Mild Stress. (United States)

    Chen, Guotao; Yang, Baibing; Chen, Jianhuai; Zhu, Leilei; Jiang, Hesong; Yu, Wen; Zang, Fengchao; Chen, Yun; Dai, Yutian


    G, Yang B, Chen J, et al. Changes in Male Rat Sexual Behavior and Brain Activity Revealed by Functional Magnetic Resonance Imaging in Response to Chronic Mild Stress. J Sex Med 2018;15:136-147. Copyright © 2017 International Society for Sexual Medicine. Published by Elsevier Inc. All rights reserved.

  20. The Role of Diffusion-Weighted Magnetic Resonance Imaging in the Treatment Response Evaluation of Hepatocellular Carcinoma Patients Treated With Radiation Therapy

    International Nuclear Information System (INIS)

    Yu, Jeong Il; Park, Hee Chul; Lim, Do Hoon; Choi, Yunseon; Jung, Sang Hoon; Paik, Seung Woon; Kim, Seong Hyun; Jeong, Woo Kyoung; Kim, Young Kon


    Purpose: We investigated the role of diffusion-weighted magnetic resonance imaging (DW MRI) as a response evaluation indicator for hepatocellular carcinoma (HCC) treated with radiation therapy (RT). Methods and Materials: Inclusion criteria of this retrospective study were DW MRI acquisition within 1 month before and 3 to 5 months after RT. In total, 48 patients were enrolled. Two radiation oncologists measured the apparent diffusion coefficient (ADC). Possible predictive factors, including alteration of the ADC value before and 3 to 5 month after RT, in relation to local progression-free survival (LPFS) were analyzed and compared. Results: Three months after RT, 6 patients (12.5%) showed a complete response, and 27 patients (56.3%) showed a partial response when evaluated using the modified response evaluation criteria in solid tumors (mRECIST). The average ADC ± SD values were 1.21 ± 0.27 ( × 10 −3  mm 2 /s) before and 1.41 ± 0.36 ( × 10 −3  mm 2 /s) after RT (P<.001). The most significant prognostic factor related to LPFS was mRECIST (P<.001). The increment of ADC value (≥20%) was also a significant factor (P=.02), but RECIST (version 1.1; P=.11) was not. When RECIST was combined with the increment of ADC value (≥20%), the LPFS rates were significantly different between the groups (P=.004), and the area under the curve value (0.745) was comparable with that of mRECIST (0.765). Conclusions: ADC value change before and after RT in HCC was closely related to LPFS. ADC value and RECIST may substitute for mRECIST in patients who cannot receive contrast agents

  1. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... you! Do you have a personal story about radiology? Share your patient story here Images × Image Gallery ... reviewed by committees from the American College of Radiology (ACR) and the Radiological Society of North America ( ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... you! Do you have a personal story about radiology? Share your patient story here Images × Image Gallery ... reviewed by committees from the American College of Radiology (ACR) and the Radiological Society of North America ( ...

  3. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Imaging (MRI) procedure View full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy bear denotes child-specific content. ...

  4. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... six weeks) before being safe for MRI examinations. Examples include but are not limited to: artificial heart ... the area to be imaged. Furthermore, the examination takes longer than other imaging modalities (typically x-ray ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... to a CD or uploaded to a digital cloud server. Currently, MRI is the most sensitive imaging ... over time. top of page What are the benefits vs. risks? Benefits MRI is a noninvasive imaging ...

  6. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... computer then processes the signals and generates a series of images, each of which shows a thin ... into the intravenous line (IV) after an initial series of scans. Additional series of images will be ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... imaging modalities. top of page Additional Information and Resources : Radiation Therapy for Brain Tumors Radiation ... To locate a medical imaging or radiation oncology provider in your community, you can search the ACR- ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... practice. top of page What are some common uses of the procedure? MR imaging of the head ... is done because a potential abnormality needs further evaluation with additional views or a special imaging technique. ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Most MRI exams are painless. However, some patients find it uncomfortable to remain still during MR imaging. ... anxious, confused or in severe pain, you may find it difficult to lie still during imaging. A ...

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... determine the presence of certain diseases. The images can then be examined on a computer monitor, transmitted ... for imaging the joints and bones, where it can help: diagnose sports-related injuries detect the presence ...

  11. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... identify and accurately characterize diseases than other imaging methods. This detail makes MRI an invaluable tool in ... might be obscured by bone with other imaging methods. The contrast material used in MRI exams is ...

  12. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... are clearer and more detailed than other imaging methods. This exam does not use ionizing radiation and ... clearer and more detailed than with other imaging methods. This detail makes MRI an invaluable tool in ...

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... other imaging methods. This exam does not use ionizing radiation and may require an injection of a contrast ... other internal body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians to ...

  14. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... claustrophobia. Newer open MRI units provide very high quality images for many types of exams. Older open MRI units may not provide this same image quality. Certain types of exams cannot be performed using ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... claustrophobia. Newer open MRI units provide very high quality images for many types of exams; however, older ... MRI units may not provide this same image quality. Certain types of exams cannot be performed using ...

  16. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... a radiologist or other physician. To locate a medical imaging or radiation oncology provider in your community, you ... not provide cost information. The costs for specific medical imaging tests, treatments and procedures may vary by geographic ...

  17. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... a radiologist or other physician. To locate a medical imaging or radiation oncology provider in your community, you ... not provide cost information. The costs for specific medical imaging tests, treatments and procedures may vary by geographic ...

  18. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Detailed MR images allow physicians to evaluate various parts of the body and determine the presence of ... machine and in some cases, placed around the part of the body being imaged, send and receive ...

  19. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... metallic objects. Patient movement can have the same effect. A very irregular heartbeat may affect the quality of images obtained using techniques that time the imaging based on the electrical activity of ...

  20. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... based on clinical judgment. This is because traction devices and many types of life support equipment may distort the MR images and as a result, must be kept away from the area to be imaged. Furthermore, the examination takes longer than other imaging modalities (typically x-ray ...

  1. Magnetic resonance imaging in radiotherapy treatment planning

    NARCIS (Netherlands)

    Moerland, Marinus Adriaan


    From its inception in the early 1970's up to the present, magnetic resonance imaging (MRI) has evolved into a sophisticated technique, which has aroused considerable interest in var- ious subelds of medicine including radiotherapy. MRI is capable of imaging in any plane and does not use ionizing

  2. Automated Segmentation of Cardiac Magnetic Resonance Images

    DEFF Research Database (Denmark)

    Stegmann, Mikkel Bille; Nilsson, Jens Chr.; Grønning, Bjørn A.


    Magnetic resonance imaging (MRI) has been shown to be an accurate and precise technique to assess cardiac volumes and function in a non-invasive manner and is generally considered to be the current gold-standard for cardiac imaging [1]. Measurement of ventricular volumes, muscle mass and function...

  3. Magnetic resonance imaging in obstetric diagnosis. (United States)

    Weinreb, J C; Lowe, T W; Santos-Ramos, R; Cunningham, F G; Parkey, R


    Five patients with abnormal pregnancies were examined with ultrasound (US) and magnetic resonance imaging (MR). Three had a malformed fetus, 1 had a molar pregnancy, and 1 had an ovarian mass. Both maternal and fetal structures were clearly shown, although fetal motion may have resulted in image degradation in some cases. The authors suggest that MR may be useful in obstetric diagnosis.

  4. Magnetic resonance imaging of semicircular canals. (United States)

    Sbarbati, A; Leclercq, F; Zancanaro, C; Antonakis, K


    The present paper reports the results of the first investigation of the semicircular canals in a living, small animal by means of high spatial resolution magnetic resonance imaging. This procedure is noninvasive and allows identification of the endolymphatic and perilymphatic spaces yielding a morphology quite consistent with direct anatomical examination. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:1506290

  5. Magnetic resonance imaging - first human images in Australia

    International Nuclear Information System (INIS)

    Baddeley, H.; Doddrell, D.M.; Brooks, W.M.; Field, J.; Irving, M.; Williams, J.E.


    The use of magnetic resonance imaging, in the demonstration of internal human anatomy and in the diagnosis of disease, has the major advantages that the technique is non-invasive, does not require the use of ionizing radiation and that it can demonstrate neurological and cardiovascular lesions that cannot be diagnosed easily by other imaging methods. The first magnetic resonance images of humans were obtained in Australia in October 1985 on the research instrument of the Queensland Medical Magnetic Resonance Research Centre, which is based at the Mater Hospital in Brisbane

  6. Brain Activation in Response to Visually Evoked Sexual Arousal in Male-to-Female Transsexuals: 3.0 Tesla Functional Magnetic Resonance Imaging (United States)

    Oh, Seok-Kyun; Kim, Gwang-Won; Yang, Jong-Chul; Kim, Seok-Kwun; Kang, Heoung-Keun


    Objective This study used functional magnetic resonance imaging (fMRI) to contrast the differential brain activation patterns in response to visual stimulation with both male and female erotic nude pictures in male-to-female (MTF) transsexuals who underwent a sex reassignment surgery. Materials and Methods A total of nine healthy MTF transsexuals after a sex reassignment surgery underwent fMRI on a 3.0 Tesla MR Scanner. The brain activation patterns were induced by visual stimulation with both male and female erotic nude pictures. Results The sex hormone levels of the postoperative MTF transsexuals were in the normal range of healthy heterosexual females. The brain areas, which were activated by viewing male nude pictures when compared with viewing female nude pictures, included predominantly the cerebellum, hippocampus, putamen, anterior cingulate gyrus, head of caudate nucleus, amygdala, midbrain, thalamus, insula, and body of caudate nucleus. On the other hand, brain activation induced by viewing female nude pictures was predominantly observed in the hypothalamus and the septal area. Conclusion Our findings suggest that distinct brain activation patterns associated with visual sexual arousal in postoperative MTF transsexuals reflect their sexual orientation to males. PMID:22563262

  7. Brain Activation in Response to Visually Evoked Sexual Arousal in Male-to-Female Transsexuals: 3.0 Tesla Functional Magnetic Resonance Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Seok Kyun; Kim, Gwang Won; Kang, Heoung Keun; Jeong, Gwang Woo [Chonnam National University, Gwangju (Korea, Republic of); Yang, Jong Chul [Chonbuk National University Medical School, Jeonju (Korea, Republic of); Kim, Seok Kwun [Dong-A University College of Medicine, Busan (Korea, Republic of)


    This study used functional magnetic resonance imaging (fMRI) to contrast the differential brain activation patterns in response to visual stimulation with both male and female erotic nude pictures in male-to-female (MTF) transsexuals who underwent a sex reassignment surgery. A total of nine healthy MTF transsexuals after a sex reassignment surgery underwent fMRI on a 3.0 Tesla MR Scanner. The brain activation patterns were induced by visual stimulation with both male and female erotic nude pictures. The sex hormone levels of the postoperative MTF transsexuals were in the normal range of healthy heterosexual females. The brain areas, which were activated by viewing male nude pictures when compared with viewing female nude pictures, included predominantly the cerebellum, hippocampus, putamen, anterior cingulate gyrus, head of caudate nucleus, amygdala, midbrain, thalamus, insula, and body of caudate nucleus. On the other hand, brain activation induced by viewing female nude pictures was predominantly observed in the hypothalamus and the septal area. Our findings suggest that distinct brain activation patterns associated with visual sexual arousal in postoperative MTF transsexuals reflect their sexual orientation to males.

  8. Brain Activation in Response to Visually Evoked Sexual Arousal in Male-to-Female Transsexuals: 3.0 Tesla Functional Magnetic Resonance Imaging

    International Nuclear Information System (INIS)

    Oh, Seok Kyun; Kim, Gwang Won; Kang, Heoung Keun; Jeong, Gwang Woo; Yang, Jong Chul; Kim, Seok Kwun


    This study used functional magnetic resonance imaging (fMRI) to contrast the differential brain activation patterns in response to visual stimulation with both male and female erotic nude pictures in male-to-female (MTF) transsexuals who underwent a sex reassignment surgery. A total of nine healthy MTF transsexuals after a sex reassignment surgery underwent fMRI on a 3.0 Tesla MR Scanner. The brain activation patterns were induced by visual stimulation with both male and female erotic nude pictures. The sex hormone levels of the postoperative MTF transsexuals were in the normal range of healthy heterosexual females. The brain areas, which were activated by viewing male nude pictures when compared with viewing female nude pictures, included predominantly the cerebellum, hippocampus, putamen, anterior cingulate gyrus, head of caudate nucleus, amygdala, midbrain, thalamus, insula, and body of caudate nucleus. On the other hand, brain activation induced by viewing female nude pictures was predominantly observed in the hypothalamus and the septal area. Our findings suggest that distinct brain activation patterns associated with visual sexual arousal in postoperative MTF transsexuals reflect their sexual orientation to males.

  9. Basic principles of nuclear magnetic resonance imaging

    International Nuclear Information System (INIS)

    Valk, J.; MacLean, C.; Algra, P.R.


    The intent of this book is to help clinicians understand the basic physical principles of magnetic resonance (MR) imaging. The book consists of the following: a discussion of elementary considerations; pulse sequencing; localization of MR signals in space; MR equipment; MR contrast agents; clinical applications; MR spectroscopy; and biological effects of MR imaging; a set of appendixes; and a bibliography. Illustrations and images are included

  10. A case of oculo-palato-skeletal myoclonus with its responsible lesion clearly delineated by magnetic resonance imaging (MRI)

    International Nuclear Information System (INIS)

    Kondou, Susumu; Muramatsu, Shinichi; Yamaguchi, Haruyasu; Morimatsu, Mitsunori; Hirai, Shunsaku


    The brain lesions responsible for palatal myoclonus have been established in many patients by autopsies, although they are yet to be demonstrated with radiological methods including X-ray CT. We report here a case of oculo-palatoskeletal myoclonus whose causative lesion was clearly delineated by MRI. A 61-year-old man had been well until 60, when he suddenly lost consciousness followed by right hemiparesis. X-ray CT revealed a small bleeding in the tegmentum of the pons. He recovered from hemiparesis almost completely in several months. In January 1985, a year after the stroke, however, he developed abnormal involuntary movements (AIM) of the right upper and lower extremities, which gradually increased in severity. In April 1985, he was admitted to our hospital because of AIM and gait disturbance. General physical examination was unremarkable with normal mentality and blood pressure 140/80 mmHg. On neurologic examination, the most outstanding finding was spontaneously and synchronously occurring rhythmic movements involving eyeballs and soft palates at a rate of about 2 Hz, more marked on the right. Furthermore, AIM of the right upper and lower limbs were also obvious in synchrony with rhythmic ocular and palatal movements. These AIM of the limbs were more prominent in the proximal portions and augmented with voluntary motions. They persisted while he was wakeful, disappearing in sleep. There were pyramidal tract signs, hemiataxia and hemisensory disturbance on the right as well as truncal ataxia. X-ray CT of the brain failed to demonstrate the lesion, while MRI showed a low intensity lesion in the tegmentum of the mid- and upper pons, which extended on both sides, more dominant on the right, probably involving the right central tegmental tract; the lesion well accepted as responsible for palatal myoclonus occurring ipsilaterally. (J.P.N.)

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... you, notify the radiologist or technologist. It is important that you remain perfectly still while the images are being obtained, which is typically only a few seconds to a few minutes at a time. You will know when images are being recorded ...

  12. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... technologist through the two-way intercom. It is important that your child remain perfectly still while the images are being obtained, which is typically only a few seconds to a few minutes at a time. Your child will know when images are being ...

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... examination poses almost no risk to the average patient when appropriate safety guidelines are followed. If sedation is used, there ... have a personal story about radiology? Share your patient story here Images ... Disease Head Injury Brain Tumors Images related ...

  14. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos ... the body and determine the presence of certain diseases. The images can then be examined on a ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... exposure to ionizing radiation. MR imaging of the soft-tissue structures of the body—such as the heart, liver and many other organs—is more likely in some instances to identify and accurately characterize diseases than other imaging methods. This detail makes MRI an invaluable tool in ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... of which shows a thin slice of the body. The images can then be studied from different angles by ... information please consult the ACR Manual on Contrast Media and its references. top of page What are the limitations of MRI of the Head? High-quality images are assured only if you are able to ...

  17. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... can also provide functional information (fMRI) in selected cases. MR images of the brain and other cranial structures are clearer and more detailed than with other imaging methods. This detail makes MRI an invaluable tool in early diagnosis and evaluation of many conditions, ...

  18. Magnetic resonance imaging of infectious myositis

    Energy Technology Data Exchange (ETDEWEB)

    Yun, Ji Young; Kim, Jee Young; Kim, Sang Heum; Jung, Youn Ju; Cha, Eun Suk; Park, Joung Mi; Park, Young Ha [The Catholic Univ., College of Medicine, Suwon (Korea, Republic of)


    To describe the findings of magnetic resonance imaging in infectious myositis and to determine their value for differentiation between ruberculous and bacterial myositis. Magnetic resonance images of ten proven cases of infectious myositis (five tuberculous and five bacterial) were retrospectively reviewed in the light of clinical and laboratory findings. On the basis of magnetic resonance images, signal intensity of the mass, the presence or absence of an abscess, signal intensity of the peripheral wall, patterns of contrast enhancement, and associated findings were evaluated. Compared with those of bacterial myositis, the symptoms of tuberculous myositis lasted longer but there were no difinite local inflammatory signs. In three of five cases of bacterial myositis there were specific medical records;trauma in two cases and systemic lupus erythematosus in one. All tuberculous myositis cases involved a single muscle, but bacterial myositis affected multipe muscles in three cases(60%). All but one case showed a mass in the involved muscles. In one bacterial case, there was diffuse swelling in the involved muscle. On T1-weighted images, eight infectious cases showed low signal intensity;two, of the bactrerial type, showed subtle increased signal intensity. all cases demonstrated high signal intensity on t2-weighted images. The signal intensity of peripheral wall was slightly increased on T1-weighted images, but low on T2-weighted. In four cases there was associated cellulitis, and in one case each, adjacent joint effusion and deep vein thrombosis were seen. After gadolinium infusion, peripheral rim enhancement was noted in nine cases and heterogeneous enhancement in one. After magnetic resonance imaging of infectious myositis, the characteristic finding was an abscessed lesion, with the peripheral wall showing high signal intensity on T1-weighted images and low signal intensity on T2 weighted. Although we found it difficult to differentiate bacterial from tuberculous

  19. Magnetic resonance imaging of infectious myositis

    International Nuclear Information System (INIS)

    Yun, Ji Young; Kim, Jee Young; Kim, Sang Heum; Jung, Youn Ju; Cha, Eun Suk; Park, Joung Mi; Park, Young Ha


    To describe the findings of magnetic resonance imaging in infectious myositis and to determine their value for differentiation between ruberculous and bacterial myositis. Magnetic resonance images of ten proven cases of infectious myositis (five tuberculous and five bacterial) were retrospectively reviewed in the light of clinical and laboratory findings. On the basis of magnetic resonance images, signal intensity of the mass, the presence or absence of an abscess, signal intensity of the peripheral wall, patterns of contrast enhancement, and associated findings were evaluated. Compared with those of bacterial myositis, the symptoms of tuberculous myositis lasted longer but there were no difinite local inflammatory signs. In three of five cases of bacterial myositis there were specific medical records;trauma in two cases and systemic lupus erythematosus in one. All tuberculous myositis cases involved a single muscle, but bacterial myositis affected multipe muscles in three cases(60%). All but one case showed a mass in the involved muscles. In one bacterial case, there was diffuse swelling in the involved muscle. On T1-weighted images, eight infectious cases showed low signal intensity;two, of the bactrerial type, showed subtle increased signal intensity. all cases demonstrated high signal intensity on t2-weighted images. The signal intensity of peripheral wall was slightly increased on T1-weighted images, but low on T2-weighted. In four cases there was associated cellulitis, and in one case each, adjacent joint effusion and deep vein thrombosis were seen. After gadolinium infusion, peripheral rim enhancement was noted in nine cases and heterogeneous enhancement in one. After magnetic resonance imaging of infectious myositis, the characteristic finding was an abscessed lesion, with the peripheral wall showing high signal intensity on T1-weighted images and low signal intensity on T2 weighted. Although we found it difficult to differentiate bacterial from tuberculous

  20. Contemporary imaging: Magnetic resonance imaging, computed tomography, and interventional radiology

    International Nuclear Information System (INIS)

    Goldberg, H.I.; Higgins, C.; Ring, E.J.


    In addition to discussing the most recent advances in magnetic resonance imaging (MRI), computerized tomography (CT), and the vast array of interventional procedures, this book explores the appropriate clinical applications of each of these important modalities

  1. Structural magnetic resonance imaging in epilepsy

    International Nuclear Information System (INIS)

    Deblaere, Karel; Achten, Eric


    Because of its sensitivity and high tissue contrast, magnetic resonance imaging (MRI) is the technique of choice for structural imaging in epilepsy. In this review the effect of using optimised scanning protocols and the use of high field MR systems on detection sensitivity is discussed. Also, the clinical relevance of adequate imaging in patients with focal epilepsy is highlighted. The most frequently encountered MRI findings in epilepsy are reported and their imaging characteristics depicted. Imaging focus will be on the diagnosis of hippocampal sclerosis and malformations of cortical development, two major causes of medically intractable focal epilepsy. (orig.)

  2. Structural magnetic resonance imaging in epilepsy

    Energy Technology Data Exchange (ETDEWEB)

    Deblaere, Karel [Ghent University Hospital, Department of Neuroradiology, Ghent (Belgium); Ghent University Hospital, MR Department - 1K12, Ghent (Belgium); Achten, Eric [Ghent University Hospital, Department of Neuroradiology, Ghent (Belgium)


    Because of its sensitivity and high tissue contrast, magnetic resonance imaging (MRI) is the technique of choice for structural imaging in epilepsy. In this review the effect of using optimised scanning protocols and the use of high field MR systems on detection sensitivity is discussed. Also, the clinical relevance of adequate imaging in patients with focal epilepsy is highlighted. The most frequently encountered MRI findings in epilepsy are reported and their imaging characteristics depicted. Imaging focus will be on the diagnosis of hippocampal sclerosis and malformations of cortical development, two major causes of medically intractable focal epilepsy. (orig.)

  3. Nuclear magnetic resonance spectroscopy and imaging

    International Nuclear Information System (INIS)

    Jiang Weiping; Wang Qi; Zhou Xin


    This paper briefly introduces the basic principle of nuclear magnetic resonance (NMR). Protein's structures and functions and dynamics studied by liquid NMR are elaborated; methods for enhancing the resolution of solid state NMR and its applications are discussed; the principle of magnetic resonance imaging (MRI) is interpreted, and applications in different aspects are reviewed. Finally, the progress of NMR is commented. (authors)

  4. Clinical magnetic resonance: imaging and spectroscopy

    International Nuclear Information System (INIS)

    Andrew, E.R.; Bydder, Graeme; Griffiths, John; Iles, Richard; Styles, Peter


    This book begins with a readable, comprehensive but non-mathematical introduction to the basic underlying principles of magnetic resonance. Further chapters include information on the theory and principles of MRI and MRS, the interpretation of MR images, the clinical applications and scope of MRI and MRS, practical aspects of spectroscopy and magnetic resonance, and also the practical problems associated with the siting, safety and operation of large MRI and MRS equipment. (author)

  5. Magnetic resonance imaging of acoustic neurinomas

    International Nuclear Information System (INIS)

    Umezu, Hiromichi; Seki, Yojiro; Aiba, Tadashi; Takemori, Setsuko


    A restrospective review was made on magnetic resonance imaging (MRI) scans, preoperative neuro-otological findings, and surgical results for hearing preservation in 20 consecutive patients with histologically verified acoustic neurinomas. The maximum diameter of the tumor, both in the cerebellopontine angle (CPA) and internal auditory canal (IAC), were measured by MRI scans to classify tumor size. The signal intensity of acoustic neurinoma was equal to or lower than that of the adjacent pons on T 1 -weighted images and higher on T 2 -weighted images. After the administration of Gd-DTPA, tumors were markedly enhanced, which appeared homogeneous for small tumors and heterogeneous for large ones. There was no relationship between the degree of preoperative hearing loss and tumor size in either the CPA or the IAC. The larger the tumor in the CPA, however, the more often did the response to a caloric test disappear or decrease greatly. In contrast, there was no apparent correlation between the caloric response and tumor size in the IAC. Twelve patients (60%) had serviceable hearing (pure tone average loss 50%) preoperatively: the average tumor size in this group was similar to that in patients with poor or no hearing. These 12 patients were considered to be candidates for hearing preservation at surgery: 5 (41.7%) retained serviceable hearing postoperatively. A mean tumor size in the CPA was 11.8 mm for patients with postoperative serviceable hearing and 21.3 mm for those without it. Moreover, hearing was preserved postoperatively in all 4 patients with tumor less than 5 mm in the IAC. Thus, hearing preservation after surgery seemed to be closely related to tumor size. This study confirmed the value of MRI, providing information for the evaluation of hearing-preservation surgery. (N.K.)

  6. The use of FDG-PET/CT and diffusion-weighted magnetic resonance imaging for response prediction before, during and after preoperative chemoradiotherapy for rectal cancer

    International Nuclear Information System (INIS)

    Lambrecht, Maarten; Roels, Sarah; Haustermans, Karin; Deroose, Christophe; Vandecaveye, Vincent; Keyzer, Frederik de; Penninckx, Freddy; Sagaert, Xavier; Cutsem, Eric van


    Purpose. To investigate the use of FDG-PET/CT before, during and after chemoradiotherapy (CRT) and diffusion-weighted magnetic resonance imaging (DW-MRI) before CRT for the prediction of pathological response (pCR) in rectal cancer patients. Material and methods. Twenty-two rectal cancer patients treated with long course CRT were included. An FDG-PET/CT was performed prior to the start of CRT, after 10 to 12 fractions of CRT and five weeks after the end of CRT. The tumor was delineated using a gradient based delineation method and the maximal standardized uptake values (SUV max ) were calculated. A DW-MRI was performed before start of CRT. Mean apparent diffusion coefficients (ADC) were determined. The ΔSUV max during and after CRT and the initial ADC values were correlated to the histopathological findings after total mesorectal excision (TME). Results. ΔSUV max during and after CRT significantly correlated with the pathological response to treatment (during CRT: ΔSUV max = 59% ± 12% for pCR vs. 25% ± 27% if no pCR, p=0.0036; post-CRT: 90% ± 11 for pCR vs. 63% ± 22 if no pCR p=0.013). ROC curve analysis revealed an optimal threshold for ΔSUV max of 40% during CRT and 76% after CRT. The initial ADC value was also significantly correlated with pCR (0.94 ± 0.12 x 10-3 mm 2 /s for pCR vs. 1.2 ± 0.24 x 10-3 mm 2 /s, p=0.002) and ROC curve analysis revealed an optimal threshold of 1.06 x 10-3 mm 2 /s. Combining the provided ΔSUV max thresholds during and after CRT increased specificity of the prediction (sensitivity 100% and specificity 94%). The combination of the thresholds for the initial ADC value and the ΔSUV max during CRT increased specificity of the prediction to a similar level (sensitivity of 100% and specificity of 94%). Conclusions. The combination of the different time points and the different imaging modalities increased the specificity of the response assessment both during and after CRT.

  7. Magnetic resonance imaging of breast implants. (United States)

    Shah, Mala; Tanna, Neil; Margolies, Laurie


    Silicone breast implants have significantly evolved since their introduction half a century ago, yet implant rupture remains a common and expected complication, especially in patients with earlier-generation implants. Magnetic resonance imaging is the primary modality for assessing the integrity of silicone implants and has excellent sensitivity and specificity, and the Food and Drug Administration currently recommends periodic magnetic resonance imaging screening for silent silicone breast implant rupture. Familiarity with the types of silicone implants and potential complications is essential for the radiologist. Signs of intracapsular rupture include the noose, droplet, subcapsular line, and linguine signs. Signs of extracapsular rupture include herniation of silicone with a capsular defect and extruded silicone material. Specific sequences including water and silicone suppression are essential for distinguishing rupture from other pathologies and artifacts. Magnetic resonance imaging provides valuable information about the integrity of silicone implants and associated complications.

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI can detect stroke at a very early stage by mapping the motion of water molecules in ... is because traction devices and many types of life support equipment may distort the MR images and ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site ...

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam ... and treatments have special pediatric considerations. The teddy bear denotes child-specific content. Related Articles and Media ...

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam ... and treatments have special pediatric considerations. The teddy bear denotes child-specific content. Related Articles and Media ...

  12. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ... medical imaging or radiation oncology provider in your community, you can search the ACR-accredited facilities database . ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ... medical imaging or radiation oncology provider in your community, you can search the ACR-accredited facilities database . ...

  14. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... the exam. MRI scanners are air-conditioned and well-lit. Music may be played through the headphones ... full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... the exam. MRI scanners are air-conditioned and well-lit. Music may be played through the headphones ... full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings ... and send a signed report to your primary care or referring physician, who will share the results ...

  17. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings ... and send a signed report to your primary care or referring physician, who will share the results ...

  18. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... a risk, depending on their nature and the strength of the MRI magnet. Many implanted devices will ... full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy ...

  19. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... a risk, depending on their nature and the strength of the MRI magnet. Many implanted devices will ... full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy ...

  20. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... examination poses almost no risk to the average patient when appropriate safety guidelines are followed. If sedation is used, there ... patient story here Images × ... and Radiation Safety Videos related ...

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... tissue from which they come. The MR scanner captures this energy and creates a picture of the ... imaging based on the electrical activity of the heart, such as electrocardiography (EKG). MRI generally is not ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... it may cause some medical devices to malfunction. Most orthopedic implants pose no risk, but you should ... a digital cloud server. Currently, MRI is the most sensitive imaging test of the head (particularly the ...

  3. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... six weeks) before being safe for MRI examinations. Examples include but are not limited to: artificial heart ... electrocardiography (ECG). MRI typically costs more and may take more time to perform than other imaging modalities. ...

  4. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... to a CD or uploaded to a digital cloud server. top of page What are some common ... over time. top of page What are the benefits vs. risks? Benefits MRI is a noninvasive imaging ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... or patients with claustrophobia. Other MRI machines are open on the sides (open MRI). Open units are especially helpful for examining larger patients or those with claustrophobia. Newer open MRI units provide very high quality images for ...

  6. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... or patients with claustrophobia. Other MRI machines are open on the sides (open MRI). Open units are especially helpful for examining larger patients or those with claustrophobia. Newer open MRI units provide very high quality images for ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam is safe for patients with metal implants, except for a few types. ...

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam is safe for patients with metal implants, except for a few types. ...

  9. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... and may add approximately 15 minutes to the total exam time. top of page What will my ... are the limitations of Children’s (Pediatric) MRI? High-quality images are assured only if your child is ...

  10. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... and may add approximately 15 minutes to the total exam time. top of page What will I ... the limitations of MRI of the Head? High-quality images are assured only if you are able ...

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... distort images of the facial area or brain, so you should let the radiologist know about them. ... MRI units, called short-bore systems , are designed so that the magnet does not completely surround you. ...

  12. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... distort images of the facial area or brain, so the radiologist should be aware of them. Parents ... MRI units, called short-bore systems , are designed so that the magnet does not completely surround you. ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... wide range of conditions in children due to injury, illness or congenital abnormalities. When imaging of a child’s brain and spinal cord is needed, MRI is useful because of ...

  14. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... to a CD or uploaded to a digital cloud server. Currently, MRI is the most sensitive imaging ... community, you can search the ACR-accredited facilities database . This website does not provide cost information. The ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... experience some bruising. There is also a very small chance of skin irritation at the site of ... a result, must be kept away from the area to be imaged. Furthermore, the examination takes longer ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... experience some bruising. There is also a very small chance of irritation of your skin at the ... a result, must be kept away from the area to be imaged. Furthermore, the examination takes longer ...

  17. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam is safe for patients with metal implants, except for a ...

  18. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam is safe for patients with metal implants, except for a ...

  19. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... to cancer treatment MRI is often the best choice for imaging the joints and bones, where it ... regular daily routine and have him/her take food and medications as usual. Some MRI examinations may ...

  20. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... processes the imaging information is located in a separate room from the scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ...

  1. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... processes the imaging information is located in a separate room from the scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... images can then be examined on a computer monitor, transmitted electronically, printed or copied to a CD ... excessive sedation. However, the technologist or nurse will monitor your vital signs to minimize this risk. Although ...

  3. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... an MRI scan, but this is rare. Tooth fillings and braces usually are not affected by the magnetic field, but they may distort images of the facial area or brain, so you should let the ...

  4. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... lodged in the eyes are particularly important. Tooth fillings and braces usually are not affected by the magnetic field, but they may distort images of the facial area or brain, so the radiologist should be ...

  5. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings ... tomography (CT) scans, MRI does not utilize ionizing radiation. Instead, radiofrequency pulses re-align hydrogen atoms that ...

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings ... tomography (CT) scans, MRI does not utilize ionizing radiation. Instead, radiofrequency pulses re-align hydrogen atoms that ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... eating and drinking before your exam vary between facilities. Unless you are told otherwise, take your regular ... with the specific exam and with the imaging facility. Unless you are told otherwise, you may follow ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... a CD or uploaded to a digital cloud server. Currently, MRI is the most sensitive imaging test ... understanding of the possible charges you will incur. Web page review process: This Web page is reviewed ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... room. In addition to affecting the MRI images, these objects can become projectiles within the MRI scanner ... may cause you and/or others nearby harm. These items include: jewelry, watches, credit cards and hearing ...

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... range of conditions in children due to injury, illness or congenital abnormalities. When imaging of a child’s ... or other reactions. If your child experiences allergic symptoms, a radiologist or other physician will be available ...

  11. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... examinations may require your child to receive an injection of contrast material into the bloodstream. The radiologist , ... images will be taken during or following the injection. When the examination is complete, you and your ...

  12. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... be asked to maintain his/her position without movement as much as possible. In some cases, intravenous ... makes it difficult to obtain clear images. Patient movement can have the same effect. A very irregular ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... the exam room. These items include: jewelry, watches, credit cards and hearing aids, all of which can ... top of page What are the benefits vs. risks? Benefits MRI is a noninvasive imaging technique that ...

  14. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... others nearby harm. These items include: jewelry, watches, credit cards and hearing aids, all of which can ... top of page What are the benefits vs. risks? Benefits MRI is a noninvasive imaging technique that ...

  15. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... This website does not provide cost information. The costs for specific medical imaging tests, treatments and procedures may vary by geographic region. Discuss the fees associated with your prescribed procedure with your doctor, ...

  16. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... This website does not provide cost information. The costs for specific medical imaging tests, treatments and procedures may vary by geographic region. Discuss the fees associated with your prescribed procedure with your doctor, ...

  17. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... to produce detailed pictures of organs, soft tissues, bone and virtually all other internal body structures. MRI ... discovery of abnormalities that might be obscured by bone with other imaging methods. The contrast material used ...

  18. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... To locate a medical imaging or radiation oncology provider in your community, you can search the ACR- ... the medical facility staff and/or your insurance provider to get a better understanding of the possible ...

  19. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... contrast for an MRI. If you have a history of kidney disease or liver transplant, it will ... claustrophobia. Newer open MRI units provide very high quality images for many types of exams. Older open ...

  20. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... radiation oncology provider in your community, you can search the ACR-accredited facilities database . This website does not provide cost information. The costs for specific medical imaging tests, treatments ...

  1. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... radiation oncology provider in your community, you can search the ACR-accredited facilities database . This website does not provide cost information. The costs for specific medical imaging tests, treatments ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... top of page Additional Information and Resources : Radiation Therapy for Brain Tumors Radiation Therapy for ... Imaging (MRI) - Head Sponsored by Please note is not a medical facility. Please contact your ...

  3. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... range of conditions in children due to injury, illness or congenital abnormalities. When imaging of a child’s ... material may be performed. The intravenous needle may cause your child some discomfort when it is inserted ...

  4. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... with metal implants, except for a few types. People with the following implants cannot be scanned and ... it difficult to lie still during imaging. A person who is very large may not fit into ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... with metal implants, except for a few types. People with the following implants cannot be scanned and ... it difficult to lie still during imaging. A person who is very large may not fit into ...

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Magnetic ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... practice. top of page What are some common uses of the procedure? MR imaging of the head ... gadolinium contrast, it may still be possible to use it after appropriate pre-medication. Patient consent will ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... is done because a potential abnormality needs further evaluation with additional views or a special imaging technique. ... MRI an invaluable tool in early diagnosis and evaluation of many conditions, including tumors. MRI enables the ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... or headphones during the exam. MRI scanners are air-conditioned and well-lit. Music may be played ... the limitations of MRI of the Head? High-quality images are assured only if you are able ...

  10. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... type your comment or suggestion into the following text box: Comment: E-mail: Area code: Phone no: Thank ... View full size with caption Pediatric Content Some imaging tests ...

  11. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... type your comment or suggestion into the following text box: Comment: E-mail: Area code: Phone no: Thank ... View full size with caption Pediatric Content Some imaging tests ...

  12. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... to: artificial heart valves implanted drug infusion ports artificial limbs or metallic joint prostheses implanted nerve stimulators metal ... will analyze the images and send a signed report to your primary care or referring physician, who ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... wide range of conditions in children due to injury, illness or congenital abnormalities. When imaging of a child’s brain and spinal cord is needed, MRI is useful because of its ...

  14. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... confused or in severe pain, he/she may find it difficult to lie still during imaging. A ... 25, 2016 Send us your feedback Did you find the information you were looking for? Yes No ...

  15. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... determine the presence of certain diseases. The images can then be examined on a computer monitor, transmitted ... of abrupt onset or long-standing symptoms. It can help diagnose conditions such as: brain tumors stroke ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... for scanning patients since the 1980s with no reports of any ill effects on pregnant women or ... will analyze the images and send a signed report to your primary care or referring physician, who ...

  17. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... used in tattoos may contain iron and could heat up during an MRI scan, but this is ... imaging based on the electrical activity of the heart, such as electrocardiography (EKG). MRI generally is not ...

  18. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... used in tattoos may contain iron and could heat up during an MRI scan, but this is ... called MR angiography (MRA) provides detailed images of blood vessels in the brain—often without the need ...

  19. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... you should let the radiologist know about them. Parents or family members who accompany patients into the ... part of the body being imaged, send and receive radio waves, producing signals that are detected by ...

  20. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... On very rare occasions, a few patients experience side effects from the contrast material, including nausea, headache and ... structures of the brain and can also provide functional information (fMRI) in selected cases. MR images of ...

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... practice. top of page What are some common uses of the procedure? MR imaging of the head ... for immediate assistance. Manufacturers of intravenous contrast indicate mothers should not breastfeed their babies for 24-48 ...

  2. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... the area of your body being imaged to feel slightly warm, but if it bothers you, notify ... are being recorded because you will hear and feel loud tapping or thumping sounds when the coils ...

  3. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... area of your child’s body being imaged to feel slightly warm, but if your child is bothered ... being recorded because he/she will hear and feel loud tapping or thumping sounds when the coils ...

  4. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ... is because traction devices and many types of life support equipment may distort the MR images and ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ... is because traction devices and many types of life support equipment may distort the MR images and ...

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index ...

  7. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... images and send a signed report to your primary care or referring physician, who will share the ... Society of Urogenital Radiology note that the available data suggest that it is safe to continue breastfeeding ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... a computer to produce detailed pictures of the brain and other cranial structures that are clearer and ... sensitive imaging test of the head (particularly the brain) in routine clinical practice. top of page What ...

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... treatment for a variety of conditions within the brain, chest, abdomen, pelvis and extremities. Tell your doctor ... or congenital abnormalities. When imaging of a child’s brain and spinal cord is needed, MRI is useful ...

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Examples include but are not limited to: artificial heart valves implanted drug infusion ports artificial limbs or ... imaging based on the electrical activity of the heart, such as electrocardiography (EKG). MRI generally is not ...

  12. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... practice. top of page What are some common uses of the procedure? MR imaging of the head ... community, you can search the ACR-accredited facilities database . This website does not provide cost information. The ...

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI) procedure View full size with caption Pediatric Content Some imaging tests and treatments have special pediatric considerations. The teddy bear denotes child-specific content. Related Articles and Media MR Angiography (MRA) Magnetic ...

  14. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... after the exam. A few patients experience side effects from the contrast material, including nausea and local ... clear images. Patient movement can have the same effect. A very irregular heartbeat may affect the quality ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... in children due to injury, illness or congenital abnormalities. When imaging of a child’s brain and spinal ... to: detect a variety of brain conditions and abnormalities like cysts, tumors, bleeding, swelling, or problems with ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... structures of the brain and can also provide functional information (fMRI) in selected cases. MR images of the brain and other cranial structures are clearer and more detailed than with other ...

  17. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... no: Thank you! Do you have a personal story about radiology? Share your patient story here Images × ... Us | FAQ | Privacy | Terms of Use | Links | Site Map Copyright © 2018 Radiological Society of North America, Inc. ( ...

  18. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... no: Thank you! Do you have a personal story about radiology? Share your patient story here Images × ... Us | FAQ | Privacy | Terms of Use | Links | Site Map Copyright © 2018 Radiological Society of North America, Inc. ( ...

  19. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... top of page What are the benefits vs. risks? Benefits MRI is a noninvasive imaging technique that ... used for conventional x-rays and CT scanning. Risks The MRI examination poses almost no risk to ...

  20. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... top of page What are the benefits vs. risks? Benefits MRI is a noninvasive imaging technique that ... than 30 minutes from the onset of symptoms. Risks The MRI examination poses almost no risk to ...

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... produce detailed pictures of the brain and other cranial structures that are clearer and more detailed than ... cases. MR images of the brain and other cranial structures are clearer and more detailed than with ...

  2. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Open units are especially helpful for examining larger patients or those with claustrophobia. Newer open MRI units provide very high quality images for many types of exams; however, older ...

  3. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ... the same effect. A very irregular heartbeat may affect the quality of images obtained using techniques that ...

  4. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... scanner. top of page How does the procedure work? Unlike conventional x-ray examinations and computed tomography ( ... the same effect. A very irregular heartbeat may affect the quality of images obtained using techniques that ...

  5. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... tissue and fluid, known as edema . MRI typically costs more and may take more time to perform ... accredited facilities database . This website does not provide cost information. The costs for specific medical imaging tests, ...

  6. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... the heart, such as electrocardiography (ECG). MRI typically costs more and may take more time to perform ... accredited facilities database . This website does not provide cost information. The costs for specific medical imaging tests, ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... have a history of kidney disease or liver transplant, it will be necessary to perform a blood ... discovery of abnormalities that might be obscured by bone with other imaging methods. The contrast material used ...

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... other internal body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians ... computed tomography (CT) scans, MRI does not utilize ionizing radiation. Instead, radiofrequency pulses re-align hydrogen atoms ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Detailed MR images allow physicians to evaluate various parts of the body and determine the presence of ... Patients who might have metal objects in certain parts of their bodies may also require an x- ...

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... MRI. For more information, consult your radiologist. The computer workstation that processes the imaging information is located ... not come in contact with the patient. A computer then processes the signals and generates a series ...

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... MRI. For more information, consult your radiologist. The computer workstation that processes the imaging information is located ... not come in contact with the patient. A computer then processes the signals and generates a series ...

  12. Magnetic Resonance Imaging (MRI of Intratumoral Voxel Heterogeneity as a Potential Response Biomarker: Assessment in a HER2+ Esophageal Adenocarcinoma Xenograft Following Trastuzumab and/or Cisplatin Therapy

    Directory of Open Access Journals (Sweden)

    Connie Yip


    Full Text Available We evaluated magnetic resonance imaging (MRI voxel heterogeneity following trastuzumab and/or cisplatin in a HER2+ esophageal xenograft (OE19 as a potential response biomarker. OE19 xenografts treated with saline (controls, monotherapy, or combined cisplatin and trastuzumab underwent 9.4-T MRI. Tumor MRI parametric maps of T1 relaxation time (pre/post contrast, T2 relaxation time, T2* relaxation rate (R2*, and apparent diffusion coefficient obtained before (TIME0, after 24 hours (TIME1, and after 2 weeks of treatment (TIME2 were analyzed. Voxel histogram and fractal parameters (from the whole tumor, rim and center, and as a ratio of rim‐to‐center were derived. Tumors were stained for immunohistochemical markers of hypoxia (CA-IX, angiogenesis (CD34, and proliferation (Ki-67. Combination therapy reduced xenograft growth rate (relative change, ∆ +0.58 ± 0.43 versus controls, ∆ +4.1 ± 1.0; P = 0.008. More spatially homogeneous voxel distribution between the rim to center was noted after treatment for combination therapy versus controls, respectively, for contrast-enhanced T1 relaxation time (90th percentile: ratio 1.00 versus 0.88, P = 0.009, T2 relaxation time (mean: 1.00 versus 0.92, P = 0.006; median: 0.98 versus 0.91, P = 0.006; 75th percentile: 1.02 versus 0.94, P = 0.007, and R2* (10th percentile: 0.99 versus 1.26, P = 0.003. We found that combination and trastuzumab monotherapy reduced MRI spatial heterogeneity and growth rate compared to the control or cisplatin groups, the former providing adjunctive tumor response information.

  13. The Efficacy of Magnetic Resonance Imaging and X-Ray in the Evaluation of Response to Radiosynovectomy in Patients with Hemophilic Arthropathy

    Directory of Open Access Journals (Sweden)

    Tamer Özülker


    Full Text Available Objective: We aimed to assess the role of Magnetic Resonance Imaging (MRI and X-Ray in the evaluation of response to radiosynovectomy (RS in patients with hemophilic arthropathy. Material and Methods: Eleven patients who suffered from hemophilic arthropathy with a mean age of 11.7 (range between 7-15 were included in this study. 148-185 MBq Yttrium 90 silicate (Y-90 was administered intraarticularly to ten knee joints and one patient was treated with intraarticular 74 MBq Rhenium 186 (Re-186 injection into his ankle. Before radiosynovectomy, plain anteroposterior and lateral X-rays of the target joints were obtained by standard technique. The follow-up MRI and X-ray studies of the patients were done 6 months after RS. Pettersson hemophilic arthropathy scales were utilized to stage the condition of the joints on plain X-ray and classification of the investigated joints on MRI were done according to Denver score. The clinical assessment of the efficacy of the RS was made with the comparison of the average bleedings before and after the intervention. Results: During the 6-month follow-up period after RS, an improvement in number of hemarthrosis 75% or greater compared with the prior six months occurred in six joints (54.5%. The Pettersson scores worsened in 1/11 (9%, remained unchanged in 9/11 (81.8%, and improved in 1/11 (9% joints. At the 6-month follow-up, the MRI score worsened in one (9% and was unchanged in 10/11 joints (90.9%. Conclusion: MRI is a more sensitive tool than plain radiography for evaluating and follow-up of joint disease in persons with hemophilia, but both methods don’t show correlation with the therapeutic response. (MIRT 2011;20:38-44

  14. Magnetic resonance imaging at Rikshospitalet

    International Nuclear Information System (INIS)

    Smith, H.J.


    During the first 18 months of operations of the nuclear magnetic resonance (NMR) unit at Rikshospitalet, 1453 NMR examinations have been performed on 1431 patients. 64% of the time has been devoted to examinations of the central nervous system and spine in children and adults, 9% of the time has been used on non-neuroradiology pediatric patients, while the rest of the time has been spent equally on ear, nose and throat, thoracic (including cardiac) and abdominal examinations in adult patients. The indications for doing NMR at Rikshospitalet are listed and discussed, and it is concluded that NMR has proved to be useful at several conditions in most organ systems. 15 refs

  15. Does magnetic resonance imaging predict future low back pain?

    DEFF Research Database (Denmark)

    Steffens, D; Hancock, M J; Maher, C G


    Magnetic resonance imaging (MRI) has the potential to identify pathology responsible for low back pain (LBP). However, the importance of findings on MRI remains controversial. We aimed to systematically review whether MRI findings of the lumbar spine predict future LBP in different samples...

  16. Magnetic resonance imaging of popliteal artery pathologies

    International Nuclear Information System (INIS)

    Holden, Andrew; Merrilees, Stephen; Mitchell, Nicola; Hill, Andrew


    This paper illustrates examples of popliteal artery pathologies imaged with contrast enhanced magnetic resonance angiography (CE-MRA) and magnetic resonance imaging (MRI) at a single tertiary referral centre. Popliteal artery pathologies were identified in 1710 patients referred over a 6-year period with symptoms suggesting lower limb arterial occlusive disease. Common pathologies such as atherosclerotic occlusive disease, thromboemboli and aneurysm disease are discussed as well as unusual pathologies such as cystic adventitial disease, mycotic aneurysm and arterial entrapment. The combination of CE-MRA and the excellent soft tissue resolution of MRI allow detailed evaluation of arterial and peri-arterial pathologies, and facilitate appropriate management decisions

  17. Magnetic resonance imaging of popliteal artery pathologies

    Energy Technology Data Exchange (ETDEWEB)

    Holden, Andrew [Department of Radiology, Auckland City Hospital, Park Road, Grafton, Auckland 9 (New Zealand)], E-mail:; Merrilees, Stephen [Department of Radiology, Auckland City Hospital, Park Road, Grafton, Auckland 9 (New Zealand)], E-mail:; Mitchell, Nicola [Department of Radiology, Auckland City Hospital, Park Road, Grafton, Auckland 9 (New Zealand)], E-mail:; Hill, Andrew [Department of Vascular Surgery, Auckland City Hospital, Park Road, Grafton, Auckland 9 (New Zealand)], E-mail:


    This paper illustrates examples of popliteal artery pathologies imaged with contrast enhanced magnetic resonance angiography (CE-MRA) and magnetic resonance imaging (MRI) at a single tertiary referral centre. Popliteal artery pathologies were identified in 1710 patients referred over a 6-year period with symptoms suggesting lower limb arterial occlusive disease. Common pathologies such as atherosclerotic occlusive disease, thromboemboli and aneurysm disease are discussed as well as unusual pathologies such as cystic adventitial disease, mycotic aneurysm and arterial entrapment. The combination of CE-MRA and the excellent soft tissue resolution of MRI allow detailed evaluation of arterial and peri-arterial pathologies, and facilitate appropriate management decisions.

  18. Musculoskeletal applications of magnetic resonance imaging: Council on Scientific Affairs

    International Nuclear Information System (INIS)

    Harms, S.E.; Fisher, C.F.; Fulmer, J.M.


    Magnetic resonance imaging provides superior contrast, resolution, and multiplanar imaging capability, allowing excellent definition of soft-tissue and bone marrow abnormalities. For these reasons, magnetic resonance imaging has become a major diagnostic imaging method for the evaluation of many musculoskeletal disorders. The applications of magnetic resonance imaging for musculoskeletal diagnosis are summarized and examples of common clinical situations are given. General guidelines are suggested for the musculoskeletal applications of magnetic resonance imaging

  19. Magnetic resonance imaging in Mexico (United States)

    Rodriguez, A. O.; Rojas, R.; Barrios, F. A.


    MR imaging has experienced an important growth worldwide and in particular in the USA and Japan. This imaging technique has also shown an important rise in the number of MR imagers in Mexico. However, the development of MRI has followed a typical way of Latin American countries, which is very different from the path shown in the industrialised countries. Despite the fact that Mexico was one the very first countries to install and operate MR imagers in the world, it still lacks of qualified clinical and technical personnel. Since the first MR scanner started to operate, the number of units has grown at a moderate space that now sums up approximately 60 system installed nationwide. Nevertheless, there are no official records of the number of MR units operating, physicians and technicians involved in this imaging modality. The MRI market is dominated by two important companies: General Electric (approximately 51%) and Siemens (approximately 17.5%), the rest is shared by other five companies. According to the field intensity, medium-field systems (0.5 Tesla) represent 60% while a further 35% are 1.0 T or higher. Almost all of these units are in private hospitals and clinics: there is no high-field MR imagers in any public hospital. Because the political changes in the country, a new public plan for health care is still in the process and will be published soon this year. This plan will be determined by the new Congress. North American Free Trade Agreement (NAFTA) and president Fox. Experience acquired in the past shows that the demand for qualified professionals will grow in the new future. Therefore, systematic training of clinical and technical professionals will be in high demand to meet the needs of this technique. The National University (UNAM) and the Metropolitan University (UAM-Iztapalapa) are collaborating with diverse clinical groups in private facilities to create a systematic training program and carry out research and development in MRI

  20. Magnetic resonance imaging in otolaryngology

    International Nuclear Information System (INIS)

    Gradzki, J.; Paprzycki, W.


    In the paper authors describe fundamental physical properties of a phenomenon of the radio-frequency excitation and relaxation of nuclei ordered in a strong magnetic field and the usefulness of MRI in medical diagnostic procedures. Basic interpretations principles of MR imaging due to signal intensity differences between organs and tissues in T 1 - and T 2 - weighted sequences and proton density are presented. Both, literature review and experience of authors suggest application of MRI in otolaryngology, it is illustrated by a lot of examples. The MR imaging studies were compared with results obtained from CT in otolaryngology field. (author)

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... types of clips used for brain aneurysms some types of metal coils placed within blood vessels nearly all cardiac defibrillators and pacemakers You ... called MR angiography (MRA) provides detailed images of blood vessels in the ... the opening of certain types of MRI machines. The presence of an implant ...

  2. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... the specific exam and also with the imaging facility. Unless you are told otherwise, follow your child’s ... Please note is not a medical facility. Please contact your physician with specific medical questions ...

  3. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... range of conditions in children due to injury, illness or congenital abnormalities. When imaging of a child’s ... after trauma diagnose and monitor infectious or inflammatory ... (fear of enclosed spaces) or anxiety, you may want to talk to your pediatrician ...

  4. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... radiology examinations, will analyze the images and send a signed report to your primary care or referring physician, who will share the results with you. Follow-up examinations may be necessary. Your doctor will ... exam is requested. Sometimes a follow-up exam is done because a potential ...

  5. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... radiology examinations, will analyze the images and send a signed report to your primary care or referring physician, who will share the results with you. Follow-up examinations may be necessary, and your doctor will ... exam is needed. Sometimes a follow-up exam is done because a suspicious ...

  6. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... provides detailed images of blood vessels in the brain—often without the need for contrast material. See the MRA page for more information. MRI can detect stroke at a very early stage by mapping the motion of water molecules in the tissue. ...

  7. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... weakness, blurry vision or seizures help detect certain chronic diseases of the nervous system, such as multiple ... There is also a very small chance of skin irritation at the site of the IV tube ... characterize diseases than other imaging methods. This detail makes MRI ...

  8. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... epilepsy (seizure) hemorrhage in selected trauma patients certain chronic conditions, such as multiple sclerosis disorders of the ... a very small chance of irritation of your skin at the site of the IV tube insertion. Some ... Images related to Magnetic ...

  9. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... internal body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians to evaluate various ... kind, such as an allergy to iodine or x-ray contrast material, drugs, food, or the environment, or ...

  10. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... internal body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians to evaluate various ... kind, such as an allergy to iodine or x-ray contrast material, drugs, food, or the environment, or ...

  11. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... very early stage by mapping the motion of water molecules in the tissue. This water motion, known as diffusion, is impaired by most ... the limitations of MRI of the Head? High-quality images are assured only if you are able ...

  12. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... fitting and has no metal fasteners. Guidelines about eating and drinking before an MRI exam vary with the specific exam and with the imaging facility. Unless you are told otherwise, you may follow your regular daily routine and take food and medications as usual. Some MRI examinations may ...

  13. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... or headphones during the exam. MRI scanners are air-conditioned and well-lit. Music may be played ... are the limitations of Children’s (Pediatric) MRI? High-quality images are assured only if your child is ...

  14. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Children’s (Pediatric) Magnetic ... patient to have an allergy to a gadolinium-based contrast agent used for MRI than the iodine- ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... illness or congenital abnormalities. When imaging of a child’s brain and spinal cord is needed, MRI is useful because of its ability to see through the skull and the bones of the skull and spine without radiation. MRI of the brain and spine ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam is safe for patients with metal implants, except for a few types. People with the ...

  17. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... metallic items, which can distort MRI images removable dental work pens, pocket knives and eyeglasses body piercings In most cases, an MRI exam is safe for patients with metal implants, except for a few types. People with the ...

  18. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... might be obscured by bone with other imaging methods. The contrast material used in MRI exams is less likely to produce an allergic reaction than the iodine-based contrast materials used for conventional x-rays and CT scanning. Risks The MRI examination poses almost no risk to ...

  19. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... they may move during the scan, possibly causing blindness. Dyes used in tattoos may contain iron and ...

  20. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians to evaluate various ... kind, such as an allergy to iodine or x-ray contrast material, drugs, food, or the environment, or ...

  1. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians to evaluate various ... kind, such as an allergy to iodine or x-ray contrast material, drugs, food, or the environment, or ...

  2. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... abnormalities. When imaging of a child’s brain and spinal cord is needed, MRI is useful because of its ... determine the condition of nerve tissue within the spinal cord In the heart, MRI is often used in ...

  3. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... MRI equipment look like? How does the procedure work? How is the ... use to diagnose medical conditions. MRI uses a powerful magnetic field, radio frequency ...

  4. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... the equipment look like? How does the procedure work? How is the ... use to diagnose medical conditions. MRI uses a powerful magnetic field, radio frequency ...

  5. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... other internal body structures. MRI does not use ionizing radiation (x-rays). Detailed MR images allow physicians to ... computed tomography (CT) scans, MRI does not utilize ionizing radiation. Instead, radiofrequency pulses re-align hydrogen atoms that ...

  6. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... prior to sedation and the examination. For the safety of your child during the sedation, it is ...

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... absolutely necessary for medical treatment. See the MRI Safety page for more information about pregnancy and MRI. ...

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... bloodstream. The radiologist , technologist or a nurse may ask if your child has allergies of any kind, such as an allergy to iodine or x- ... facility. Please contact your physician with specific medical questions or for a ... imaging tests, treatments and procedures may vary by geographic region. ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... the head uses a powerful magnetic field, radio waves and a computer to produce detailed pictures of the brain and other cranial structures that are clearer and more detailed than other imaging methods. This exam does not use ionizing radiation and may require an injection of a ...

  10. Magnetic resonance imaging in multiple sclerosis

    International Nuclear Information System (INIS)

    Kojima, Shigeyuki; Hirayama, Keizo


    Magnetic resonance imaging (MRI) of the brain was performed in a total of 45 patients with multiple sclerosis (MS), comprising 27 with brain symptoms and 18 without it. The results were compared with X-ray computed tomography (CT). Some of the 45 MS patients were also examined by neurophysiological studies for comparison. MRI showed demyelinating plaques of the brain in a total of 31 patients (69%) - 20 symptomatic and 11 asymptomatic patients. For symptomatic patients, MRI was capable of detecting brain lesions in 6 (86%) of 7 acute stage patients and 14 (70%) of 20 non-acute stage patients. It was also capable of detecting brain lesions in 21 (70%) of 30 clinically definite MR patients and 10 (67%) of 15 clinically probable MS patients. Concurrently available X-ray CT revealed brain lesions in 9 symptomatic patients (33%) and one asymptomatic patient (6%). Visual evoked potentials examined in 31 patients showed abnormality in one (11%) of 9 patients without symptoms of optic neuritis and all (100%) of the other 22 patients with symptoms. In 19 evaluable patients, auditory brainstem responses were abnormal in one (11%) of 9 patients without brainstem symptoms and 3 (30%) of 10 patients with symptoms. MRI of the brain was far superior to X-ray CT, visual evoked potentials and auditory brainstem responses in detecting clinically unsuspected lesions. We proposed new diagnostic criteria including MRI findings of the brain in the Japanese MS diagnostic criteria. MRI of the spinal cord was performed in 12 MS patients with spinal cord symptoms by sagittal and coronal images. It demonstrated demyelinating lesions within the cervical and superior thoracic cord in 8 MS acute stage patients. Spinal cord lesions were longitudinally continuous as long as many spinal segments, with swelling in 6 patients and atrophy in 2 patients. MRI of spinal cord was useful in deciding superior and inferior limits of cord lesions and in visualizing cord swelling or atrophy. (Namekawa, K)

  11. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... and pelvic region, MRI is used to: diagnose causes of pain evaluate for injury after trauma diagnose and monitor infectious or inflammatory disorders monitor response to cancer treatment MRI is often the best choice for ...

  12. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... monitor infectious or inflammatory disorders monitor response to cancer treatment MRI is often the best choice for ... diagnose developmental joint abnormalities in children detect bone cancer inspect the marrow for leukemia and other diseases ...

  13. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... not responsible for the content contained on the web pages found at these links. About ... Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  14. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... not responsible for the content contained on the web pages found at these links. About ... Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  15. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... are not responsible for the content contained on the web pages found at these links. ... Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  16. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... are not responsible for the content contained on the web pages found at these links. ... Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  17. Magnetic resonance spectroscopy as an imaging method

    International Nuclear Information System (INIS)

    Bomsdorf, H.; Imme, M.; Jensen, D.; Kunz, D.; Menhardt, W.; Ottenberg, K.; Roeschmann, P.; Schmidt, K.H.; Tschendel, O.; Wieland, J.


    An experimental Magnetic Resonance (MR) system with 4 tesla flux density was set up. For that purpose a data acquisition system and RF coils for resonance frequencies up to 170 MHz were developed. Methods for image guided spectroscopy as well as spectroscopic imaging focussing on the nuclei 1 H and 13 C were developed and tested on volunteers and selected patients. The advantages of the high field strength with respect to spectroscopic studies were demonstrated. Developments of a new fast imaging technique for the acquisition of scout images as well as a method for mapping and displaying the magnetic field inhomogeneity in-vivo represent contributions to the optimisation of the experimental procedure in spectroscopic studies. Investigations on the interaction of RF radiation with the exposed tissue allowed conclusions regarding the applicability of MR methods at high field strengths. Methods for display and processing of multi-dimensional spectroscopic imaging data sets were developed and existing methods for real-time image synthesis were extended. Results achieved in the field of computer aided analysis of MR images comprised new techniques for image background detection, contour detection and automatic image interpretation as well as knowledge bases for textural representation of medical knowledge for diagnosis. (orig.) With 82 refs., 3 tabs., 75 figs [de

  18. Evaluation of treatment response to enzyme replacement therapy with Velaglucerase alfa in patients with Gaucher disease using whole-body magnetic resonance imaging. (United States)

    Laudemann, K; Moos, L; Mengel, E; Lollert, A; Hoffmann, C; Brixius-Huth, M; Wagner, D; Düber, C; Staatz, G


    This was a retrospective data analysis to evaluate the treatment response to enzyme replacement therapy (ERT) with Velaglucerase alfa using whole-body magnetic resonance imaging (MRI). A baseline and follow-up MRI were performed on 18 Gaucher Type 1 patients at an interval of 11.6 months. The MRI score systems determined the Bone-Marrow-Burden (BMB) score, the Düsseldorf-Gaucher score (DGS), and the Vertebra-Disc-Ratio (VDR). The Severity Score Index Type 1 (GD-DS3) was also assessed. The baseline MRI medians were: BMB, 7.00; DGS, 3.00; and VDR: 1.70; while, the follow-up MRI medians were: BMB, 7.00; DGS, 3.00; and VDR: 1.73. The baseline GD-DS3 median was 2.40 (BMB excl.: 0.50) and the follow-up median was 2.00 (BMB excl.: 0.50). There was weak statistical significance with the Wilcoxon signed-rank test for the DGS (p=0.034) and GD-DS3 (p=0.047) between both MRIs. Velaglucerase alfa therapy is a effective long-term treatment for Gaucher Type 1 patients who are newly diagnosed or switching therapies. Measurements with whole-body MRI and an objective scoring system were reliable tools for detecting early stage bone marrow activity. Further research is needed to evaluate the "Booster-Effect" of Velaglucerase alfa therapy in Gaucher skeletal disease. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Reducing Field Distortion in Magnetic Resonance Imaging (United States)

    Eom, Byeong Ho; Penanen, Konstantin; Hahn, Inseob


    A concept for a magnetic resonance imaging (MRI) system that would utilize a relatively weak magnetic field provides for several design features that differ significantly from the corresponding features of conventional MRI systems. Notable among these features are a magnetic-field configuration that reduces (relative to the conventional configuration) distortion and blurring of the image, the use of a superconducting quantum interference device (SQUID) magnetometer as the detector, and an imaging procedure suited for the unconventional field configuration and sensor. In a typical application of MRI, a radio-frequency pulse is used to excite precession of the magnetic moments of protons in an applied magnetic field, and the decaying precession is detected for a short time following the pulse. The precession occurs at a resonance frequency proportional to the strengths of the magnetic field and the proton magnetic moment. The magnetic field is configured to vary with position in a known way; hence, by virtue of the aforesaid proportionality, the resonance frequency varies with position in a known way. In other words, position is encoded as resonance frequency. MRI using magnetic fields weaker than those of conventional MRI offers several advantages, including cheaper and smaller equipment, greater compatibility with metallic objects, and higher image quality because of low susceptibility distortion and enhanced spin-lattice-relaxation- time contrast. SQUID MRI is being developed into a practical MRI method for applied magnetic flux densities of the order of only 100 T

  20. Cryogenic Preamplifiers for Magnetic Resonance Imaging

    DEFF Research Database (Denmark)

    Johansen, Daniel H.; Sanchez-Heredia, Juan D.; Petersen, Jan R.


    Pursuing the ultimate limit of detection in magnetic resonance imaging (MRI) requires cryogenics to decrease the thermal noise of the electronic circuits. As cryogenic coils for MRI are slowly emerging cryogenic preamplifiers are required to fully exploit their potential. A cryogenic preamplifier...

  1. Magnetic resonance imaging of xanthomatous meningioma

    International Nuclear Information System (INIS)

    Katayama, Y.; Tsubokawa, T.; Tanaka, A.; Koshinaga, M.; Nemoto, N.


    A case of meningioma with extensive xanthomatous metaplasia occurring in the left frontal convexity of a 37-year-old woman is reported. The tumour was demonstrated as a hypodense mass with minimal enhancement on CT. Our findings suggest that magnetic resonance imaging may provide a clue to the diagnosis of meningiomas with extensive xanthomatous metaplasia when CT is less specific. (orig.)

  2. Intralabyrinthine schwannoma shown by magnetic resonance imaging

    International Nuclear Information System (INIS)

    Saeed, S.R.; Birzgalis, A.R.; Ramsden, R.T.


    Intralabyrinthine schwannomas are rare benign tumours which present with progressive or fluctuant audiovestibular symptoms and may mimic Menieres disease. The size and position of these lesions make preoperative diagnosis unusual and most are discovered incidentally at labyrinthectomy. A case is reported which was diagnosed on magnetic resonance imaging and confirmed at surgery. (orig.)

  3. Topical questions in magnetic resonance imaging

    International Nuclear Information System (INIS)

    Andrew, E.R.; Florida Univ., Gainesville, FL; Florida Univ., Gainesville, FL


    This paper examines a number of practical questions concerning magnetic resonance imaging. These include the choice of operating magnetic field strength, the problem of siting and screening, a procedure for securing precise slice selection and the use of paramagnetic contrast agents. (author). 5 refs

  4. Magnetic resonance imaging of uveitis

    International Nuclear Information System (INIS)

    Li, Charles Q.; Mafee, Mahmood F.; Cho, Aaron A.; Edward, Neeraj J.; Edward, Deepak P.; Fajardo, Roman G.


    Uveitis is a term used to describe inflammation of the choroid, iris, or ciliary body, which make up the uveal tract. It can be idiopathic or associated with a systemic disease which may be infectious or noninfectious. With the exception of B-scan ultrasonography, current imaging methods for diagnosing and monitoring uveitis are predominately non-radiologic. Although MRI has been anecdotally shown to detect various inflammatory conditions of the globe, such as posterior scleritis, endophthalmitis, and posterior uveitis secondary to Vogt-Koyanagi-Harada disease, a more comprehensive review of the MRI findings in uveitis of various etiologies is presented here. The MRI and CT studies of seven patients with uveitis and the clinical history of three of them (not available in four patients) were reviewed. Etiologies included ankylosing spondylitis, relapsing polychondritis, Vogt-Koyanagi-Harada disease, sarcoidosis, and tuberculosis. Increased gadolinium enhancement of the uveal tract, which is visualized as the enhancing layer immediately deep to the low-signal sclera, was seen on all six MRI studies. Diffusion-weighted imaging of a case with posterior uveitis and subretinal effusions revealed restriction within the uvea and effusions. Two patients had inflammatory nodules adherent to the uvea, two patients had vitreous humor abnormalities, and one patient exhibited proximal perineural and perimuscular spread of enhancement. Uveoscleral thickening and enhancement with a posterior calcification were observed in the patient with chronic uveitis imaged with CT. Increased uveal tract enhancement is a common finding in patients with uveitis, regardless of anatomic distribution and etiology. MRI can also further evaluate complications of uveitis and help differentiate it from masquerade syndromes. (orig.)

  5. Magnetic resonance imaging of uveitis

    Energy Technology Data Exchange (ETDEWEB)

    Li, Charles Q.; Mafee, Mahmood F. [University of California, San Diego, Department of Radiology, San Diego, CA (United States); Cho, Aaron A. [Naval Medical Center, San Diego, CA (United States); Edward, Neeraj J. [University of Cincinnati, Department of Anesthesiology, Cincinnati, OH (United States); Edward, Deepak P. [King Khaled Eye Specialist Hospital, Riyadh (Saudi Arabia); Wilmer Eye Institute, Johns Hopkins Hospital, Baltimore, MD (United States); Fajardo, Roman G. [University of California, San Diego, Shiley Eye Center, La Jolla, CA (United States)


    Uveitis is a term used to describe inflammation of the choroid, iris, or ciliary body, which make up the uveal tract. It can be idiopathic or associated with a systemic disease which may be infectious or noninfectious. With the exception of B-scan ultrasonography, current imaging methods for diagnosing and monitoring uveitis are predominately non-radiologic. Although MRI has been anecdotally shown to detect various inflammatory conditions of the globe, such as posterior scleritis, endophthalmitis, and posterior uveitis secondary to Vogt-Koyanagi-Harada disease, a more comprehensive review of the MRI findings in uveitis of various etiologies is presented here. The MRI and CT studies of seven patients with uveitis and the clinical history of three of them (not available in four patients) were reviewed. Etiologies included ankylosing spondylitis, relapsing polychondritis, Vogt-Koyanagi-Harada disease, sarcoidosis, and tuberculosis. Increased gadolinium enhancement of the uveal tract, which is visualized as the enhancing layer immediately deep to the low-signal sclera, was seen on all six MRI studies. Diffusion-weighted imaging of a case with posterior uveitis and subretinal effusions revealed restriction within the uvea and effusions. Two patients had inflammatory nodules adherent to the uvea, two patients had vitreous humor abnormalities, and one patient exhibited proximal perineural and perimuscular spread of enhancement. Uveoscleral thickening and enhancement with a posterior calcification were observed in the patient with chronic uveitis imaged with CT. Increased uveal tract enhancement is a common finding in patients with uveitis, regardless of anatomic distribution and etiology. MRI can also further evaluate complications of uveitis and help differentiate it from masquerade syndromes. (orig.)

  6. Magnetic resonance imaging of the central nervous system

    International Nuclear Information System (INIS)

    Brant-Zawadzki, M.; Norman, D.


    This book presents the papers on technological advancement and diagnostic uses g magnetic resonance imaging. A comparative evaluation with computerized tomography is presented. Topics covered are imaging principles g magnetic resonance;instrumentation of magnetic resonance (MR);pathophysiology;quality and limitations g images;NMR imaging of brain and spinal cord;MR spectroscopy and its applications;neuroanatomy;Congenital malformations of brain and MR imaging;planning g MR imaging of spine and head and neck imaging

  7. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... understanding of the possible charges you will incur. Web page review process: This Web page is reviewed regularly by a physician with ... not responsible for the content contained on the web pages found at these links. About Us | Contact ...

  8. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... understanding of the possible charges you will incur. Web page review process: This Web page is reviewed regularly by a physician with ... not responsible for the content contained on the web pages found at these links. About Us | Contact ...

  9. Magnetic Resonance Imaging (MRI) -- Head

    Medline Plus

    Full Text Available ... understanding of the possible charges you will incur. Web page review process: This Web page is reviewed regularly by a physician with expertise ... not responsible for the content contained on the web pages found at these links. About Us | Contact Us | ...

  10. Children's (Pediatric) Magnetic Resonance Imaging

    Medline Plus

    Full Text Available ... understanding of the possible charges you will incur. Web page review process: This Web page is reviewed regularly by a physician with expertise ... not responsible for the content contained on the web pages found at these links. About Us | Contact Us | ...

  11. [Surface coils for magnetic-resonance images]. (United States)

    Rodríguez-González, Alfredo Odón; Amador-Baheza, Ricardo; Rojas-Jasso, Rafael; Barrios-Alvarez, Fernando Alejandro


    Since the introduction of magnetic resonance imaging in Mexico, the development of this important medical imaging technology has been almost non-existing in our country. The very first surface coil prototypes for clinical applications in magnetic resonance imaging has been developed at the Center of Research in Medical Imaging and Instrumentation of the Universidad Autónoma Metropolitana Iztapalapa (Metropolitan Autonomous University, Campus Iztapalapa). Two surface coil prototypes were built: a) a circular-shaped coil and b) a square-shaped coil for multiple regions of the body, such as heart, brain, knee, hands, and ankles. These coils were tested on the 1.5T imager of the ABC Hospital-Tacubaya, located in Mexico City. Brain images of healthy volunteers were obtained in different orientations: sagittal, coronal, and axial. Since images showed a good-enough clinical quality for diagnosis, it is fair to say that these coil prototypes can be used in the clinical environment, and with small modifications, they can be made compatible with almost any commercial scanner. This type of development can offer new alternatives for further collaboration between the research centers and the radiology community, in the search of new applications and developments of this imaging technique.

  12. Nuclear magnetic resonance imaging of the thorax

    International Nuclear Information System (INIS)

    Gamsu, G.; Webb, W.R.; Sheldon, P.; Kaufman, L.; Crooks, L.E.; Birnberg, F.A.; Goodman, P.; Hinchcliffe, W.A.; Hedgecock, M.


    Nuclear magnetic resonance (NMR) images of the thorax were obtained in ten normal volunteers, nine patients with advanced bronchogenic carcinoma, and three patients with benign thoracic abnormalities. In normal volunteers, mediastinal and hilar structures were seen with equal frequency on NMR images and computed tomographic scans. The hila were especially well displayed on spin-echo images. Spin-echo images showed mediastinal invasion by tumor, vascular and bronchial compression and invasion, and hilar and mediastinal adenopathy. Tumor and benign abnormalities could be separated from mediastinal and hilar fat because of their longer T1 times. Lung masses and nodules as small as 1.5 cm could be seen on the spin-echo images. NMR imaging shows promise for assessment of benign and malignant mediastinal, hilar, and lung abnormalities

  13. Magnetic resonance imaging of intervertebral disc degeneration

    International Nuclear Information System (INIS)

    Maeda, Hiroshi; Noguchi, Masao; Kira, Hideaki; Fujiki, Hiroshi; Shimokawa, Isao; Hinoue, Kaichi.


    The aim of this study was to correlate the degree of lumbar intervertebral disc degeneration with findings of magnetic resonance imaging (MRI). Seventeen autopsied (from 7 patients) and 21 surgical (from 20 patients) intervertebral discs were used as specimens for histopathological examination. In addition, 21 intervertebral discs were examined on T2-weighted images. Histopathological findings from both autopsied and surgical specimens were well correlated with MRI findings. In particular, T2-weighted images reflected increased collagen fibers and rupture within the fibrous ring accurately. However, when severely degenerated intervertebral discs and hernia protruding the posterior longitudinal ligament existed, histological findings were not concordant well with T2-weighted images. Morphological appearances of autopsy specimens, divided into four on T2-weighted images, were well consistent with histological degeneration. This morphological classification, as shown on T2-weighted images, could also be used in the evaluation of intervertebral disc degeneration. (N.K.)

  14. Magnetic resonance imaging of intervertebral disc degeneration

    Energy Technology Data Exchange (ETDEWEB)

    Maeda, Hiroshi; Noguchi, Masao (Kitakyushu City Yahata Hospital, Fukuoka (Japan)); Kira, Hideaki; Fujiki, Hiroshi; Shimokawa, Isao; Hinoue, Kaichi


    The aim of this study was to correlate the degree of lumbar intervertebral disc degeneration with findings of magnetic resonance imaging (MRI). Seventeen autopsied (from 7 patients) and 21 surgical (from 20 patients) intervertebral discs were used as specimens for histopathological examination. In addition, 21 intervertebral discs were examined on T2-weighted images. Histopathological findings from both autopsied and surgical specimens were well correlated with MRI findings. In particular, T2-weighted images reflected increased collagen fibers and rupture within the fibrous ring accurately. However, when severely degenerated intervertebral discs and hernia protruding the posterior longitudinal ligament existed, histological findings were not concordant well with T2-weighted images. Morphological appearances of autopsy specimens, divided into four on T2-weighted images, were well consistent with histological degeneration. This morphological classification, as shown on T2-weighted images, could also be used in the evaluation of intervertebral disc degeneration. (N.K.).

  15. Neural network segmentation of magnetic resonance images

    International Nuclear Information System (INIS)

    Frederick, B.


    Neural networks are well adapted to the task of grouping input patterns into subsets which share some similarity. Moreover, once trained, they can generalize their classification rules to classify new data sets. Sets of pixel intensities from magnetic resonance (MR) images provide a natural input to a neural network; by varying imaging parameters, MR images can reflect various independent physical parameters of tissues in their pixel intensities. A neural net can then be trained to classify physically similar tissue types based on sets of pixel intensities resulting from different imaging studies on the same subject. This paper reports that a neural network classifier for image segmentation was implanted on a Sun 4/60, and was tested on the task of classifying tissues of canine head MR images. Four images of a transaxial slice with different imaging sequences were taken as input to the network (three spin-echo images and an inversion recovery image). The training set consisted of 691 representative samples of gray matter, white matter, cerebrospinal fluid, bone, and muscle preclassified by a neuroscientist. The network was trained using a fast backpropagation algorithm to derive the decision criteria to classify any location in the image by its pixel intensities, and the image was subsequently segmented by the classifier

  16. Resonance Energy Transfer Molecular Imaging Application in Biomedicine

    Directory of Open Access Journals (Sweden)

    NIE Da-hong1,2;TANG Gang-hua1,3


    Full Text Available Resonance energy transfer molecular imaging (RETI can markedly improve signal intensity and tissue penetrating capacity of optical imaging, and have huge potential application in the deep-tissue optical imaging in vivo. Resonance energy transfer (RET is an energy transition from the donor to an acceptor that is in close proximity, including non-radiative resonance energy transfer and radiative resonance energy transfer. RETI is an optical imaging technology that is based on RET. RETI mainly contains fluorescence resonance energy transfer imaging (FRETI, bioluminescence resonance energy transfer imaging (BRETI, chemiluminescence resonance energy transfer imaging (CRETI, and radiative resonance energy transfer imaging (RRETI. RETI is the hot field of molecular imaging research and has been widely used in the fields of biology and medicine. This review mainly focuses on RETI principle and application in biomedicine.

  17. Magnetic resonance imaging of aneurysmal subarachnoid hemorrhage

    International Nuclear Information System (INIS)

    Ogawa, Toshihide; Shimosegawa, Eku; Inugami, Atsushi; Shishido, Fumio; Fujita, Hideaki; Ito, Hiroshi; Uemura, Kazuo; Yasui, Nobuyuki


    Magnetic resonance imaging of subarachnoid hemorrhage (SAH) due to aneurysm rupture was evaluated in relation to CT findings in nine patients. Six patients were studied within 3 days and the other three patients were studied 4 to 6 days from the ictus of SAH using a 0.5 Tesla superconducting unit. In all of the patients, hematoma in the subarachnoid space and ventricles was demonstrated by the proton density-weighted spin echo sequence, which showed that bloody cerebrospinal fluid (CSF) had a higher signal intensity than brain tissue or normal CSF. Magnetic resonance imaging was more sensitive in detecting SAH and more informative as to the site of the ruptured aneurysm than CT. Despite some limitations in applying it to patients with acute SAH, magnetic resonace imaging has clear advantages in the diagnosis of SAH. (author)

  18. Magnetic resonance imaging of aneurysmal subarachnoid hemorrhage

    Energy Technology Data Exchange (ETDEWEB)

    Ogawa, Toshihide; Shimosegawa, Eku; Inugami, Atsushi; Shishido, Fumio; Fujita, Hideaki; Ito, Hiroshi; Uemura, Kazuo; Yasui, Nobuyuki (Research Inst. of Brain and Blood Vessels, Akita (Japan))


    Magnetic resonance imaging of subarachnoid hemorrhage (SAH) due to aneurysm rupture was evaluated in relation to CT findings in nine patients. Six patients were studied within 3 days and the other three patients were studied 4 to 6 days from the ictus of SAH using a 0.5 Tesla superconducting unit. In all of the patients, hematoma in the subarachnoid space and ventricles was demonstrated by the proton density-weighted spin echo sequence, which showed that bloody cerebrospinal fluid (CSF) had a higher signal intensity than brain tissue or normal CSF. Magnetic resonance imaging was more sensitive in detecting SAH and more informative as to the site of the ruptured aneurysm than CT. Despite some limitations in applying it to patients with acute SAH, magnetic resonace imaging has clear advantages in the diagnosis of SAH. (author).

  19. Magnetic resonance imaging of optic nerve

    International Nuclear Information System (INIS)

    Gala, Foram


    Optic nerves are the second pair of cranial nerves and are unique as they represent an extension of the central nervous system. Apart from clinical and ophthalmoscopic evaluation, imaging, especially magnetic resonance imaging (MRI), plays an important role in the complete evaluation of optic nerve and the entire visual pathway. In this pictorial essay, the authors describe segmental anatomy of the optic nerve and review the imaging findings of various conditions affecting the optic nerves. MRI allows excellent depiction of the intricate anatomy of optic nerves due to its excellent soft tissue contrast without exposure to ionizing radiation, better delineation of the entire visual pathway, and accurate evaluation of associated intracranial pathologies

  20. Nuclear magnetic resonance imaging in pharmaceutical research

    International Nuclear Information System (INIS)

    Sarkar, S.K.


    Nuclear magnetic resonance imaging has important applications in pharmaceutical research since it allows specific tissue and disease characterization in animal models noninvasively with excellent anatomical resolution and therefore provides improved ability to monitor the efficacy of novel drugs. The utility of NMR imaging in renal studies to monitor the mechanism of drug action and renal function in rats is described. The extension of the resolution of an NMR image to microscopic domain at higher magnetic field strengths and the utility of NMR microimaging in cerebrovascular and tumour metastasis studies in mice are discussed. (author). 40 refs., 14 figs

  1. Magnetic resonance imaging of pelvic floor dysfunction. (United States)

    Lalwani, Neeraj; Moshiri, Mariam; Lee, Jean H; Bhargava, Puneet; Dighe, Manjiri K


    Pelvic floor dysfunction is largely a complex problem of multiparous and postmenopausal women and is associated with pelvic floor or organ descent. Physical examination can underestimate the extent of the dysfunction and misdiagnose the disorders. Functional magnetic resonance (MR) imaging is emerging as a promising tool to evaluate the dynamics of the pelvic floor and use for surgical triage and operative planning. This article reviews the anatomy and pathology of pelvic floor dysfunction, typical imaging findings, and the current role of functional MR imaging. Copyright © 2013 Elsevier Inc. All rights reserved.

  2. Magnetic resonance imaging and myelin

    International Nuclear Information System (INIS)

    Adamsbaum, C.; Andre, C.; Rolland, Y.


    Postnatal development of the brain is characterized by growth and by myelination. Myelination of the brain normally extends from birth until about two years of age. MRI changes corresponding to the various myelination stages are due mainly to changes in the water content of the cerebral parenchyma. Myelination kinetics follow a fairly precise timetable, with variations across areas of the brain. Abnormalities of white matter are responsible for relatively stereotyped, nonspecific manifestations, which are mainly due to an increase in the amount of water contained in diseased white matter, whatever the cause of the disorder. Interpretation is based on the location, distribution, and progression of lesions. (authors). 7 refs., 5 figs

  3. Magnetic Resonance Imaging (MRI): Lumbar Spine (For Parents) (United States)

    ... Staying Safe Videos for Educators Search English Español Magnetic Resonance Imaging (MRI): Lumbar Spine KidsHealth / For Parents / Magnetic Resonance Imaging (MRI): Lumbar Spine What's in this article? ...

  4. Parasellar meningiomas: magnetic resonance imaging findings

    International Nuclear Information System (INIS)

    Santos, Alair Augusto S.M.D. dos; Fontes, Cristina Asvolinsque P.


    We reviewed 22 cases of patients with parasellar meningiomas evaluated with magnetic resonance imaging (MRI) in private clinics of the cities of Niteroi and Rio de Janeiro, Rio de Janeiro State, Brazil. Our aim was to characterize the imaging findings in this type of tumor. MRI scanners with 0.5 and 1.0 Tesla magnets were used for the acquisition of multiplanar T1-weighted (pre-and post-gadolinium administration) and T2-weighted images. The main symptoms observed were headache and visual disturbances. Hyperprolactinaemia was observed in only one patient. The most frequent imaging finding was a parasellar mass which appeared hypointense on T1-weighted and hyperintense on T2-weighted images, and enhanced intensively after gadolinium administration. MRI is useful to demonstrate the lesion and to asses the damage to adjacent structures, particularly when the patient presents visual disturbances due to involvement of the cavernous sinuses. (author)

  5. Clinical application of functional magnetic resonance imaging

    International Nuclear Information System (INIS)

    Alwatban, Adnan Z.W.


    The work described in this thesis was carried out at the Magnetic Resonance Centre of the University of Nottingham during the time from May 1998 to April 2001, and is the work of the author except where indicated by reference. The main source of signal changes in functional magnetic resonance imaging (fMRJ) is the fluctuation of paramagnetic deoxyhaemoglobin in the venous blood during different states of functional performance. For the work of this thesis, fMRI studies were carried out using a 3 T MR system with an echo planar imaging (EPI) pulse sequence. Hearing research utilising fMRI has been previously reported in normal subjects. Hearing fMRI is normally performed by stimulating the auditory cortex via an acoustic task presentation such as music, tone, etc. However, performing the same research on deaf subjects requires special equipment to be designed to allow direct stimulation of the auditory nerve. In this thesis, a new method of direct electrical stimulation of the auditory nerve is described that uses a transtympanic electrode implanted onto the surface of the cochlea. This approach would however, result in electromotive forces (EMFs) being induced by the time varying magnetic field, which would lead to current flow and heating, as well as deflection of the metallic electrode within the static magnetic field, and image distortion due to the magnetic susceptibility difference. A gold-plated tungsten electrode with a zero magnetic susceptibility was developed to avoid image distortion. Used with carbon leads and a carbon reference pad, it enabled safe, distortion-free fMRI studies of deaf subjects. The study revealed activation of the primary auditory cortex. This fMRI procedure can be used to demonstrate whether the auditory pathway is fully intact, and may provide a useful method for pre-operative assessment of candidates for cochlear implantation. Glucose is the energy source on which the function of the human brain is entirely dependent. Failure to

  6. Clinical application of functional magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Alwatban, Adnan Z W


    The work described in this thesis was carried out at the Magnetic Resonance Centre of the University of Nottingham during the time from May 1998 to April 2001, and is the work of the author except where indicated by reference. The main source of signal changes in functional magnetic resonance imaging (fMRJ) is the fluctuation of paramagnetic deoxyhaemoglobin in the venous blood during different states of functional performance. For the work of this thesis, fMRI studies were carried out using a 3 T MR system with an echo planar imaging (EPI) pulse sequence. Hearing research utilising fMRI has been previously reported in normal subjects. Hearing fMRI is normally performed by stimulating the auditory cortex via an acoustic task presentation such as music, tone, etc. However, performing the same research on deaf subjects requires special equipment to be designed to allow direct stimulation of the auditory nerve. In this thesis, a new method of direct electrical stimulation of the auditory nerve is described that uses a transtympanic electrode implanted onto the surface of the cochlea. This approach would however, result in electromotive forces (EMFs) being induced by the time varying magnetic field, which would lead to current flow and heating, as well as deflection of the metallic electrode within the static magnetic field, and image distortion due to the magnetic susceptibility difference. A gold-plated tungsten electrode with a zero magnetic susceptibility was developed to avoid image distortion. Used with carbon leads and a carbon reference pad, it enabled safe, distortion-free fMRI studies of deaf subjects. The study revealed activation of the primary auditory cortex. This fMRI procedure can be used to demonstrate whether the auditory pathway is fully intact, and may provide a useful method for pre-operative assessment of candidates for cochlear implantation. Glucose is the energy source on which the function of the human brain is entirely dependent. Failure to

  7. 76 FR 58281 - Magnetic Resonance Imaging Safety; Public Workshop (United States)


    ...] Magnetic Resonance Imaging Safety; Public Workshop AGENCY: Food and Drug Administration, HHS. ACTION... announcing a public workshop entitled: ``Magnetic Resonance Imaging (MRI) Safety Public Workshop.'' The purpose of the public workshop is to discuss factors affecting the safe use of magnetic resonance imaging...

  8. Functional magnetic resonance imaging of the primary motor cortex ...

    Indian Academy of Sciences (India)


    Abbreviations used: BOLD, Blood oxygenation level dependent; CBF, cerebral blood flow; fMRI, functional magnetic resonance imaging; EPI, eco-planar imaging; FOV, field of view; MRI, Magnetic resonance imaging; MRS, magnetic resonance spectroscopy;. PET, position emission tomography; rCBF, regional cerebral ...

  9. Magnetic resonance imaging in sudden deafness

    International Nuclear Information System (INIS)

    Ramos, Hugo Valter Lisboa; Barros, Flavia Alencar; Penido, Norma de Oliveira; Souza, Ana Claudia Valerio de; Yamaoka, Wellington Yugo; Yamashita, Helio


    The etiology of sudden deafness can remain undetermined despite extensive investigation. This study addresses the value of magnetic resonance imaging in the analysis of sudden deafness patients.Study Design: transversal cohort.Material And Method: In a prospective study, 49 patients attended at otolaryngology emergency room of Federal University of Sao Paulo - Escola Paulista de Medicina, from April 2001 to May 2003, were submitted to magnetic resonance imaging.Results: Magnetic Resonance abnormalities were seen in 23 (46.9%) patients and revealed two tumors suggestive of meningioma, three vestibular schwannomas, thirteen microangiopathic changes of the brain and five (21.7%) pathological conditions of the labyrinth.Conclusion: Sudden deafness should be approached as a symptom common to different diseases. The presence of cerebellopontine angle tumors in 10.2% of our cases, among other treatable causes, justifies the recommendation of gadolinium-enhanced magnetic resonance use, not only to study the auditory peripheral pathway, but to study the whole auditory pathway including the brain. (author)

  10. Sensorineural hearing loss after magnetic resonance imaging

    DEFF Research Database (Denmark)

    Mollasadeghi, Abolfazl; Mehrparvar, Amir Houshang; Atighechi, Saeid


    Magnetic resonance imaging (MRI) devices produce noise, which may affect patient's or operators' hearing. Some cases of hearing impairment after MRI procedure have been reported with different patterns (temporary or permanent, unilateral or bilateral, with or without other symptoms like tinnitus)......). In this report, a case of bilateral sensorineural hearing loss in an otherwise healthy patient underwent brain MRI was described. The patient's hearing loss was accompanied with tinnitus and was not improved after 3 months of followup.......Magnetic resonance imaging (MRI) devices produce noise, which may affect patient's or operators' hearing. Some cases of hearing impairment after MRI procedure have been reported with different patterns (temporary or permanent, unilateral or bilateral, with or without other symptoms like tinnitus...

  11. Magnetic resonance imaging of valvular heart disease

    DEFF Research Database (Denmark)

    Søndergaard, Lise; Ståhlberg, F; Thomsen, C


    The optimum management of patients with valvular heart diseases requires accurate and reproducible assessment of the valvular lesion and its hemodynamic consequences. Magnetic resonance imaging (MRI) techniques, such as volume measurements, signal-void phenomena, and velocity mapping, can be used...... in an integrated approach to gain qualitative and quantitative information on valvular heart disease as well as ventricular dimensions and functions. Thus, MRI may be advantageous to the established diagnostic tools in assessing the severity of valvular heart disease as well as monitoring the lesion and predicting...... the optimal timing for valvular surgery. This paper reviews the validation of these MRI techniques in assessing valvular heart disease and discusses some typical pitfalls of the techniques, including suggestions for solutions.J. Magn. Reson. Imaging 1999;10:627-638....

  12. Magnetic resonance imaging findings in tuberculous meningoencephalitis

    Energy Technology Data Exchange (ETDEWEB)

    Pui, M.H.; Memon, W.A. [Aga Khan Univ. Hospital, Dept. of Radiology, Karachi (Pakistan)


    To evaluate the efficacy of magnetic resonance imaging (MRI) for distinguishing tuberculosis from other types of meningoencephalitis. MRIs of 100 patients with tuberculous (50), pyogenic (33), viral (14), or fungal (3) meningoencephalitis were analyzed independently by 2 radiologists. Number, size, location, signal characteristics, surrounding edema, and contrast enhancement pattern of nodular lesions; location and pattern of meningeal enhancement; extent of infarct or encephalitis and hydrocephalus were evaluated. Contrast-enhancing nodular lesions were detected in patients with tuberculous (43 of 50 patients), pyogenic (9 of 33), and fungal (3 of 3) infections. No nodules were detected in patients with viral meningoencephalitis. Using the criteria of 1 or more solid rim or homogeneously enhancing nodules smaller than 2 cm, the sensitivity, specificity and accuracy for diagnosing tuberculous meningitis were 86.0%, 90.0% and 88.0%, respectively. Magnetic resonance imaging is useful in distinguishing tuberculous from pyogenic, viral and fungal meningoencephalitis. (author)

  13. BOLD magnetic resonance imaging in nephrology


    Hall ME; Jordan JH; Juncos LA; Hundley WG; Hall JE


    Michael E Hall,1,2 Jennifer H Jordan,3 Luis A Juncos,1,2 W Gregory Hundley,3 John E Hall2 1Department of Medicine, University of Mississippi Medical Center, Jackson, MS, USA; 2Department of Physiology and Biophysics, University of Mississippi Medical Center, Jackson, MS, USA; 3Department of Internal Medicine, Section on Cardiovascular Medicine, Wake Forest University School of Medicine, Winston-Salem, NC, USA Abstract: Magnetic resonance (MR) imaging, a non-invasive modality that provides ana...

  14. Sensorineural hearing loss after magnetic resonance imaging

    DEFF Research Database (Denmark)

    Mollasadeghi, Abolfazl; Mehrparvar, Amir Houshang; Atighechi, Saeid


    Magnetic resonance imaging (MRI) devices produce noise, which may affect patient's or operators' hearing. Some cases of hearing impairment after MRI procedure have been reported with different patterns (temporary or permanent, unilateral or bilateral, with or without other symptoms like tinnitus......). In this report, a case of bilateral sensorineural hearing loss in an otherwise healthy patient underwent brain MRI was described. The patient's hearing loss was accompanied with tinnitus and was not improved after 3 months of followup....

  15. Magnetic resonance imaging of pediatric soft-tissue vascular anomalies

    International Nuclear Information System (INIS)

    Navarro, Oscar M.


    Magnetic resonance (MR) imaging can be used in the management of pediatric soft-tissue vascular anomalies for diagnosing and assessing extent of lesions and for evaluating response to therapy. MR imaging studies often involve a combination of T1- and T2-weighted images in addition to MR angiography and fat-suppressed post-contrast sequences. The MR imaging features of these vascular anomalies when combined with clinical findings can aid in diagnosis. In cases of complex vascular malformations and syndromes associated with vascular anomalies, MR imaging can be used to evaluate accompanying soft-tissue and bone anomalies. This article reviews the MR imaging protocols and appearances of the most common pediatric soft-tissue vascular anomalies. (orig.)

  16. Radiation dosimetry using magnetic resonance imaging

    International Nuclear Information System (INIS)

    Olsson, L.E.


    A new dosimetry system for 3D dose distribution measurements based on the Fricke dosimeter and magnetic resonance imaging (MRI) has been developed. The dosimeter consists of a ferrous sulphate solution incorporated in an agarose gel, which together constitute the dosimeter gel. The absorbed dose to the gel is measured by means of the proton spin-lattice relaxation rate, 1/T1 in an MR scanner. The dose distribution to an arbitrary slice within a dosimeter gel phantom can thus be determined. The chemical yield of the dosimeter gel is significantly higher than that of the for Fricke solution, and is strongly dependent of the initial ferrous sulphate concentration, assuming that the gel is bubbled with oxygen during preparation. A gel of 1.5 mM [Fe 2+ ] and 50 mM [H 2 SO 4 ] has a sensitivity of 0.108 s -1 Gy -1 and is linear up to 50 Gy. The dosimeter gel has uniform dose response over large volumes. Above 50 mM[H 2 SO 4 ] the yield increases only slightly, but the gel strength decreases and results in gel phantoms with non-uniform dose response. Below 50 mM[H 2 SO 4 ] the sensitivity of the dosimeter falls rapidly due to the decreased relaxivity of the ferric ions. The high chemical yield can be explained by a chain reaction and a reaction scheme is accordingly proposed. The dosimeter gel shows no dependence on dose rate or radiation quality and can be regarded as water-equivalent with respect to the interaction of the radiation. The diffusion coefficient of the ferric ions in the agarose gel is 1.19x10 -2 cm 2 /h. The diffusion blurs the dosimeteric image, but poses only a minor problem if the MR measurements are completed within the first two hours after irradiation. Dose distribution data from external radiation therapy units have been determined using the dosimeter gel and MRI with good accuracy, but the precision is poor, about 5-10%. (au) (84 refs.)

  17. Magnetic resonance imaging of pelvic endometriosis

    International Nuclear Information System (INIS)

    Vieira, G.P.; Martin, B.; Tubiana, J.M.


    Twenty-five magnetic resonance imaging (MRI) studies were performed in 18 patients with proven endometriosis. MRI findings were analyzed and compared with laparoscopic or surgical findings; MRI accurately demonstrated ovarian endometrial cysts as well as ectopic foci of endometriosis. Adhesions may be also suggested. Contrary to laparoscopy, MRI easily depicts both deep lesions and endometrial implants under the peritoneum. Consequently, MRI appears as an useful adjunct to laparoscopy for initial diagnosis before starting a medical treatment and above all as the imaging modality of choice for evaluation of the answer to treatment, avoiding iterative and often adhesions limited laparoscopies. (author). 7 refs.; 9 figs

  18. New magnetic resonance imaging methods in nephrology (United States)

    Zhang, Jeff L.; Morrell, Glen; Rusinek, Henry; Sigmund, Eric; Chandarana, Hersh; Lerman, Lilach O.; Prasad, Pottumarthi Vara; Niles, David; Artz, Nathan; Fain, Sean; Vivier, Pierre H.; Cheung, Alfred K.; Lee, Vivian S.


    Established as a method to study anatomic changes, such as renal tumors or atherosclerotic vascular disease, magnetic resonance imaging (MRI) to interrogate renal function has only recently begun to come of age. In this review, we briefly introduce some of the most important MRI techniques for renal functional imaging, and then review current findings on their use for diagnosis and monitoring of major kidney diseases. Specific applications include renovascular disease, diabetic nephropathy, renal transplants, renal masses, acute kidney injury and pediatric anomalies. With this review, we hope to encourage more collaboration between nephrologists and radiologists to accelerate the development and application of modern MRI tools in nephrology clinics. PMID:24067433

  19. Generation of nuclear magnetic resonance images

    International Nuclear Information System (INIS)

    Beckmann, N.X.


    Two generation techniques of nuclear magnetic resonance images, the retro-projection and the direct transformation method are studied these techniques are based on the acquisition of NMR signals which phases and frequency components are codified in space by application of magnetic field gradients. The construction of magnet coils is discussed, in particular a suitable magnet geometry with polar pieces and air gap. The obtention of image contrast by T1 and T2 relaxation times reconstructed from generated signals using sequences such as spin-echo, inversion-recovery and stimulated echo, is discussed. The mathematical formalism of matrix solution for Bloch equations is also presented. (M.C.K.)

  20. Prostate resonance imaging: morphology and metabolism

    International Nuclear Information System (INIS)

    Ocantos, Jorge A.; Pietrani, Marcelo A.; Paganini, Lisandro


    The cancer of prostate is the most frequent neoplasms and the third cause of death in men, although the average of survival of patients it improved, the cancer of prostate is an important problem in health. The majority of these tumors are of slow growth and the early detection allows high probabilities of definitive treatment. The neoplasms of prostate detected at present are smaller than the detected ones 20 years ago behind, nevertheless exist big differences in the aggressiveness of these tumors. The images are very important in the management of prostate cancer, and the magnetic resonance imaging of the prostate is a new tool in the evaluation of prostate cancer [es

  1. Susceptibility effects in nuclear magnetic resonance imaging

    International Nuclear Information System (INIS)

    Ziener, Christian Herbert


    The properties of dephasing and the resulting relaxation of the magnetization are the basic principle on which all magnetic resonance imaging methods are based. The signal obtained from the gyrating spins is essentially determined by the properties of the considered tissue. Especially the susceptibility differences caused by magnetized materials (for example, deoxygenated blood, BOLD-effect) or magnetic nanoparticles are becoming more important for biomedical imaging. In the present work, the influence of such field inhomogeneities on the NMR-signal is analyzed. (orig.)

  2. Magnetic resonance imaging of the pediatric airway

    International Nuclear Information System (INIS)

    Auringer, S.T.; Bisset, G.S. III; Myer, C.M.


    Evaluation of the pediatric airway is often complex and may require multiple imaging techniques and invasive procedures. We performed magnetic resonance (MR) imaging of the airway in 34 children with clinical evidence of chronic airway obstruction and compared MR findings with those obtained by surgery and/or endoscopy. MR diagnoses included vascular compression in 15 patients, primary tracheomalacic states in 12 patients, and mediastinal masses in 4 patients. Findings were normal for 3 patients. The MR findings were in agreement with the endoscopic findings in 25 to 28 cases and in agreement with the surgical findings in 21 to 21 cases. (orig./GDG)

  3. Basic concepts from magnetic resonance imaging

    International Nuclear Information System (INIS)

    Rodriguez Arroyo, Diego


    The use of magnetic resonance imaging (MRI) has grown exponentially, due in part to excellent anatomic and pathologic detail provided by the modality, as recent technological advances that have led to more rapid acquisition times. Radiology residents in different parts of the world now receive training in MR images from their first year of residence, included the pulse sequences training spin-echo, gradient-echo, inversion-recovery, echo-planar image and MR angiographic sequences, commonly used in medical imaging. However, to optimize the use of this type of study, it has been necessary to understand the basic concepts of physics, included the concepts of recovery T1, degradation T2* and T2, repetition time, echo time, and the effects of chemical shift. Additionally, it has been important to understand the contrast weighting for better representation of specific tissues and thus perform an appropriate differential diagnosis of various pathological processes. (author) [es

  4. Chest magnetic resonance imaging: a protocol suggestion

    Directory of Open Access Journals (Sweden)

    Bruno Hochhegger


    Full Text Available Abstract In the recent years, with the development of ultrafast sequences, magnetic resonance imaging (MRI has been established as a valuable diagnostic modality in body imaging. Because of improvements in speed and image quality, MRI is now ready for routine clinical use also in the study of pulmonary diseases. The main advantage of MRI of the lungs is its unique combination of morphological and functional assessment in a single imaging session. In this article, the authors review most technical aspects and suggest a protocol for performing chest MRI. The authors also describe the three major clinical indications for MRI of the lungs: staging of lung tumors; evaluation of pulmonary vascular diseases; and investigation of pulmonary abnormalities in patients who should not be exposed to radiation.

  5. Magnetic resonance imaging of pancreatitis: An update (United States)

    Manikkavasakar, Sriluxayini; AlObaidy, Mamdoh; Busireddy, Kiran K; Ramalho, Miguel; Nilmini, Viragi; Alagiyawanna, Madhavi; Semelka, Richard C


    Magnetic resonance (MR) imaging plays an important role in the diagnosis and staging of acute and chronic pancreatitis and may represent the best imaging technique in the setting of pancreatitis due to its unmatched soft tissue contrast resolution as well as non-ionizing nature and higher safety profile of intravascular contrast media, making it particularly valuable in radiosensitive populations such as pregnant patients, and patients with recurrent pancreatitis requiring multiple follow-up examinations. Additional advantages include the ability to detect early forms of chronic pancreatitis and to better differentiate adenocarcinoma from focal chronic pancreatitis. This review addresses new trends in clinical pancreatic MR imaging emphasizing its role in imaging all types of acute and chronic pancreatitis, pancreatitis complications and other important differential diagnoses that mimic pancreatitis. PMID:25356038

  6. Multifunctional magnetic resonance imaging of cerebrovascular disease

    International Nuclear Information System (INIS)

    Grond, J. van der; Mali, W.P.T.M.


    Over the last few years magnetic resonance imaging (MRI) has developed into a multipurpose imaging technique. In addition to anatomical information, data can be obtained on perfusion, metabolism and imaging of the vascular anatomy. Especially in the field of neuroradiology the possibilities for obtaining multifunctional information from combined MR examinations are promising. In particular, stroke or stroke-related research benefits from these developments. This article reviews the current status and the potential of newly developed MR techniques with regard to the intracranial hemodynamic changes in patients with severe stenosis or occlusion of the internal carotid artery. The combination of MR angiography, perfusion-weighted MRI and MR spectroscopic imaging seems especially useful in the management of the individual patient. (orig.)

  7. Magnetic resonance imaging of hypothalamic hamartoma

    Energy Technology Data Exchange (ETDEWEB)

    Kanazawa, Junichi; Uozumi, Tohru; Sakoda, Katsuaki; Yamanaka, Masami; Kihara, Mikio; Nishi, Yoshikazu; Kagawa, Yoshihiro; Kajima, Toshio.


    Magnetic resonance (MR) findings of two patients with a hypothalamic hamartoma are discussed. The two girls showed clinical symptoms and endocrinological signs of precocious puberty. MR imaging was of diagnostic value superior to that of CT in the demonstration of the characteristic location of this tumor and relationships to the neighboring structures because of its multi-dimensional utility. Although it has been reported that CT showed this lesion as isodense to the grey matter with and without injection of contrast medium, MR imaging depicted the lesion as a high signal intensity area on T2-weighted images in both patients. MR imaging is a useful method for the evaluation of the hypothalamic hamartoma.

  8. Contrast Agent in Magnetic Resonance Imaging

    DEFF Research Database (Denmark)

    Vu-Quang, Hieu


    Nanoparticles have been employed as contrast agent in magnetic resonance imaging (MRI) in order to improve sensitivity and accuracy in diagnosis. In addition, these contrast agents are potentially combined with other therapeutic compounds or near infrared bio-imaging (NIR) fluorophores to obtain...... theranostic or dual imaging purposes, respectively. There were two main types of MRI contrast agent that were synthesized during this PhD project including fluorine containing nanoparticles and magnetic nanoparticles. In regard of fluorine containing nanoparticles, there were two types contrast agent...... cancer cells for cancer diagnosis in MRI. F127-Folate coated SPION were stable in various types of suspension medium for over six months. They could specifically target folate receptor of cancer cells in vitro and in vivo thus enhancing the contrast in MRI T2/T2* weighted images. These are preliminary...

  9. Shimadzu magnetic resonance imaging system, SMT-50

    International Nuclear Information System (INIS)

    Oikawa, Shiro; Nishida, Takayuki; Fujio, Yasuo


    The magnetic resonance imaging (MRI) system, as a new modality of medical imaging, has already been put to practical applications on many clinical sites, through which a lot of clinical data has been accumulated. It can offer a powerful new probe of internal anatomy of the human body and its functions. Now that the MRI has established its effectiveness in diagnosis, a really practical MRI system which features high efficiency and economical design with high patient throughput is strongly called for. Introduced in this article is a superconductive magnet MRI system, SMT-50, operating at 5000 Gauss. It has realized an excellent diagnostic capability with such functions as multi-slice multi-echo imaging, high sensitive, surface coil technique and so on. High resolution image display (1024 x 1024 pixcel) unit and separate console system (viewing console and scanning console) will assist high patient throughput. The outline of the SMT-50 and its clinical data are reported here. (author)

  10. Magnetic resonance imaging in hypertrophic cardiomyopathy

    International Nuclear Information System (INIS)

    Ichida, Fukiko; Hamamichi, Yuuji; Hashimoto, Ikuo; Tsubata, Shinichi; Miyazaki, Ayumi; Okada, Toshio; Futatsuya, Ryuusuke; Okada, Eikichi


    To evaluate the capability of magnetic resonance imaging (MRI) in the anatomical diagnosis and tissue characterization, 8 children with hypertrophic cardiomyopathy were studied comparing with echocardiography and 201 Tl myocardial imaging. The severity and distribution of hypertrophy were comparable on echocardiography and MRI. MRI was superior to echocardiography to demonstrate the apical hypertrophy. In 4 patients with severe hypertrophy, heterogenous high signal intensity was demonstrated in the site of hypertrophy, which was enhanced by T 2 weighted imaging. In the patient with decreased cardiac performance and progressed cardiac failure, the heterogeneity and high signal intensity progressed in one year interval. Simultaneously performed 201 Tl myocardial imaging showed patchy perfusion defect. Histological findings of the left ventricle demonstrated hypertrophy, degeneration and marked dysarray of the myocytes and fibrosis. MRI has the potential ability for the evaluation and sequential monitoring of myocardial tissue characterization as well as cardiac anatomy in childhood hypertrophic cardiomyopathy. (author)

  11. Pharmaceutical applications of magnetic resonance imaging (MRI). (United States)

    Richardson, J Craig; Bowtell, Richard W; Mäder, Karsten; Melia, Colin D


    Magnetic resonance imaging (MRI) is a powerful imaging modality that provides internal images of materials and living organisms on a microscopic and macroscopic scale. It is non-invasive and non-destructive, and one of very few techniques that can observe internal events inside undisturbed specimens in situ. It is versatile, as a wide range of NMR modalities can be accessed, and 2D and 3D imaging can be undertaken. Despite widespread use and major advances in clinical MRI, it has seen limited application in the pharmaceutical sciences. In vitro studies have focussed on drug release mechanisms in polymeric delivery systems, but isolated studies of bioadhesion, tablet properties, and extrusion and mixing processes illustrate the wider potential. Perhaps the greatest potential however, lies in investigations of pharmaceuticals in vivo, where pilot human and animal studies have demonstrated we can obtain unique insights into the behaviour of gastrointestinal, topical, colloidal, and targeted drug delivery systems.

  12. Magnetic resonance imaging in hypertrophic cardiomyopathy

    Energy Technology Data Exchange (ETDEWEB)

    Ichida, Fukiko; Hamamichi, Yuuji; Hashimoto, Ikuo; Tsubata, Shinichi; Miyazaki, Ayumi; Okada, Toshio; Futatsuya, Ryuusuke; Okada, Eikichi [Toyama Medical and Pharmaceutical Univ. (Japan)


    To evaluate the capability of magnetic resonance imaging (MRI) in the anatomical diagnosis and tissue characterization, 8 children with hypertrophic cardiomyopathy were studied comparing with echocardiography and [sup 201]Tl myocardial imaging. The severity and distribution of hypertrophy were comparable on echocardiography and MRI. MRI was superior to echocardiography to demonstrate the apical hypertrophy. In 4 patients with severe hypertrophy, heterogenous high signal intensity was demonstrated in the site of hypertrophy, which was enhanced by T[sub 2] weighted imaging. In the patient with decreased cardiac performance and progressed cardiac failure, the heterogeneity and high signal intensity progressed in one year interval. Simultaneously performed [sup 201]Tl myocardial imaging showed patchy perfusion defect. Histological findings of the left ventricle demonstrated hypertrophy, degeneration and marked dysarray of the myocytes and fibrosis. MRI has the potential ability for the evaluation and sequential monitoring of myocardial tissue characterization as well as cardiac anatomy in childhood hypertrophic cardiomyopathy. (author).

  13. Multifunctional magnetic resonance imaging of cerebrovascular disease

    Energy Technology Data Exchange (ETDEWEB)

    Grond, J. van der; Mali, W.P.T.M. [Department of Radiology, University Hospital Utrecht, P. O. Box 85500, 3508 GA Utrecht (Netherlands)


    Over the last few years magnetic resonance imaging (MRI) has developed into a multipurpose imaging technique. In addition to anatomical information, data can be obtained on perfusion, metabolism and imaging of the vascular anatomy. Especially in the field of neuroradiology the possibilities for obtaining multifunctional information from combined MR examinations are promising. In particular, stroke or stroke-related research benefits from these developments. This article reviews the current status and the potential of newly developed MR techniques with regard to the intracranial hemodynamic changes in patients with severe stenosis or occlusion of the internal carotid artery. The combination of MR angiography, perfusion-weighted MRI and MR spectroscopic imaging seems especially useful in the management of the individual patient. (orig.) With 4 figs., 176 refs.

  14. Imaging in hematology. Part 2: Computed tomography, magnetic resonance imaging and nuclear imaging

    International Nuclear Information System (INIS)

    Zhechev, Y.


    A dramatic increase of the role of imaging in diagnosis of blood diseases occurred with the development of computed tomography (CT) and magnetic resonance imaging (MRI). At present CT of the chest, abdomen, and pelvis is routinely employed in diagnostic and staging evaluation. The bone marrow may be imaged by one of several methods, including scintigraphy, CT and MRI. Nuclear imaging at diagnosis can clarify findings of uncertain significance on conventional staging and may be very useful in the setting of large masses to follow responses to therapy nad to evaluate the residual tumor in a large mass that has responded to treatment. Recent developments such as helical CT, single proton emission computed tomography (SPECT) and positron-emission tomography (PET) have continued to advance diagnosis and therapy

  15. Image quality at synthetic brain magnetic resonance imaging in children

    Energy Technology Data Exchange (ETDEWEB)

    Lee, So Mi; Cho, Seung Hyun; Kim, Won Hwa; Kim, Hye Jung [Kyungpook National University Hospital, Department of Radiology, Daegu (Korea, Republic of); Choi, Young Hun; Cheon, Jung-Eun; Kim, In-One [Seoul National University College of Medicine, Department of Radiology and Institute of Radiation Medicine, Seoul (Korea, Republic of); Cho, Hyun-Hae [Ewha Womans University Mokdong Hospital, Department of Radiology, Seoul (Korea, Republic of); You, Sun-Kyoung [Chungnam National University Hospital, Department of Radiology, Daejeon (Korea, Republic of); Park, Sook-Hyun [Kyungpook National University Hospital, Department of Pediatrics, Daegu (Korea, Republic of); Hwang, Moon Jung [GE Healthcare, MR Applications and Workflow, Seoul (Korea, Republic of)


    The clinical application of the multi-echo, multi-delay technique of synthetic magnetic resonance imaging (MRI) generates multiple sequences in a single acquisition but has mainly been used in adults. To evaluate the image quality of synthetic brain MR in children compared with that of conventional images. Twenty-nine children (median age: 6 years, range: 0-16 years) underwent synthetic and conventional imaging. Synthetic (T2-weighted, T1-weighted and fluid-attenuated inversion recovery [FLAIR]) images with settings matching those of the conventional images were generated. The overall image quality, gray/white matter differentiation, lesion conspicuity and image degradations were rated on a 5-point scale. The relative contrasts were assessed quantitatively and acquisition times for the two imaging techniques were compared. Synthetic images were inferior due to more pronounced image degradations; however, there were no significant differences for T1- and T2-weighted images in children <2 years old. The quality of T1- and T2-weighted images were within the diagnostically acceptable range. FLAIR images showed greatly reduced quality. Gray/white matter differentiation was comparable or better in synthetic T1- and T2-weighted images, but poorer in FLAIR images. There was no effect on lesion conspicuity. Synthetic images had equal or greater relative contrast. Acquisition time was approximately two-thirds of that for conventional sequences. Synthetic T1- and T2-weighted images were diagnostically acceptable, but synthetic FLAIR images were not. Lesion conspicuity and gray/white matter differentiation were comparable to conventional MRI. (orig.)

  16. Magnetic resonance perfusion imaging without contrast media

    International Nuclear Information System (INIS)

    Martirosian, Petros; Graf, Hansjoerg; Schick, Fritz; Boss, Andreas; Schraml, Christina; Schwenzer, Nina F.; Claussen, Claus D.


    Principles of magnetic resonance imaging techniques providing perfusion-related contrast weighting without administration of contrast media are reported and analysed systematically. Especially common approaches to arterial spin labelling (ASL) perfusion imaging allowing quantitative assessment of specific perfusion rates are described in detail. The potential of ASL for perfusion imaging was tested in several types of tissue. After a systematic comparison of technical aspects of continuous and pulsed ASL techniques the standard kinetic model and tissue properties of influence to quantitative measurements of perfusion are reported. For the applications demonstrated in this paper a flow-sensitive alternating inversion recovery (FAIR) ASL perfusion preparation approach followed by true fast imaging with steady precession (true FISP) data recording was developed and implemented on whole-body scanners operating at 0.2, 1.5 and 3 T for quantitative perfusion measurement in various types of tissue. ASL imaging provides a non-invasive tool for assessment of tissue perfusion rates in vivo. Images recorded from kidney, lung, brain, salivary gland and thyroid gland provide a spatial resolution of a few millimetres and sufficient signal to noise ratio in perfusion maps after 2-5 min of examination time. Newly developed ASL techniques provide especially high image quality and quantitative perfusion maps in tissues with relatively high perfusion rates (as also present in many tumours). Averaging of acquisitions and image subtraction procedures are mandatory, leading to the necessity of synchronization of data recording to breathing in abdominal and thoracic organs. (orig.)

  17. Magnetic resonance imaging in neurologic diseases

    International Nuclear Information System (INIS)

    Chang, Kee Hyun; Han, Man Chung; Wan, Chu Wan; Myung, Ho Jin; Choi, Kil Soo; Ahn, Chang Beom; Oh, Chang Hyun; Cho, Zang Hee


    Magnetic resonance (MR) imaging with 0.15 Tesla resistive magnet developed by Korea Advanced Institute of Science were performed in 27 patients with various neurologic diseases and compared with x-ray computed tomography (CT). The purpose of the paper is to evaluate the image quality, the diagnostic value and limitation, and the optimal pulse sequence of MR imagings with a resistive magnet. The MR images were obtained by using a variety of pulse sequence with spin echo technique including saturation recovery. T2-weighted spin echo, and/or inversion recovery with various pulse repetition (TR) and echo delay (TE) times. The MR imaging demonstrated the capability of detecting the lesions shown on CT in al cases and also detected an additional finding in one case (multiple sclerosis) which was not seen on CT. The MR imaging appeared to be more useful than CT in the evaluation of syringomyelia of spinal cord and white matter disease, while it failed to demonstrated small calcific lesion or inflammatory nodule (less than 1 cm) shown on CT and has shown somewhat poor contrast resolution in the case of meingloma. The spatial resolution of saturation recovery images was similar or superior to CT, whereas the contrast resolution of saturation recovery was inferior to CT. While the saturation recovery images have shown false negative findings in 5 patients (19%), the inversion recovery and T2-weighted spin echo have shown consistently positive findings. The inversive recovery and T2-weighted spin echo images demonstrated better contrast discrimination between normal and pathologic conditions than the saturation recovery images, but somewhat poorer spatial resolution. Authors suggest that the MR images of both the saturation recovery with 300/30 and T2-weighted spin echo with 1000/90 be used as a routine procedure and additional inversion recovery of 1300/300/30 sequence as a option if white matter disease is suspected

  18. Brain Imaging Using Hyperpolarized 129Xe Magnetic Resonance Imaging. (United States)

    Chahal, Simrun; Prete, Braedan R J; Wade, Alanna; Hane, Francis T; Albert, Mitchell S


    Hyperpolarized (HP) 129 Xe magnetic resonance imaging (MRI) is a novel iteration of traditional MRI that relies on detecting the spins of 1 H. Since 129 Xe is a gaseous signal source, it can be used for lung imaging. Additionally, 129 Xe dissolves in the blood stream and can therefore be detectable in the brain parenchyma and vasculature. In this work, we provide detailed information on the protocols that we have developed to image 129 Xe within the brains of both rodents and human subjects. © 2018 Elsevier Inc. All rights reserved.

  19. Magnetic resonance imaging of olfactory neuroblastoma

    International Nuclear Information System (INIS)

    Iio, Mitsuhiro; Homma, Akihiro; Furuta, Yasushi; Fukuda, Satoshi


    Olfactory neuroblastoma is an uncommon intranasal tumor originating from olfactory neuroepithelium. Despite the development of electron microscopy and immunohistochemical testing, the pathological diagnosis of this tumor is still difficult because of the wide range of histological features. Magnetic resonance imaging (MR) of this tumor and the pattern of contrast enhancement have not been well described. The purpose of this report was to analyze the MR characteristics of olfactory neuroblastomas. The MR signal, pattern of contrast enhancement, and correlation with high-resolution computed tomography (CT) imaging were examined. Seventeen patients with olfactory neuroblastoma were treated at Hokkaido University Hospital and a related hospital during the past 25 years. MR images taken in 12 patients and CT images taken in 9 patients with histologically confirmed olfactory neuroblastoma were retrospectively reviewed. Compared with brain gray matter, 11 tumors were hypointense on T1-weighted images, 9 homogeneously and 2 heterogeneously. Eight tumors were hyperintense on T2-weighted images, 3 homogeneously and 5 heterogeneously, although their appearance was less intense than that of sinusitis. Gadolinium enhancement was moderate in one case and marked in 10 of the 11 cases, 9 homogeneously and 2 heterogeneously. Nine of the 11 tumors showed smooth regular shaped margins; 2 of these tumors exhibited irregular infiltrating margins on gadolinium-enhanced images, compared to the pre-contrast T1-weighted images. Eight of the 11 tumors had clearly demarcated margins, while 3 of the 11 tumors did not exhibit gadolinium enhancement. Six of the 12 cases (50%) exhibited intracranial cysts on the gadolinium-enhanced images. T2-weighted or gadolinium-enhanced images successfully distinguished sinusitis from tumors in 4 cases whereas the CT images failed. Gadolinium enhancement, particularly in the tangential plane, demonstrated intracranial extension not apparent on the CT images

  20. Magnetic resonance imaging in pediatric neurological disease

    International Nuclear Information System (INIS)

    Tsukiyama, Takashi; Nishimoto, Hiroshi; Fujioka, Mutsuhisa; Aihara, Toshinori; Tanaka, Osamu.


    In this paper, we summarize our initial experience with Magnetic Resonance Imaging(MRI) in the evaluation of pediatric neurological disease. 17 children between the ages of 2 month and 8.5 year have been examined with MRI. All subjects tolerated the MRI procedure well, although sedation was necessary for young children. Result as follows : (1) MRI does not utilize ionising radiation to produce an image. (2) MRI images more clearly demonstrate cerebral gray and white matter than X-ray CT. (3) Compared with X-ray CT, MRI proved to be advantageous in detection and characterization of the pathology, especially when the abnormality was located along the posterior fossa and spinal canal. It is suggested that these nature of MRI makes it the ideal diagnostic method for children. (author)

  1. Magnetic resonance imaging of thoracic hydatid disease

    International Nuclear Information System (INIS)

    Sinner, W.N. von; Rifal, A.; Te Strake, L.; Sieck, J.; King Faisal Specialist Hospital and Research Centre, Riyadh; Michigan Univ., Ann Arbor


    Two patients with thoracic manifestations of hydatid disease (HD) are discussed; one patient had recurrent HD of the chest wall and the other, intrapulmonary HD after rupture and intrathoracic extension of an infradiaphragmatic cyst. At magnetic resonance (MR) imaging the manifestations of HD in the thorax are similar to previously reported MR findings in HD in the liver. The presence of a low signal intensity rim on T2 weighted images representing the cyst wall was confirmed. On T1 weighted images cysts with heterogeneous low and intermediate signal intensity contents and a relatively high signal intensity wall were seen. ''Folded parasitic membranes'' previously not described on MR were noted. Daughter cysts may have a low or high signal intensity depending on contents. Reactive changes in the lung may be quite marked compared with the liver, due to reaction to the parasite or simply because the lung is more easily compressed leading to secondary atelectasis. (orig.)

  2. Magnetic resonance imaging of parotid tumors, 1

    International Nuclear Information System (INIS)

    Nakamura, Akihiko; Yamashita, Toshio; Inoue, Toshiya; Kumazawa, Tadami; Kato, Tsutomu; Sawada, Satoshi; Tanaka, Yoshimasa


    We compared the usefulness of magnetic resonance imaging (MRI), with that of X-ray computed tomography in the preoperative diagnosis of parotid tumors. We performed in 13 patients with parotid tumors and 10 of them were operated. The MRI equipment had a magnetic fild of 0.15 Tesla. We used the spine echo acquisition technique and a repetition time of 600, 1000 and 2000 milli-seconds, and echo time of 40 and 80 milli-seconds. We found that the T 1 weighted image well visualized the duct of the parotid gland, the T 2 weighted image provided fine pictures of the parotid tumor. The facial nerve of normal parotid glands could not be visualized by MRI. (author)

  3. Magnetic resonance imaging of intraorbital tumors

    International Nuclear Information System (INIS)

    Inoue, Tooru; Fukui, Masashi; Matsushima, Toshio; Fujii, Kiyotaka; Hasuo, Kanehiro


    Ten cases of histologically confirmed intraorbital tumors were studied with magnetic resonance imaging (MRI). Two meningiomas were nearly isointense on the T 1 -weighted image (T 1 WI) and the T 2 -weighted image (T 2 WI) relative on the cerebral cortex. The hemangiopericytoma, lacrimal gland tumor, optic glioma, and encephalocele were hypointense on the T 1 WI. The pseudotumor was hypoisointense on both the T 1 WI and the T 2 WI. The metastatic tumor (prostatic carcinoma) was hyperintense on both the T 1 WI and the T 2 WI. Gd-DTPA MRI was performed in five cases. The anatomical relationships between the tumor and the orbital tissue could be discriminated well by means of the coronal and sagittal views. MRI is thus found to be useful for the preoperative diagnosis of the intraorbital tumor and the selection of the surgical approach. (author)

  4. Magnetic resonance imaging of intraorbital tumors

    Energy Technology Data Exchange (ETDEWEB)

    Inoue, Tooru; Fukui, Masashi; Matsushima, Toshio; Fujii, Kiyotaka; Hasuo, Kanehiro (Kyushu Univ., Fukuoka (Japan). Faculty of Medicine)


    Ten cases of histologically confirmed intraorbital tumors were studied with magnetic resonance imaging (MRI). Two meningiomas were nearly isointense on the T[sub 1]-weighted image (T[sub 1]WI) and the T[sub 2]-weighted image (T[sub 2]WI) relative on the cerebral cortex. The hemangiopericytoma, lacrimal gland tumor, optic glioma, and encephalocele were hypointense on the T[sub 1]WI. The pseudotumor was hypoisointense on both the T[sub 1]WI and the T[sub 2]WI. The metastatic tumor (prostatic carcinoma) was hyperintense on both the T[sub 1]WI and the T[sub 2]WI. Gd-DTPA MRI was performed in five cases. The anatomical relationships between the tumor and the orbital tissue could be discriminated well by means of the coronal and sagittal views. MRI is thus found to be useful for the preoperative diagnosis of the intraorbital tumor and the selection of the surgical approach. (author).

  5. Magnetic resonance imaging of facial muscles

    Energy Technology Data Exchange (ETDEWEB)

    Farrugia, M.E. [Department of Clinical Neurology, University of Oxford, Radcliffe Infirmary, Oxford (United Kingdom)], E-mail:; Bydder, G.M. [Department of Radiology, University of California, San Diego, CA 92103-8226 (United States); Francis, J.M.; Robson, M.D. [OCMR, Department of Cardiovascular Medicine, University of Oxford, John Radcliffe Hospital, Oxford (United Kingdom)


    Facial and tongue muscles are commonly involved in patients with neuromuscular disorders. However, these muscles are not as easily accessible for biopsy and pathological examination as limb muscles. We have previously investigated myasthenia gravis patients with MuSK antibodies for facial and tongue muscle atrophy using different magnetic resonance imaging sequences, including ultrashort echo time techniques and image analysis tools that allowed us to obtain quantitative assessments of facial muscles. This imaging study had shown that facial muscle measurement is possible and that useful information can be obtained using a quantitative approach. In this paper we aim to review in detail the methods that we applied to our study, to enable clinicians to study these muscles within the domain of neuromuscular disease, oncological or head and neck specialties. Quantitative assessment of the facial musculature may be of value in improving the understanding of pathological processes occurring within facial muscles in certain neuromuscular disorders.

  6. Magnetic resonance imaging of facial muscles

    International Nuclear Information System (INIS)

    Farrugia, M.E.; Bydder, G.M.; Francis, J.M.; Robson, M.D.


    Facial and tongue muscles are commonly involved in patients with neuromuscular disorders. However, these muscles are not as easily accessible for biopsy and pathological examination as limb muscles. We have previously investigated myasthenia gravis patients with MuSK antibodies for facial and tongue muscle atrophy using different magnetic resonance imaging sequences, including ultrashort echo time techniques and image analysis tools that allowed us to obtain quantitative assessments of facial muscles. This imaging study had shown that facial muscle measurement is possible and that useful information can be obtained using a quantitative approach. In this paper we aim to review in detail the methods that we applied to our study, to enable clinicians to study these muscles within the domain of neuromuscular disease, oncological or head and neck specialties. Quantitative assessment of the facial musculature may be of value in improving the understanding of pathological processes occurring within facial muscles in certain neuromuscular disorders

  7. Magnetic resonance imaging of intramuscular metastases

    International Nuclear Information System (INIS)

    Surov, Alexey; Spielmann, Rolf-Peter; Behrmann, Curd; Fiedler, Eckhard; Voigt, Wieland; Wienke, Andreas; Holzhausen, Hans-Juergen


    The aim of the present study was to analyse magnetic resonance findings of intramuscular metastases (IM) in a relatively large series. From January 2000 to January 2010, 28 patients (207 metastases) were retrospectively identified in the radiological database of the Martin-Luther-University. Several different scanning protocols were used depending on the localisation of IM. In 12 patients diffusion-weighted (DW) images were obtained with a multi-shot SE-EPI sequence. Apparent diffusion coefficient (ADC) maps were also calculated. Furthermore, fusion images were manually generated between the DW and half-Fourier acquisition single-shot turbo spin echo (HASTE) images. On T2-weighted images, 97% of the recognised IM were hyperintense in comparison to unaffected musculature, and 3% were mixed iso- to hyperintense. On T1-weighted images most IM (91%) were homogeneously isointense in comparison to muscle tissue, whereas 4% were hypointense, and 5% lightly hyperintense. ADC maps were calculated for 91 metastases ranging from 0.99 to 4.00 mm 2 s -1 (mean value 1.99 ± 0.66). ADC values of low ( 3.0) in 6%. Of the IM that were investigated with contrast medium, 88.5% showed marked enhancement. It was homogeneous in 88% and heterogenous in 6%. Rim enhancement with central low attenuation was seen in 6%. There was no difference in enhancement characteristics with respect to ADC values or fusion patterns. Peritumoral enhancement was identified in 2.4%. Magnetic resonance features of muscle metastases are relatively typical and consist of round or oval intramuscular masses with well-defined margins, marked enhancement, low or moderate ADC values, and moderate to high signal intensity on fusion images. (orig.)

  8. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian


    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  9. Nuclear magnetic resonance imaging of the kidney

    International Nuclear Information System (INIS)

    Hricak, H.; Crooks, L.; Sheldon, P.; Kaufman, L.


    The role of nuclear magnetic resonance (NMR) imaging of the kidney was analyzed in 18 persons (6 normal volunteers, 3 patients with pelvocaliectasis, 2 with peripelvic cysts, 1 with renal sinus lipomatosis, 3 with renal failure, 1 with glycogen storage disease, and 2 with polycystic kidney disease). Ultrasound and/or computed tomography (CT) studies were available for comparison in every case. In the normal kidney distinct anatomical structures were clearly differentiated by NMR. The best anatomical detail ws obtained with spin echo (SE) imaging, using a pulse sequence interval of 1,000 msec and an echo delay time of 28 msec. However, in the evaluation of normal and pathological conditions, all four intensity images (SE 500/28, SE 500/56, SE 1,000/28, and SE 1,000/56) have to be analyzed. No definite advantage was found in using SE imaging with a pulse sequence interval of 1,500 msec. Inversion recovery imaging enhanced the differences between the cortex and medulla, but it had a low signal-to-noise level and, therefore, a suboptimal overall resolution. The advantages of NMR compared with CT and ultrasound are discussed, and it is concluded that NMR imaging will prove to be a useful modality in the evaluation of renal disease

  10. Magnetic resonance imaging findings in adnexial torsion

    Energy Technology Data Exchange (ETDEWEB)

    Trindade, Ronald Meira Castro; Quadros, Marianne Siquara de [Hospital Albert Einstein, Sao Paulo, SP (Brazil). Instituto de Ensino e Pesquisa], e-mail:; Baroni, Ronaldo Hueb; Rosemberg, Michelle; Racy, Marcelo de Castro Jorge; Tachibana, Adriano [Hospital Albert Einstein, Sao Paulo, SP (Brazil); Funari, Marcelo Buarque de Gusmao [Hospital Albert Einstein, Sao Paulo, SP (Brazil). Imaging Service


    Adnexial torsion is an unusual event, but a major cause of abdominal pain in women. It is often associated with ovarian tumor or cyst, but can occur in normal ovaries, especially in children. The twisting of adnexial structures may involve the ovary or tube, but frequently affects both. In most cases, it is unilateral, with slight predilection for the right size. In imaging findings, increased ovarian volume and adnexial masses are observed, with reduced or absent vascularisation. In cases of undiagnosed or untreated complete twist, hemorrhagic necrosis may occur leading to complications; in that, peritonitis is the most frequent. Early diagnosis helps preventing irreversible damage with conservative treatment, thereby saving the ovary. Limitations in performing physical examination, possible inconclusive results in ultrasound and exposure to radiation in computed tomography makes magnetic resonance imaging a valuable tool in emergency assessment of gynecological diseases. The objective of this study was to report two confirmed cases of adnexial twist, emphasizing the contribution of magnetic resonance imaging in the diagnosis of this condition. (author)

  11. Magnetic resonance imaging of cleft palate

    Energy Technology Data Exchange (ETDEWEB)

    Naito, Yasushi; Tasaka, Yasuyuki; Honjo, Iwao; Nishimura, Kazumasa; Nakano, Yoshihisa


    Magnetic resonance imaging (MRI) of the nasopharynx and the eustachian tube was performed in five patients with cleft palate and compared with the results of those without this anomaly. Various degrees of deformity of the eustachian tube cartilage were found in cleft palate patients. The levator veli palatini muscles were situated more laterally in cleft palate patients than in normal subjects. Also, changes in the position of these muscles after palatoplasty were clearly depicted by MRI. Besides several autopsy reports, this is the first demonstration of the characteristic anomaly around the eustachian tube by a non-invasive method.

  12. Magnetic resonance imaging in cardiovascular disease

    International Nuclear Information System (INIS)

    Eckel, C.G.; Mettler, F.A. Jr.; Wicks, J.D.; Stevens, G.F.


    How does magnetic resonance imaging (MRI) currently contribute in the evaluation of patients with suspected heart disease? What role will MRI play in the future in evaluation of cardiovascular disease? To understand better where MRI fits into the diagnostic algorithm of cardiovascular disease the authors first consider the characteristics that they would like to see in the ideal diagnostic test and then survey the available cardiac diagnostic tests to note the characteristics that limit or recommend a test. In the final analysis, the justification for expensive diagnostic tests such as MRI must be an overall improvement in survival or quality of life in those patients treated after diagnosis

  13. Fetal magnetic resonance imaging and human genetics

    International Nuclear Information System (INIS)

    Hengstschlaeger, Markus


    The use of fetal magnetic resonance imaging (MRI), in addition to prenatal genetic testing and sonography, has the potential to improve prenatal diagnosis of genetic disorders. MRI plays an important role in the evaluation of fetal abnormalities and malformations. Fetal MRI often enables a differential diagnosis, a determination of the extent of the disorder, the prognosis, and an improvement in therapeutic management. For counseling of parents, as well as to basically understand how genetic aberrations affect fetal development, it is of great importance to correlate different genotypes with fetal MRI data

  14. Fetal magnetic resonance imaging and human genetics

    Energy Technology Data Exchange (ETDEWEB)

    Hengstschlaeger, Markus [Medical Genetics, Obstetrics and Gynecology, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna (Austria)]. E-mail:


    The use of fetal magnetic resonance imaging (MRI), in addition to prenatal genetic testing and sonography, has the potential to improve prenatal diagnosis of genetic disorders. MRI plays an important role in the evaluation of fetal abnormalities and malformations. Fetal MRI often enables a differential diagnosis, a determination of the extent of the disorder, the prognosis, and an improvement in therapeutic management. For counseling of parents, as well as to basically understand how genetic aberrations affect fetal development, it is of great importance to correlate different genotypes with fetal MRI data.

  15. Magnetic resonance imaging of the cardiovascular system

    International Nuclear Information System (INIS)

    Masuda, Yoshiaki; Imai, Hiroshi; Watanabe, Sigeru; Inagaki, Yoshiaki; Tateno, Yukio; Ikehira, Hiroo.


    Magnetic resonance imaging (MRI) is a new noninvasive technique for visualization of the cardiovascular system, and is used to evaluate tissue characteristics, cardiac function and blood flow abnormalities, as well as to obtain morphological information. In this paper we presented results of clinical and laboratory research obtained using conventional spin echo MRI with regard to cardiovascular anatomy, tissue characterization and physiology. Furthermore, experience with two new techniques, cine-MRI and volume-selected MR spectroscopy, and their potential clinical usefulness in detecting cardiovascular diseases are documented. (author)

  16. Magnetic resonance imaging of the male pelvis

    International Nuclear Information System (INIS)

    Lamarque, J.L.; Rouanet, J.P.; Pujol, J.


    The authors present their preliminary results in the investigation of the male pelvis by means of a 0.35 Tesla superconductor apparatus. They present the different sequences used. The signal of the various pelvic organs in man is analysed together with the different anatomical possibilities. Magnetic resonance imaging appears to present very important advantages. The authors consider that the major limitations involve the prostate: new sequences of investigation, in particular a long TR, should be used for the purposes of tissue differentiation [fr

  17. Indications for fetal magnetic resonance imaging (MRI)

    International Nuclear Information System (INIS)

    Prayer, D.


    Indications to perform fetal magnetic resonance imaging (MRI) are composed of common ones related to methodological problems of ultrasound (US) assessment (such as for instance hydramnios) and special ones. The latter are related to MR capability of high-resolution soft tissue contrast and an extended field of view that allows visualization of the whole fetus, even in later stages of pregnancy. The most important indications include confirmation of US findings, work-up of malformations with respect to individual prognosis and genetic background, differentiation between acquired conditions and malformations, visualization of pathologies that have to be treated surgically immediately after birth, and morphological changes of the placenta. (orig.) [de

  18. Magnetic resonance imaging of glenohumeral joint diseases

    International Nuclear Information System (INIS)

    Kieft, G.J.; Bloem, J.L.; Obermann, W.R.; Rozing, P.; Doornbos, J.


    Through the application of oblique planes and flexible surface coil techniques, magnetic resonance imaging (MRI) promises to be of great clinical value in the evaluation of a variety of pathologic conditions affecting the shoulder. In patients with joint effusions, the tendinous portion of the rotator cuff, glenoid labrum, and bicipital tendon can be readily visualized. This capability has particular relevance in patients with inflammatory disease and traumatic conditions. Rotator cuff atrophy and impingement of the coracoacromial arc upon the supraspinatus muscle and tendon can also be demonstrated. MRI is also useful in the evaluation of shoulder instability. (orig.)

  19. Magnetic resonance imaging of unicornuate uterus

    Energy Technology Data Exchange (ETDEWEB)

    Fedele, L.; Dorta, M.; Brioschi, D.; Giudici, M.N.; Villa, L. (1st Dept. of Obstetrics and Gynecology, Univ. of Milan (Italy))


    Five patient with a hysterosalpingographic diagnosis of unicornuate uterus underwent resonance imaging (MRI) and subsequently laparoscopy/laparotomy to evaluate the ability of MRI to identify the various subclasses of this malformation. The method was demonstrated to be valid, since in all 5 cases (one subclass A1b, two subclass B) were correctly diagnosed. Compared with laparoscopy, MRI is less expensive, less invasive, and can be performed in women in whom laparoscopic examination is risky. However, unlike laparoscopy, MRI can not detect the presence of minimal and mild endometriosis and does not allow assessment of the tubal conditions. (au).

  20. Magnetic resonance imaging of spinal diseases

    International Nuclear Information System (INIS)

    Nakatani, Mariko; Sekiya, Toru; Harada, Junta; Kawakami, Kenji; Tada, Shimpei


    Twenty-two patients were examined to determine the clinical value of magnetic resonance imaging (MRI) in the spinal disease. Using different pulse sequences T 1 value was obtained from 38 spines; the result showed that increased T 1 value indicated spinal marrow abnormalities. A comparative study of MRI and bone scintigraphy was performed in 18 patients. Although it was not feasible to evaluate effect of therapy in metastatic disease by MRI, diffuse bone marrow disease, such as diffuse bone marrow metastases and blood dyscrasia could be detected by MRI. This limited study will suggest applicability of MRI in the spinal disease. (author)

  1. Sensorineural Hearing Loss after Magnetic Resonance Imaging

    Directory of Open Access Journals (Sweden)

    Abolfazl Mollasadeghi


    Full Text Available Magnetic resonance imaging (MRI devices produce noise, which may affect patient’s or operators’ hearing. Some cases of hearing impairment after MRI procedure have been reported with different patterns (temporary or permanent, unilateral or bilateral, with or without other symptoms like tinnitus. In this report, a case of bilateral sensorineural hearing loss in an otherwise healthy patient underwent brain MRI was described. The patient’s hearing loss was accompanied with tinnitus and was not improved after 3 months of followup.

  2. Nanoplatforms for magnetic resonance imaging of cancer

    International Nuclear Information System (INIS)

    Cywinska, M. A.; Grudzinski, I. P.; Cieszanowski, A.; Bystrzejewski, M.; Poplawska, M.


    The application of biomedical nanotechnology in magnetic resonance imaging (MRI) is expect to have a major impact leading to the development of new contrast drug candidates on the nanoscale (1 - 100 nm) that are able to react with specific biological targets at a molecular level. One of the major challenges in this regard is the construction of nanomaterials, especially used in molecular MRI diagnostics of cancer in vivo, specialized antitumor drug delivery or real-time evaluation of the efficacy of the implemented cancer treatment. In this paper, we tried to gain further insights into current trends of nanomedicine, with special focus on preclinical MRI studies in translation cancer research. (authors)

  3. Developments in boron magnetic resonance imaging (MRI)

    International Nuclear Information System (INIS)

    Schweizer, M.


    This report summarizes progress during the past year on maturing Boron-11 magnetic resonance imaging (MRI) methodology for noninvasive determination of BNCT agents (BSH) spatially in time. Three major areas are excerpted: (1) Boron-11 MRI of BSH distributions in a canine intracranial tumor model and the first human glioblastoma patient, (2) whole body Boron-11 MRI of BSH pharmacokinetics in a rat flank tumor model, and (3) penetration of gadolinium salts through the BBB as a function of tumor growth in the canine brain

  4. Application of magnetic resonance techniques for imaging tumour physiology

    International Nuclear Information System (INIS)

    Stubbs, M.


    Magnetic resonance (MR) techniques have the unique ability to measure in vivo the biochemical content of living tissue in the body in a dynamic, non-invasive and non-destructive manner. MR also permits serial investigations of steady-state tumour physiology and biochemistry, as well as the response of a tumour to treatment. Magnetic resonance imaging (MRI), Magnetic resonance spectroscopy (MRS) and a mixture of the two techniques (spectroscopic imaging) allow some physiological parameters, for example pH, to be 'imaged'. Using these methods, information on tissue bioenergetics and phospolipid membrane turnover, pH, hypoxia, oxygenation, and various aspects of vascularity including blood flow, angiogenesis, permeability and vascular volume can be obtained. In addition, MRS methods can be used for monitoring anticancer drugs (e.g. 5FU, ifosfamide) and their metabolites at their sites of action. The role of these state-of-the-art MR methods in imaging tumour physiology and their potential role in the clinic are discussed. (orig.)

  5. Magnetic resonance imaging of the transplanted kidneys

    International Nuclear Information System (INIS)

    Matsui, Suguru; Lee, Chol-Joo; Hamashima, Takashi


    Magnetic resonance imaging (MRI) is a new noninvasive means for evaluating pathological changes of kidney transplants. Thirty kidney transplants were examined by MRI study, comparing with 12 donor kidneys as control. Imaging of well functioning grafts using inversion recovery (IR) method displayed a clear figure of corticomedullary differentiation (CMD). Kidneys under acute rejection, chronic rejection, and ciclosporin nephrotoxicity displayed poor CMD. CMD of Kidneys under ATN was poor on IR imaging, but clear on T 1 weightened imaging. T 1 values of kidney grafts were obtained as the mean value of T 1 relaxation time of three areas including upper pole, lower pole, and the middle of the cortex. T 1 value of the grafts under chronic rejection was similar to that of well functioning grafts. The value increased in case of acute rejection, ATN, and ciclosporin nephrotoxicity and decreased as the graft function was getting better. Imaging and the estimation of T 1 value of kidney transplants of MRI were effective for evaluating graft function but of no use for differentiation of causes of graft deterioration. (author)

  6. BOLD magnetic resonance imaging in nephrology (United States)

    Hall, Michael E; Jordan, Jennifer H; Juncos, Luis A; Hundley, W Gregory; Hall, John E


    Magnetic resonance (MR) imaging, a non-invasive modality that provides anatomic and physiologic information, is increasingly used for diagnosis of pathophysiologic conditions and for understanding renal physiology in humans. Although functional MR imaging methods were pioneered to investigate the brain, they also offer powerful techniques for investigation of other organ systems such as the kidneys. However, imaging the kidneys provides unique challenges due to potential complications from contrast agents. Therefore, development of non-contrast techniques to study kidney anatomy and physiology is important. Blood oxygen level-dependent (BOLD) MR is a non-contrast imaging technique that provides functional information related to renal tissue oxygenation in various pathophysiologic conditions. Here we discuss technical considerations, clinical uses and future directions for use of BOLD MR as well as complementary MR techniques to better understand renal pathophysiology. Our intent is to summarize kidney BOLD MR applications for the clinician rather than focusing on the complex physical challenges that functional MR imaging encompasses; however, we briefly discuss some of those issues. PMID:29559807

  7. State of the art magnetic resonance imaging

    International Nuclear Information System (INIS)

    Weissman, J.D.


    In less than a decade Magnetic Resonance Imaging (MRI) has evolved from a laboratory demonstration to a safe and effective technique for clinical diagnosis. This evolutionary process continues. At this time 2-D and 3-D imaging of the head and body is firmly established in clinical use. Surface coil imaging, two-component chemical shift imaging, in-vivo spectroscopy and flow imaging are currently in various stages of development. The present state of the art of MRI is a function of an array of technologies: magnet, Rf coil, Rf pulse amplifier, gradient coil and driver, pulse programmer, A/D converter, computer system architecture, array processors and mass storage (both magnetic and optical). The overall product design is the result of a complex process which balances the advantages and disadvantages of each component for optimal system performance and flexibility. The author discusses the organization of a state-of-the-art MRI system. Several examples of the kinds of system interactions affecting design choices are given. (Auth.)

  8. BOLD magnetic resonance imaging in nephrology

    Directory of Open Access Journals (Sweden)

    Hall ME


    Full Text Available Michael E Hall,1,2 Jennifer H Jordan,3 Luis A Juncos,1,2 W Gregory Hundley,3 John E Hall2 1Department of Medicine, University of Mississippi Medical Center, Jackson, MS, USA; 2Department of Physiology and Biophysics, University of Mississippi Medical Center, Jackson, MS, USA; 3Department of Internal Medicine, Section on Cardiovascular Medicine, Wake Forest University School of Medicine, Winston-Salem, NC, USA Abstract: Magnetic resonance (MR imaging, a non-invasive modality that provides anatomic and physiologic information, is increasingly used for diagnosis of pathophysiologic conditions and for understanding renal physiology in humans. Although functional MR imaging methods were pioneered to investigate the brain, they also offer powerful techniques for investigation of other organ systems such as the kidneys. However, imaging the kidneys provides unique challenges due to potential complications from contrast agents. Therefore, development of non-contrast techniques to study kidney anatomy and physiology is important. Blood oxygen level-dependent (BOLD MR is a non-contrast imaging technique that provides functional information related to renal tissue oxygenation in various pathophysiologic conditions. Here we discuss technical considerations, clinical uses and future directions for use of BOLD MR as well as complementary MR techniques to better understand renal pathophysiology. Our intent is to summarize kidney BOLD MR applications for the clinician rather than focusing on the complex physical challenges that functional MR imaging encompasses; however, we briefly discuss some of those issues. Keywords: functional MRI, kidney, oxygenation, chronic kidney disease 

  9. Magnetic resonance imaging of cystic periventricular leukomalacia

    International Nuclear Information System (INIS)

    Kadoi, Nobuaki; Nomura, Junko; Nowatari, Masahiko; Ohta, Takeo; Kamohara, Takashi; Yashiro, Kimio


    A study was performed to assess the values of magnetic resonance (MR) imaging in evaluation and the follow up of patients with cystic periventricular leukomalacia. Ten patients selected for MR imaging were diagnosed as having periventricular cystic lesions based on US scans. The range of gestational ages was 27 to 32 weeks, and the range of birth weights was 927 to 2,046 g. Twenty MR examinations were carried out using a 0.5 T superconducting system (Resona; Yokogawa). On the first MR examinations, taken by 6 months of age, low signal intensity lesions within the periventricular white matter, moderate ventriculomegaly with irregularity of the ventricular wall and delayed myelination were observed. These were the MR findings observed in the subacute stage of PVL. On the second or the third MR examinations, taken after 12 months of age, increased signal intensity in periventricular white matter on T 2 weighted images decreased volume of periventricular white matter and centrum semiovale and the ventriculomagaly with irregularity of ventricular wall were observed. However, progressions of myelination were proved to be not delayed in comparison with age matched controls. These were thought to be the MR findings of late stage of PVL. As the US findings of PVL have good correlation with pathologic changes revealed at autopsy, MR imaging can depict myelination and detect PVL lesion beyond the neonatal period. These observations demonstrate the value of the MR imaging for the follow up of the patients with PVL beyond the time of fontanel closure. (author)

  10. Rat Tumor Response to the Vascular-Disrupting Agent 5,6-Dimethylxanthenone-4-Acetic Acid as Measured by Dynamic Contrast-Enhanced Magnetic Resonance Imaging, Plasma 5-Hydroxyindoleacetic Acid Levels, and Tumor Necrosis1


    McPhail, Lesley D; McIntyre, Dominick J O; Ludwig, Christian; Kestell, Philip; Griffiths, John R; Kelland, Lloyd R; Robinson, Simon P


    The dose-dependent effects of 5,6-dimethylxanthenone-4-acetic acid (DMXAA) on rat GH3 prolactinomas were investigated in vivo. Dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI) was used to assess tumor blood flow/permeability pretreatment and 24 hours posttreatment with 0, 100, 200, or 350 mg/kg DMXAA. DCE-MRI data were analyzed using Ktrans and the integrated area under the gadolinium time curve (IAUGC) as response biomarkers. Highperformance liquid chromatography (HPLC) was use...

  11. Far-field superresolution by imaging of resonance scattering

    KAUST Repository

    Schuster, Gerard T.; Huang, Y.


    We show that superresolution imaging in the far-field region of the sources and receivers is theoretically and practically possible if migration of resonant multiples is employed. A resonant multiple is one that bounces back and forth between two

  12. Cardiac magnetic resonance imaging in clinical practice

    Directory of Open Access Journals (Sweden)

    Adriana Dias Barranhas


    Full Text Available Objective To evaluate and describe indications, mainly diagnoses and cardiac magnetic resonance imaging findings observed in clinical practice. Materials and Methods Retrospective and descriptive study of cardiac magnetic resonance performed at a private hospital and clinic in the city of Niterói, RJ, Brazil, in the period from May 2007 to April 2011. Results The sample included a total of 1000 studies performed in patients with a mean age of 53.7 ± 16.2 years and predominance for male gender (57.2%. The majority of indications were related to assessment of myocardial perfusion at rest and under pharmacological stress (507/1000; 51%, with positive results in 36.2% of them. Suspected myocarditis was the second most frequent indication (140/1000; 14%, with positive results in 63.4% of cases. These two indications were followed by study of arrhythmias (116/1000; 12%, myocardial viability (69/1000; 7% and evaluation of cardiomyopathies (47/1000; 5%. In a subanalysis, it was possible to identify that most patients were assessed on an outpatient basis (58.42%. Conclusion Cardiac magnetic resonance has been routinely performed in clinical practice, either on an outpatient or emergency/inpatient basis, and myocardial ischemia represented the main indication, followed by investigation of myocarditis, arrhythmogenic right ventricular dysplasia and myocardial viability.

  13. Clinical applications of cardiovascular magnetic resonance imaging

    International Nuclear Information System (INIS)

    Marcu, C.B.; Beek, A.M.; Van Rossum, A.C.


    Cardiovascular magnetic resonance imaging (MRI) has evolved from an effective research tool into a clinically proven, safe and comprehensive imaging modality. It provides anatomic and functional information in acquired and congenital heart disease and is the most precise technique for quantification of ventricular volumes, function and mass. Owing to its excellent interstudy reproducibility, cardiovascular MRI is the optimal method for assessment of changes in ventricular parameters after therapeutic intervention. Delayed contrast enhancement is an accurate and robust method used in the diagnosis of ischemic and nonischemic cardiomyopathies and less common diseases, such as cardiac sarcoidosis and myocarditis. First-pass magnetic contrast myocardial perfusion is becoming an alternative to radionuclide techniques for the detection of coronary atherosclerotic disease. In this review we outline the techniques used in cardiovascular MRI and discuss the most common clinical applications. (author)

  14. Magnetic resonance imaging for cardiac tumors

    International Nuclear Information System (INIS)

    Niwa, Koichiro; Tashima, Kazuyuki; Okajima, Yoshitomo; Nakajima, Hiromichi; Terai, Masaru; Nakajima, Hironori; Harada, Tsutomu; Ishida, Yoshikazu.


    We performed magnetic resonance imaging (MRI) in 4 patients with cardiac tumor (1 with rhabdomyoma, 1 with left atrial myxoma, and 2 with tumor of the left ventricular wall) for morphological evaluation of the tumor. ECG-gated MRI was performed by the spin echo imaging technique using a superconducting MRI system operating at 0.5 tesla. Spatial extension of the tumor was clearly demonstrated in all the patients. Gadolinium-DTPA (Gd-DTPA), was used in the 2 patients with tumor of the left ventricular myocardium to enhance the contrast, and allowed clear visualization of the tumor. These findings show the usefulness of MRI and MRI with Gd-DTPA for morphological evaluation of cardiac tumor. (author)

  15. Magnetic resonance imaging of spinal plasmacytoma

    International Nuclear Information System (INIS)

    Shah, B.K.; Saifuddin, A.; Price, G.J.


    AIM: To describe the magnetic resonance imaging (MRI) features of spinal plasmacytoma. MATERIALS AND METHODS: The clinical records and MRI findings in six patients (five men, one woman; age range 41-61 years) with histologically proven plasmacytoma of the spine were reviewed. All studies included sagittal T1- and T2-weighted spin-echo sequences and axial T1-weighted spin-echo sequences. Intravenous gadolinium DTPA was administered in four cases. RESULTS: MRI showed a characteristic appearances in four cases of low signal intensity curvilinear areas within the vertebra or cortical irregularity. CONCLUSION: Recognition of these imaging features can initiate the appropriate investigation as the commonest differential diagnosis for such lesions is metastasis. Shah, B. K. (2000)

  16. Magnetic resonance imaging of the genitourinary tract

    International Nuclear Information System (INIS)

    Strake, L. te; Persijn van Meerten, E.L. van; Trimbos, J.B.M.Z.; Paul, L.C.; Langeveld, J.W.; Bloem, J.L.; Bluemm, R.G.; Doornbos, J.


    This is an overview of the current applications of magnetic resonance imaging (MRI) in the genitourinary tract based on the experience with the 0.5-Tesla MR scanner (Gyroscan, Philips) at the Leiden University Hospital and on reports in the literature. MRI appears to share some of the limitations of CT. MRI cannot reliably differentiate between a malignant and a benign tumor. In the staging of ovarian malignancies by means of MRI, bowel preparation would be desirable. On the other hand, the soft-tissue contrast resolution of MRI is superior to that of CT and images can be obtained in any plane. Thus MRI promises to be an accurate method for staging malignancies. The results in the examination of transplant kidneys are encouraging. It is expected that there will be a place for MRI as a complementary technique to ultrasonography in the diagnosis of scrotal disease. (Auth.)

  17. Magnetic resonance imaging of placenta accreta (United States)

    Varghese, Binoj; Singh, Navdeep; George, Regi A.N; Gilvaz, Sareena


    Placenta accreta (PA) is a severe pregnancy complication which occurs when the chorionic villi (CV) invade the myometrium abnormally. Optimal management requires accurate prenatal diagnosis. Ultrasonography (USG) and magnetic resonance imaging (MRI) are the modalities for prenatal diagnosis of PA, although USG remains the primary investigation of choice. MRI is a complementary technique and reserved for further characterization when USG is inconclusive or incomplete. Breath-hold T2-weighted half-Fourier rapid acquisition with relaxation enhancement (RARE) and balanced steady-state free precession imaging in the three orthogonal planes is the key MRI technique. Markedly heterogeneous placenta, thick intraplacental dark bands on half-Fourier acquisition single-shot turbo spin-echo (HASTE), and disorganized abnormal intraplacental vascularity are the cardinal MRI features of PA. MRI is less reliable in differentiating between different degrees of placental invasion, especially between accreta vera and increta. PMID:24604945

  18. Magnetic resonance imaging of placenta accreta

    Directory of Open Access Journals (Sweden)

    Binoj Varghese


    Full Text Available Placenta accreta (PA is a severe pregnancy complication which occurs when the chorionic villi (CV invade the myometrium abnormally. Optimal management requires accurate prenatal diagnosis. Ultrasonography (USG and magnetic resonance imaging (MRI are the modalities for prenatal diagnosis of PA, although USG remains the primary investigation of choice. MRI is a complementary technique and reserved for further characterization when USG is inconclusive or incomplete. Breath-hold T2-weighted half-Fourier rapid acquisition with relaxation enhancement (RARE and balanced steady-state free precession imaging in the three orthogonal planes is the key MRI technique. Markedly heterogeneous placenta, thick intraplacental dark bands on half-Fourier acquisition single-shot turbo spin-echo (HASTE, and disorganized abnormal intraplacental vascularity are the cardinal MRI features of PA. MRI is less reliable in differentiating between different degrees of placental invasion, especially between accreta vera and increta.

  19. Magnetic resonance imaging of placenta accreta

    International Nuclear Information System (INIS)

    Varghese, Binoj; Singh, Navdeep; George, Regi A.N; Gilvaz, Sareena


    Placenta accreta (PA) is a severe pregnancy complication which occurs when the chorionic villi (CV) invade the myometrium abnormally. Optimal management requires accurate prenatal diagnosis. Ultrasonography (USG) and magnetic resonance imaging (MRI) are the modalities for prenatal diagnosis of PA, although USG remains the primary investigation of choice. MRI is a complementary technique and reserved for further characterization when USG is inconclusive or incomplete. Breath-hold T2-weighted half-Fourier rapid acquisition with relaxation enhancement (RARE) and balanced steady-state free precession imaging in the three orthogonal planes is the key MRI technique. Markedly heterogeneous placenta, thick intraplacental dark bands on half-Fourier acquisition single-shot turbo spin-echo (HASTE), and disorganized abnormal intraplacental vascularity are the cardinal MRI features of PA. MRI is less reliable in differentiating between different degrees of placental invasion, especially between accreta vera and increta

  20. Magnetic resonance imaging of nasopharyngeal malignant tumors

    International Nuclear Information System (INIS)

    Sakakihara, Junji; Kanoh, Naoyuki; Hayakawa, Katsumi.


    Magnetic Resonance Imaging (MRI) was used in the examination of three patients with nasopharyngeal malignant tumor and cranial nerve symptoms. Coronal and saggital sections were very useful for determining skull base invasion. Its high contrast resolution enabled us to visualize several cranial nerves directly. Differentiation between tumor and effusion in the paranasal sinuses was easy especially in T2 weighted images. Bone destruction could also be detected as bone marrow replacement by tumor or as interruption of the black line of compact bone. Local relationships of tumor and large blood vessels were visualized by MRI without invasive contrast enhancing methods. Despite such advantages, in one patient whose symptoms were highly suggestive of cranial invasion, no cranial invasion was detected by CT or MRI. (author)

  1. Penetrating power of resonant electromagnetic induction imaging

    Directory of Open Access Journals (Sweden)

    Roberta Guilizzoni


    Full Text Available The possibility of revealing the presence and identifying the nature of conductive targets is of central interest in many fields, including security, medicine, industry, archaeology and geophysics. In many applications, these targets are shielded by external materials and thus cannot be directly accessed. Hence, interrogation techniques are required that allow penetration through the shielding materials, in order for the target to be identified. Electromagnetic interrogation techniques represent a powerful solution to this challenge, as they enable penetration through conductive shields. In this work, we demonstrate the power of resonant electromagnetic induction imaging to penetrate through metallic shields (1.5-mm-thick and image targets (having conductivities σ ranging from 0.54 to 59.77 MSm−1 concealed behind them.

  2. Magnetic resonance imaging of tablet dissolution. (United States)

    Nott, Kevin P


    Magnetic resonance imaging (MRI) is the technique of choice for measuring hydration, and its effects, during dissolution of tablets since it non-invasively maps (1)H nuclei associated with 'mobile' water. Although most studies have used MRI systems with high-field superconducting magnets, low-field laboratory-based instruments based on permanent magnet technology are being developed that provide key data for the formulation scientist. Incorporation of dissolution hardware, in particular the United States Pharmacopeia (USP) apparatus 4 flow-through cell, allows measurements under controlled conditions for comparison against other dissolution methods. Furthermore, simultaneous image acquisition and measurement of drug concentration allow direct comparison of the drug release throughout the hydration process. The combination of low-field MRI with USP-4 apparatus provides another tool to aid tablet formulation. Copyright 2009 Elsevier B.V. All rights reserved.

  3. Magnetic resonance imaging of the transplanted kidney

    International Nuclear Information System (INIS)

    Jennerholm, S.; Backman, U.; Bohman, S.O.; Hemmingsson, A.; Nyman, R.; Uppsala Univ. Hospital; Huddinge Hospital


    In this study, long-term renal transplants were investigated with magnetic resonance (MR) imaging, and the results were correlated to histopathology and graft function. Seventeen patients were investigated with MR one to 10 years after transplantation and with simultaneous ultrasonographically guided cortical needle biopsy and function tests. Histopathology included semiquantitative grading of degree of fibrosis and quantitation of ratios of tubular structures to interstitial tissue. The correlation between the histopathological assessment of interstitial fibrosis and graft function was good. Poor differentiation between the renal cortex and the renal medulla at MR imaging was correlated to high degree of interstitial fibrosis in the kidney transplants as well as to reduced graft function. MR examination may thus be of value in the evaluation of long-term renal transplants with chronic functional changes. (orig./MG)

  4. Magnetic resonance imaging of the elbow. Part I: Normal anatomy, imaging technique, and osseous abnormalities

    International Nuclear Information System (INIS)

    Kijowski, Richard; Tuite, Michael; Sanford, Matthew


    Part I of this comprehensive review on magnetic resonance imaging of the elbow discusses normal elbow anatomy and the technical factors involved in obtaining high-quality magnetic resonance images of the elbow. Part I also discusses the role of magnetic resonance imaging in evaluating patients with osseous abnormalities of the elbow. With proper patient positioning and imaging technique, magnetic resonance imaging can yield high-quality multiplanar images which are useful in evaluating the osseous structures of the elbow. Magnetic resonance imaging can detect early osteochondritis dissecans of the capitellum and can be used to evaluate the size, location, stability, and viability of the osteochondritis dissecans fragment. Magnetic resonance imaging can detect early stress injury to the proximal ulna in athletes. Magnetic resonance imaging can detect radiographically occult fractures of the elbow in both children and adults. Magnetic resonance imaging is also useful in children to further evaluate elbow fractures which are detected on plain-film radiographs. (orig.)

  5. Magnetic resonance imaging of spinal cord syndromes

    International Nuclear Information System (INIS)

    Einsiedel, H. von; Stepan, R.


    Thirty-four patients with intramedullary space-occupying lesions or cord compression syndromes were examined with a resistive and two different superconductive magnetic resonance (MR) imaging units. Studies were done primarily by the spin-echo (SE) technique and in the majority of patients different pulse sequences were used. Images with short echo-time (TE) and short recovery-time (TR) were best for demonstration of spinal cord anatomy, for depicting cystic portions in intramedullary tumours and for showing syringomyelia. Solid intramedullary tumours showed normal cord signal intensity. Images with prolonged TE and TR predominantly enhanced CSF signal intensity and, to a more considerable extent, solid intramedullary tumours. Thus, the diameter of the subarachnoid space and the presence of a solid intramedullary tumour, not concomittant with a significant enlargement of the spinal cord, could only be recognized on these prolonged SE images. Major advantages of MR in comparison to CT are that the spinal cord can be imaged in the sagittal plane and that beam hardening artifacts do not occur; in comparison to myelography the cord can be imaged directly by MR. Partial volume is a major limitation of MR, not only in the preferably applied sagittal plane. The choice of slice thickness adequate to the diameter of the lesion and straight positioning of the patient for sagittal single slice midline images are fundamental for reliable MR investigations. Another limitation to MR is that cortical bone gives no signal. The actual diameter of the spinal canal therefore cannot be correctly appreciated and consequently it was difficult or impossible to assess spinal stenosis. (orig.)

  6. Magnetic resonance imaging in breast cancer treated with neoadjuvant chemotherapy: radiologic-pathologic correlation of the response and disease-free survival depending on molecular subtype. (United States)

    Cruz Ciria, S; Jiménez Aragón, F; García Mur, C; Esteban Cuesta, H; Gros Bañeres, B


    To evaluate the radiologic and pathologic responses to neoadjuvant chemotherapy and their correlation in the molecular subtypes of breast cancer and to analyze their impact in disease-free survival. We included 205 patients with breast cancer treated with neoadjuvant chemotherapy. We evaluated the radiologic response by comparing MRI images acquired before and after chemotherapy. The pathologic response was classified on the Miller and Payne scale. For each subtype (HER2+, TN, luminal A, luminal B HER2-, and luminal B HER2+), we used the χ(2) test, Student's t-test, ANOVA, and Kendall's Tau-b to evaluate the radiologic response and the pathologic response, the radiologic-pathologic correlation, and the disease-free survival. The subtypes HER2+ (62.1%) and TN (45.2%) had higher rates of complete radiologic response. The pathologic response was 65.5% in the HER2+ subtype, 38.1% in the TN subtype, 2.6% in the luminal A subtype, 8.2% in the luminal B HER2- subtype, and 31% in the luminal B HER2+ subtype. The rate of radiologic-pathologic correlation was significant in all subtypes, higher in TN and HER2 (Tau-b coefficients 0.805 and 0.717, respectively). Disease-free survival was higher in HER2+ (91.9±3.3 months) and lower in TN (69.5±6.3 months), with significant differences between the cases with poor and good radiologic responses (P=.040). Survival was greater in cases with good radiologic response, except in cases with luminal A subtype. MRI can be a useful tool that provides information about the evolution of breast cancer treated with neoadjuvant chemotherapy, which varies with the immunohistochemical subtype. Copyright © 2012 SERAM. Published by Elsevier Espana. All rights reserved.

  7. Magnetic resonance imaging in complex partial seizures

    International Nuclear Information System (INIS)

    Furune, Sunao; Negoro, Tamiko; Maehara, Mitsuo; Nomura, Kazushi; Miura, Kiyokuni; Takahashi, Izumi; Watanabe, Kazuyoshi


    Magnetic resonance imaging (MRI) and computed tomography (CT) were performed on 45 patients with intractable complex partial seizures. MRI was performed with a superconducting whole-body scanner operating at 0.5 tesla (T) and 1.5 T. In patients with temporal lobe epilepsy, 8 of 24 patients had abnormal CT, but 16 or 24 patients showed abnormal MRI. 1.5 T MRI detected more abnormality than 0.5 T MRI when CT was normal. In patients with frontal lobe epilepsy, 5 of 7 patients had normal CT and MRI. In 2 other patients, MRI demonstrated an arachnoid cyst and increased signal intensity area on the T2-weighted images which were not detected by CT. In patients with occipital lobe epilepsy, 5 of 6 patients show abnormal CT and MRI. In patients with tuberous sclerosis, MRI revealed some increased signal intensity areas on the T2-weighted images in the occipital and temporal lobe, which were not detected by CT. Most surface EEG foci corresponded with the side of MRI abnormality. These data indicate that MRI is more informative than CT in complex partial seizures. MRI is the imaging technique of choice in the diagnosis of complex partial seizures. (author)

  8. Magnetic resonance imaging of splenic iron overload

    International Nuclear Information System (INIS)

    Arrive, L.; Thurnher, S.; Hricak, H.; Price, D.C.


    The value of magnetic resonance (MR) imaging in assessing iron overload in the spleen was retrospectively investigated in 40 consecutive patients. MR appearance, mesaure of signal intensity and T1-and T2-relaxation times were correlated with the histologically determined level of iron in the spleen in each patient. Histologic examination revealed no iron overload in 19 patients, mild iron overload in seven, moderate iron overload in six, and severe iron overload in eight. All 19 patients with no splenic iron overload and 11 of the other 21 patients with splenic iron overload were correctly identified by MR imaging (sensitivity 52%, specificity 100%, accuracy 75%). Splenic iron overload was diagnosed when a decrease of signal intensity of the spleen compared with those of adipose tissue and renal cortex was demonstrated. MR images demonstrated all eight cases of severe, three of the six cases of moderate, and none of the seven cases of mild iron overload. Only spleens with severe iron overload had a significant mean decrease in signal intensity and T1- and T2-relaxation times. Although specific, MR imaging is poorly sensitive to splenic iron overload. (author). 15 refs.; 5 figs.; 3 tabs

  9. Very low field magnetic resonance imaging

    International Nuclear Information System (INIS)

    Herreros, Quentin


    The aim of this thesis is to perform Magnetic Resonance Imaging at very low field (from 1 mT to 10 mT). A new kind of sensor called 'mixed sensor' has been used to achieve a good detectivity at low frequencies. Combining a superconducting loop and a giant magnetoresistance, those detectors have a competitive equivalent field noise compared to existing devices (Tuned coils, SQUIDs and Atomic Magnetometers). They have been combined with flux transformers to increase the coupling between the sample and the sensor. A complete study has been performed to adapt it to mixed sensors and then maximize the gain. This set has been incorporated in an existing small MRI device to test its robustness in real conditions. In parallel, several MRI sequences (GE, SE, FLASH, EPI,...) have been integrated and adapted to very low field requirements. They have been used to perform in-vivo three dimensional imaging and relaxometry studies on well known products to test their reliability. Finally, a larger setup adapted for full-head imaging has been designed and built to perform images on a larger working volume. (author) [fr

  10. Responsiveness of the Ankylosing Spondylitis Disease Activity Score (ASDAS), and clinical and magnetic resonance imaging measures of disease activity in a 1 year follow-up study of patients with axial spondyloarthritis treated with TNF-{alpha} inhibitors

    DEFF Research Database (Denmark)

    Pedersen, Susanne J; Sørensen, Inge J; Hermann, Kay-Geert A


    OBJECTIVES: To investigate construct validity and responsiveness of the novel ankylosing spondylitis disease activity score (ASDAS) in patients with spondyloarthritis (SpA). METHODS: In a 46 weeks prospective, longitudinal multi-center study of 60 SpA patients (80% men, median age 40 years (range...... 21-62)) treated with tumor-necrosis-factor-alpha (TNF-alpha) inhibitors (infliximab (n=41), etanercept (n=13), adalimumab (n=6)) responsiveness of ASDAS, conventional clinical measures of disease activity and treatment response, and the Berlin magnetic resonance imaging (MRI) sacroiliac joint (SIJ......) and lumbar spine inflammation scores were compared. RESULTS: After 22 weeks, 58.3% of the patients were clinical responders (50% or 20mm reduction in BASDAI). At baseline, clinical responders had significantly higher ASDAS (median 4.15 (range 1.98-6.04), p=0.008) compared with non-responders (2.99, 2...

  11. Magnetic resonance imaging in Parkinson's disease

    International Nuclear Information System (INIS)

    Moriwaka, Fumio; Tashiro, Kunio; Itoh, Kazunori; Miyasaka, Kazuo; Hamada, Takeshi.


    The width of substantia nigra (SN) in 59 cases of idiopathic Parkinson's disease as well as 21 normal controls was analyzed by T2 weighted image (T2WI) of 1.5 Tesla high-field magnetic resonance image (MRI). All patients and controls underwent MRI with the spin-echo sequences used TR/TE: 3000/30 (short TE), and TR/TE: 3000/80 (long TE), in 5-mm-thick volumes. The width between the red nucleus and the cerebral peduncle showing low signal intensity areas was measured as that of SN and its ratio to the distance from the aqueduct to the midline of the cerebral peduncle was also measured. The calculated values of the width of SN and its ratio were analyzed by Mann-Whitney test. The significant reduction in the width of SN and its ratio in Parkinson's disease were disclosed below: the mean calculated values of the width of SN were 2.95±0.51 mm in controls, 2.68±0.99 mm in Parkinson's disase on long TE images (P<0.01), and the mean ratio of the width of SN were 13.58±4.21% in controls, 10.52±3.07% in Parkinson's disease on long TE images (P=0.0002). The narrowing of SN in Parkinson's disease was more prominent in men, and advanced cases with Yahr stage III and IV. Considering that the pars reticulata, which is normally containing iron, shows low signal intensity on long TE images, the width of pars compacta could be measured more precisely on this sequences. The evaluation of the ratio of SN in midbrain on long TE images seemed to be more sensitive than the calculated values in detecting the narrowing of SN and pars compacta in Parkinson's disease. (author)

  12. Flow imaging of the cardiovascular system using magnetic resonance imaging

    International Nuclear Information System (INIS)

    Imai, Hitoshi; Sakakibara, Makoto; Sunami, Yuko


    Blood flow images by magnetic resonance imaging (MRI) using a 0.25 T unit were evaluated for nine normal volunteers and 108 subjects with a variety of cardiovascular abnormalities. Using the non-gated short-spin echo (SE) technique, blood flow in the cardiovascular systems was not imaged in the normal volunteers. Using end-systolic and end-diastolic SE techniques for the normal subjects, blood flow in the cardiac chambers was not clearly imaged. Blood flow in the ascending aorta and aortic arch often did not appear in the gated SE images of the normal subjects. However, blood flow in the descending aorta was often observed in the gated SE images. Blood flow imaging was demonstrated by both non-gated and gated SE techniques in regions where blood flow was relatively slow; for example, in the left atrium of mitral stenosis, in an aortic aneurysm, in a false lumen of an aortic dissection, and in the left ventricle having old myocardial infarction. Using the non-gated inversion recovery (IR) technique, no blood flow was imaged in the cardiovascular system except in the left atrium of one case with mitral stenosis. Using the non-gated short SE technique, there was good correlation between the thrombus formation and the presence of blood flow images in the left atria of 17 patients with mitral stenosis, and in the aneurysmal portions of the aorta or in the false lumens of aortic dissection of 18 patients. It was suggested that mural thrombi in such diseases were related to the relatively slow blood flow. Blood flow imaging easily distinguished stagnant blood flow from mural thrombi using non-gated short SE, end-systolic SE, and IR techniques. Thus, blood flow imaging using MRI should become an important means of evaluating the cardiovascular system. (author)

  13. Pulse sequences for contrast-enhanced magnetic resonance imaging

    International Nuclear Information System (INIS)

    Graves, Martin J.


    The theory and application of magnetic resonance imaging (MRI) pulse sequences following the administration of an exogenous contrast agent are discussed. Pulse sequences are categorised according to the contrast agent mechanism: changes in proton density, relaxivity, magnetic susceptibility and resonant frequency shift. Applications in morphological imaging, magnetic resonance angiography, dynamic imaging and cell labelling are described. The importance of optimising the pulse sequence for each application is emphasised

  14. Image fusion for dynamic contrast enhanced magnetic resonance imaging

    Directory of Open Access Journals (Sweden)

    Leach Martin O


    Full Text Available Abstract Background Multivariate imaging techniques such as dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI have been shown to provide valuable information for medical diagnosis. Even though these techniques provide new information, integrating and evaluating the much wider range of information is a challenging task for the human observer. This task may be assisted with the use of image fusion algorithms. Methods In this paper, image fusion based on Kernel Principal Component Analysis (KPCA is proposed for the first time. It is demonstrated that a priori knowledge about the data domain can be easily incorporated into the parametrisation of the KPCA, leading to task-oriented visualisations of the multivariate data. The results of the fusion process are compared with those of the well-known and established standard linear Principal Component Analysis (PCA by means of temporal sequences of 3D MRI volumes from six patients who took part in a breast cancer screening study. Results The PCA and KPCA algorithms are able to integrate information from a sequence of MRI volumes into informative gray value or colour images. By incorporating a priori knowledge, the fusion process can be automated and optimised in order to visualise suspicious lesions with high contrast to normal tissue. Conclusion Our machine learning based image fusion approach maps the full signal space of a temporal DCE-MRI sequence to a single meaningful visualisation with good tissue/lesion contrast and thus supports the radiologist during manual image evaluation.

  15. Magnetic Resonance Imaging in Myocardial Fibrosis Related to Ischemic Events

    Directory of Open Access Journals (Sweden)

    Himcinschi Elisabeta


    Full Text Available Given the higher amount of detail it offers, the use of magnetic resonance (MR in the field of cardiology has increased, thus leading to a decrease in the use of invasive and irradiating methods for diagnosing various cardiovascular disorders. The only precautions for MR imaging are metallic implants and advanced-stage chronic kidney disease. For the acquisition of clear and dynamic myocardial images, methods such as spin echo imaging for anatomical description, steady-state free precession imaging for the assessment of ventricular cavity size and function, flow velocity encoding for blood flow measurements, radiofrequency tagging for dynamics, and even spectroscopy for metabolism evaluation are used. Cardiac magnetic resonance (CMR is considered the gold standard imaging method for the anatomical characterization of the heart and obtaining information related to myocardial dynamics. In case of ischemic events, CMR is used for a detailed description of the necrotic area and the complications, and for tracking the ventricular remodeling. By administrating a contrast agent (gadolinium, the difference between sub-endothelial and transmural infarctions can be distinguished, highlighting even microvascular lesions responsible for the extension of the necrosis. The assessment of the dynamics of ventricular remodeling and viability through late gadolinium enhancement (LGE technology highlights the area of fibrosis and the occurrence of late complications.

  16. [Achilles tendon xanthoma imaging on ultrasound and magnetic resonance imaging]. (United States)

    Fernandes, Eloy de Ávila; Santos, Eduardo Henrique Sena; Tucunduva, Tatiana Cardoso de Mello; Ferrari, Antonio J L; Fernandes, Artur da Rocha Correa


    The Achilles tendon xanthoma is a rare disease and has a high association with primary hyperlipidemia. An early diagnosis is essential to start treatment and change the disease course. Imaging exams can enhance diagnosis. This study reports the case of a 60-year-old man having painless nodules on his elbows and Achilles tendons without typical gout crisis, followed in the microcrystalline disease clinic of Unifesp for diagnostic workup. Laboratory tests obtained showed dyslipidemia. The ultrasound (US) showed a diffuse Achilles tendon thickening with hypoechoic areas. Magnetic resonance imaging (MRI) showed a diffuse tendon thickening with intermediate signal areas, and a reticulate pattern within. Imaging studies showed relevant aspects to diagnose a xanthoma, thus helping in the differential diagnosis. Copyright © 2014 Elsevier Editora Ltda. All rights reserved.

  17. Segmentation of neuroanatomy in magnetic resonance images (United States)

    Simmons, Andrew; Arridge, Simon R.; Barker, G. J.; Tofts, Paul S.


    Segmentation in neurological magnetic resonance imaging (MRI) is necessary for feature extraction, volume measurement and for the three-dimensional display of neuroanatomy. Automated and semi-automated methods offer considerable advantages over manual methods because of their lack of subjectivity, their data reduction capabilities, and the time savings they give. We have used dual echo multi-slice spin-echo data sets which take advantage of the intrinsically multispectral nature of MRI. As a pre-processing step, a rf non-uniformity correction is applied and if the data is noisy the images are smoothed using a non-isotropic blurring method. Edge-based processing is used to identify the skin (the major outer contour) and the eyes. Edge-focusing has been used to significantly simplify edge images and thus allow simple postprocessing to pick out the brain contour in each slice of the data set. Edge- focusing is a technique which locates significant edges using a high degree of smoothing at a coarse level and tracks these edges to a fine level where the edges can be determined with high positional accuracy. Both 2-D and 3-D edge-detection methods have been compared. Once isolated, the brain is further processed to identify CSF, and, depending upon the MR pulse sequence used, the brain itself may be sub-divided into gray matter and white matter using semi-automatic contrast enhancement and clustering methods.

  18. Magnetic resonance imaging of the larynx

    International Nuclear Information System (INIS)

    Oleaga, L.


    Larynx and hypopharynx represent difficult anatomical structures to evaluate by imaging. Pathological processes inflammatory conditions and neoplasms are frequently found specially neoplasms. The most common tumor originating in this region is squamous cell carcinoma that represents 90%, of malignancies, magnetic Resonance Imaging (MRI) is used for staging of those tumors. In our study we evaluate the technique used for MRI studies as well as the anatomy of the larynx, hypopharynx and nodes and the different classification system used for neck nodes. We also analyze the different types of neoplasm that can be found being and malignant and the use of MRI for staging neoplasms. Clinical and laryngoscope staging of laryngeal tumors is not accurate if fails to demonstrate deep submucosal and laryngeal spaces invasion (pre-epi glottic. para laryngeal, para glottic, anterior commissures posterior commissure and sub glottis) as well as cartilage infiltration and extra laryngeal extension. We need accurate imaging diagnostic methods like MRI to evaluate the extension of tumors. (Author) 38 refs

  19. Magnetic resonance imaging of intracavernous pathology

    Energy Technology Data Exchange (ETDEWEB)

    Komiyama, Masaki; Yasui, Toshihiro; Yagura, Hisatsugu; Fu, Yoshihiko; Baba, Mitsuru [Baba Memorial Hospital, Sakai, Osaka (Japan); Hakuba, Akira; Nishimura, Shuro


    To evaluate the usefulness of magnetic resonance (MR) imaging of intracavernous pathology, T{sub 1}-weighted spin echo images of four vascular lesions and 10 neoplastic lesions with surgically confirmed cavernous sinus (CS) invasion were reviewed retrospectively. In one case of traumatic carotid-cavernous fistula (CCF) and one of dural arteriovenous malformation (AVM), the internal carotid artery (ICA) and rapid shunted flow were depicted as signal voids, and the relationship between the ICA and shunted flow was clearly shown. Normal venous flow appeared as a low-intensity area and was observed even in the presence of the CCF and dural AVM. In two cases of thrombosed aneurysms, the thrombosis was clearly demonstrated, along with patent arterial flow in one case; in the other case, however, it was impossible to differentiate patent arterial flow from calcification. The intensity of all neoplastic lesions was similar to that of the cerebral cortex. The relationship between the ICA and the tumors was clearly demonstrated. The visual pathways were also plainly shown unless they were involved, or markedly compressed, by tumor. CS invasion was strongly associated with four findings: (1) encasement of the ICA by the tumor; (2) marked displacement of the ICA; (3) absence of low intensity, which reflects normal venous flow, in the CS; and (4) extension of extrasellar tumors to the medial wall or of intrasellar tumors to the lateral wall. MR imaging was judged promising in the evaluation of intracavernous pathology. (author).

  20. Magnetic Resonance Imaging Features of Neuromyelitis Optica

    Energy Technology Data Exchange (ETDEWEB)

    You, Sun Kyung; Song, Chang June; Park, Woon Ju; Lee, In Ho; Son, Eun Hee [Chungnam National University College of Medicine, Chungnam National University Hospital, Daejeon (Korea, Republic of)


    To report the magnetic resonance (MR) imaging features of the spinal cord and brain in patients of neuromyelitis optica (NMO). Between January 2001 and March 2010, the MR images (spinal cord, brain, and orbit) and the clinical and serologic findings of 11 NMO patients were retrospectively reviewed. The contrast-enhancement of the spinal cord was performed (20/23). The presence and pattern of the contrast-enhancement in the spinal cord were classified into 5 types. Acute myelitis was monophasic in 8 patients (8/11, 72.7%); and optic neuritis preceded acute myelitis in most patients. Longitudinally extensive cord lesion (average, 7.3 vertebral segments) was involved. The most common type was the diffuse and subtle enhancement of the spinal cord with a multifocal nodular, linear or segmental intense enhancement (45%). Most of the brain lesions (5/11, 10 lesions) were located in the brain stem, thalamus and callososeptal interphase. Anti-Ro autoantibody was positive in 2 patients, and they showed a high relapse rate of acute myelitis. Anti-NMO IgG was positive in 4 patients (4/7, 66.7%). The imaging findings of acute myelitis in NMO may helpful in making an early diagnosis of NMO which can result in a severe damage to the spinal cord, and to make a differential diagnosis of multiple sclerosis and inflammatory diseases of the spinal cord such as toxocariasis.

  1. Exploring brain function with magnetic resonance imaging

    International Nuclear Information System (INIS)

    Di Salle, F.; Formisano, E.; Linden, D.E.J.; Goebel, R.; Bonavita, S.; Pepino, A.; Smaltino, F.; Tedeschi, G.


    Since its invention in the early 1990s, functional magnetic resonance imaging (fMRI) has rapidly assumed a leading role among the techniques used to localize brain activity. The spatial and temporal resolution provided by state-of-the-art MR technology and its non-invasive character, which allows multiple studies of the same subject, are some of the main advantages of fMRI over the other functional neuroimaging modalities that are based on changes in blood flow and cortical metabolism. This paper describes the basic principles and methodology of fMRI and some aspects of its application to functional activation studies. Attention is focused on the physiology of the blood oxygenation level-dependent (BOLD) contrast mechanism and on the acquisition of functional time-series with echo planar imaging (EPI). We also provide an introduction to the current strategies for the correction of signal artefacts and other image processing techniques. In order to convey an idea of the numerous applications of fMRI, we will review some of the recent results in the fields of cognitive and sensorimotor psychology and physiology

  2. Exploring brain function with magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Di Salle, F.; Formisano, E.; Linden, D.E.J.; Goebel, R.; Bonavita, S.; Pepino, A.; Smaltino, F.; Tedeschi, G


    Since its invention in the early 1990s, functional magnetic resonance imaging (fMRI) has rapidly assumed a leading role among the techniques used to localize brain activity. The spatial and temporal resolution provided by state-of-the-art MR technology and its non-invasive character, which allows multiple studies of the same subject, are some of the main advantages of fMRI over the other functional neuroimaging modalities that are based on changes in blood flow and cortical metabolism. This paper describes the basic principles and methodology of fMRI and some aspects of its application to functional activation studies. Attention is focused on the physiology of the blood oxygenation level-dependent (BOLD) contrast mechanism and on the acquisition of functional time-series with echo planar imaging (EPI). We also provide an introduction to the current strategies for the correction of signal artefacts and other image processing techniques. In order to convey an idea of the numerous applications of fMRI, we will review some of the recent results in the fields of cognitive and sensorimotor psychology and physiology.

  3. Magnetic Resonance Imaging Features of Neuromyelitis Optica

    International Nuclear Information System (INIS)

    You, Sun Kyung; Song, Chang June; Park, Woon Ju; Lee, In Ho; Son, Eun Hee


    To report the magnetic resonance (MR) imaging features of the spinal cord and brain in patients of neuromyelitis optica (NMO). Between January 2001 and March 2010, the MR images (spinal cord, brain, and orbit) and the clinical and serologic findings of 11 NMO patients were retrospectively reviewed. The contrast-enhancement of the spinal cord was performed (20/23). The presence and pattern of the contrast-enhancement in the spinal cord were classified into 5 types. Acute myelitis was monophasic in 8 patients (8/11, 72.7%); and optic neuritis preceded acute myelitis in most patients. Longitudinally extensive cord lesion (average, 7.3 vertebral segments) was involved. The most common type was the diffuse and subtle enhancement of the spinal cord with a multifocal nodular, linear or segmental intense enhancement (45%). Most of the brain lesions (5/11, 10 lesions) were located in the brain stem, thalamus and callososeptal interphase. Anti-Ro autoantibody was positive in 2 patients, and they showed a high relapse rate of acute myelitis. Anti-NMO IgG was positive in 4 patients (4/7, 66.7%). The imaging findings of acute myelitis in NMO may helpful in making an early diagnosis of NMO which can result in a severe damage to the spinal cord, and to make a differential diagnosis of multiple sclerosis and inflammatory diseases of the spinal cord such as toxocariasis.

  4. Magnetic resonance imaging of facial nerve schwannoma. (United States)

    Thompson, Andrew L; Aviv, Richard I; Chen, Joseph M; Nedzelski, Julian M; Yuen, Heng-Wai; Fox, Allan J; Bharatha, Aditya; Bartlett, Eric S; Symons, Sean P


    This study characterizes the magnetic resonance (MR) appearances of facial nerve schwannoma (FNS). We hypothesize that the extent of FNS demonstrated on MR will be greater compared to prior computed tomography studies, that geniculate involvement will be most common, and that cerebellar pontine angle (CPA) and internal auditory canal (IAC) involvement will more frequently result in sensorineural hearing loss (SNHL). Retrospective study. Clinical, pathologic, and enhanced MR imaging records of 30 patients with FNS were analyzed. Morphologic characteristics and extent of segmental facial nerve involvement were documented. Median age at initial imaging was 51 years (range, 28-76 years). Pathologic confirmation was obtained in 14 patients (47%), and the diagnosis reached in the remainder by identification of a mass, thickening, and enhancement along the course of the facial nerve. All 30 lesions involved two or more contiguous segments of the facial nerve, with 28 (93%) involving three or more segments. The median segments involved per lesion was 4, mean of 3.83. Geniculate involvement was most common, in 29 patients (97%). CPA (P = .001) and IAC (P = .02) involvement was significantly related to SNHL. Seventeen patients (57%) presented with facial nerve dysfunction, manifesting in 12 patients as facial nerve weakness or paralysis, and/or in eight with involuntary movements of the facial musculature. This study highlights the morphologic heterogeneity and typical multisegment involvement of FNS. Enhanced MR is the imaging modality of choice for FNS. The neuroradiologist must accurately diagnose and characterize this lesion, and thus facilitate optimal preoperative planning and counseling.

  5. Magnetic resonance imaging of nasopharyngeal carcinoma

    International Nuclear Information System (INIS)

    Naito, Yasushi; Tamaki, Susumu; Kurata, Kyosuke; Honjo, Iwao; Nishimura, Kazumasa; Nakano, Yoshihisa


    Magnetic resonance imaging (MRI) of the nasopharynx, the eustachian tube and the middle ear was performed in nine patients with nasopharyngeal carcinoma. MRI revealed the extent of the tumor more clearly than CT (computed tomography) when the tumor was situated in the parapharyngeal space. But when the tumor extended superficially in the nasopharyngeal mucosa, its margin could not be identified clearly by either MRI or CT because of hypervascularity and long T1 and T2 of the nasopharyngeal mucosa. Seven of the nine patients had unilateral otitis media with effusion. Their eustachian tube ventilation function was evaluated by an inflation-deflation technique. Failure of active equalization of negative pressure applied to the middle ear was found to be a characteristic disorder of their eustachian tube ventilation function. This dysfunction seemed to be correlated with the lateral dislocation of the eustachian tube cartilage caused by the tumor. (author)

  6. Magnetic resonance imaging of traumatic cervical injury

    International Nuclear Information System (INIS)

    Juhng, S. K.; Lee, K. S.; Sohn, K. J.; Choi, S. S.; Won, J. J.


    To evaluate magnetic resonance imaging (MRI) findings of cevical injuries. MRI studies of 34 patients with cervical spinal injuries were analyzed retrospectively. All MRI scans were obtained with an 1.0T superconductive MRI scanner (Siemens Magnetom 42SPE) and their findings were analyzed regarding the spinal cord, bony spine, ligaments, and intervertebral disks. A variety of abnormal findings were detected: 25 cord abnormalities including cord compression (15 cases), cord edema (4 cases), syringomyelia (4 cases), myelomalacia (1 case), and hemorrhagic contusion (1 case), 18 ligamentous injuries, 22 disk herniations (9 post-traumatic, 13 chronic degenerative), 11 spine fractures, and 4 subluxations. MRI is useful in evaluating the spinal cord itself, in depicting ligamentous injuries, in establishing the presence of disc herniation, and in assessing the alignment of cervical spine

  7. Magnetic resonance imaging of traumatic cervical injury

    Energy Technology Data Exchange (ETDEWEB)

    Juhng, S. K.; Lee, K. S.; Sohn, K. J.; Choi, S. S.; Won, J. J. [Wonkwang University School of Medicine, Iri (Korea, Republic of)


    To evaluate magnetic resonance imaging (MRI) findings of cevical injuries. MRI studies of 34 patients with cervical spinal injuries were analyzed retrospectively. All MRI scans were obtained with an 1.0T superconductive MRI scanner (Siemens Magnetom 42SPE) and their findings were analyzed regarding the spinal cord, bony spine, ligaments, and intervertebral disks. A variety of abnormal findings were detected: 25 cord abnormalities including cord compression (15 cases), cord edema (4 cases), syringomyelia (4 cases), myelomalacia (1 case), and hemorrhagic contusion (1 case), 18 ligamentous injuries, 22 disk herniations (9 post-traumatic, 13 chronic degenerative), 11 spine fractures, and 4 subluxations. MRI is useful in evaluating the spinal cord itself, in depicting ligamentous injuries, in establishing the presence of disc herniation, and in assessing the alignment of cervical spine.

  8. Functional Magnetic Resonance Imaging in Consumer Research

    DEFF Research Database (Denmark)

    Reimann, Martin; Schilke, Oliver; Weber, Bernd


    of prior fMRI research related to consumer behavior and highlights the features that make fMRI an attractive method for consumer and marketing research. The authors discuss advantages and limitations and illustrate the proposed procedures with an applied study, which investigates loss aversion when buying......Although the field of psychology is undergoing an immense shift toward the use of functional magnetic resonance imaging (fMRI), the application of this methodology to consumer research is relatively new. To assist consumer researchers in understanding fMRI, this paper elaborates on the findings...... and selling a common product. Results reveal a significantly stronger activation in the amygdala while consumers estimate selling prices versus buying prices, suggesting that loss aversion is associated with the processing of negative emotion. © 2011 Wiley Periodicals, Inc....

  9. Imaging of Groin Pain: Magnetic Resonance and Ultrasound Imaging Features. (United States)

    Lee, Susan C; Endo, Yoshimi; Potter, Hollis G

    Evaluation of groin pain in athletes may be challenging as pain is typically poorly localized and the pubic symphyseal region comprises closely approximated tendons and muscles. As such, magnetic resonance imaging (MRI) and ultrasound (US) may help determine the etiology of groin pain. A PubMed search was performed using the following search terms: ultrasound, magnetic resonance imaging, sports hernia, athletic pubalgia, and groin pain. Date restrictions were not placed on the literature search. Clinical review. Level 4. MRI is sensitive in diagnosing pathology in groin pain. Not only can MRI be used to image rectus abdominis/adductor longus aponeurosis and pubic bone pathology, but it can also evaluate other pathology within the hip and pelvis. MRI is especially helpful when groin pain is poorly localized. Real-time capability makes ultrasound useful in evaluating the pubic symphyseal region, as it can be used for evaluation and treatment. MRI and US are valuable in diagnosing pathology in athletes with groin pain, with the added utility of treatment using US-guided intervention. Strength-of Recommendation Taxonomy: C.

  10. Magnetic resonance imaging of bone marrow disease in children

    International Nuclear Information System (INIS)

    Cohen, M.D.; Klatte, E.C.; Baehner, R.


    Seven children underwent magnetic resonance imaging (MRI) of the bone marrow: results showed that it is technically feasible to obtain good MR images of marrow in children. MR has detected abnormality in the bone marrow of a child who had metastatic neuroblastoma. The extent of abnormality in the femur correlated well with findings of a bone marrow isotope scan. In one child who had idiopathic aplastic anemia, diseased marrow could not be distinguished from normal marrow on MR images. MRI identified abnormality of the marrow in osteogenic sarcoma, and demonstrated change in response to chemotherapy. It displayed marrow spread of tumors as well as CT. MRI showed marrow abnormality in four children who had leukemia

  11. Detection of diminished response to cold pressor test in smokers: assessment using phase-contrast cine magnetic resonance imaging of the coronary sinus. (United States)

    Kato, Shingo; Kitagawa, Kakuya; Yoon, Yeonyee E; Nakajima, Hiroshi; Nagata, Motonori; Takase, Shinichi; Nakamori, Shiro; Ito, Masaaki; Sakuma, Hajime


    The purposes of this study were to evaluate the reproducibility for measuring the cold pressor test (CPT)-induced myocardial blood flow (MBF) alteration using phase-contrast (PC) cine MRI, and to determine if this approach could detect altered MBF response to CPT in smokers. After obtaining informed consent, ten healthy male non-smokers (mean age: 28±5 years) and ten age-matched male smokers (smoking duration ≥5 years, mean age: 28±3 years) were examined in this institutional review board approved study. Breath-hold PC cine MR images of the coronary sinus were obtained with a 3T MR imager with 32 channel coils at rest and during a CPT performed after immersing one foot in ice water. MBF was calculated as coronary sinus flow divided by the left ventricular (LV) mass which was given as a total LV myocardial volume measured on cine MRI multiplied by the specific gravity (1.05 g/mL). In non-smokers, MBF was 0.86±0.25 mL/min/g at rest, with a significant increase to 1.20±0.36 mL/min/g seen during CPT (percentage change of MBF (∆MBF (%)); 39.2%±14.4%, psmokers and non-smokers for resting MBF (0.85±0.32 mL/min/g, p=0.91). However, ∆MBF (%) in smokers was significantly reduced (-4.0±32.2% vs. 39.2±14.4%, p=0.011). PC cine MRI can be used to reproducibly quantify MBF response to CPT and to detect impaired flow response in smokers. This MR approach may be useful for monitoring the sequential change of coronary blood flow in various potentially pathologic conditions and for investigating its relationship with cardiovascular risk. Copyright © 2014 Elsevier Inc. All rights reserved.

  12. In vivo intracellular oxygen dynamics in murine brain glioma and immunotherapeutic response of cytotoxic T cells observed by fluorine-19 magnetic resonance imaging.

    Directory of Open Access Journals (Sweden)

    Jia Zhong

    Full Text Available Noninvasive biomarkers of anti-tumoral efficacy are of great importance to the development of therapeutic agents. Tumor oxygenation has been shown to be an important indicator of therapeutic response. We report the use of intracellular labeling of tumor cells with perfluorocarbon (PFC molecules, combined with quantitative ¹⁹F spin-lattice relaxation rate (R₁ measurements, to assay tumor cell oxygen dynamics in situ. In a murine central nervous system (CNS GL261 glioma model, we visualized the impact of Pmel-1 cytotoxic T cell immunotherapy, delivered intravenously, on intracellular tumor oxygen levels. GL261 glioma cells were labeled ex vivo with PFC and inoculated into the mouse striatum. The R₁ of ¹⁹F labeled cells was measured using localized single-voxel magnetic resonance spectroscopy, and the absolute intracellular partial pressure of oxygen (pO₂ was ascertained. Three days after tumor implantation, mice were treated with 2×10⁷ cytotoxic T cells intravenously. At day five, a transient spike in pO₂ was observed indicating an influx of T cells into the CNS and putative tumor cell apoptosis. Immunohistochemistry and quantitative flow cytometry analysis confirmed that the pO₂ was causally related to the T cells infiltration. Surprisingly, the pO₂ spike was detected even though few (∼4×10⁴ T cells actually ingress into the CNS and with minimal tumor shrinkage. These results indicate the high sensitivity of this approach and its utility as a non-invasive surrogate biomarker of anti-cancer immunotherapeutic response in preclinical models.

  13. Magnetic resonance imaging- physical principles and clinical application

    International Nuclear Information System (INIS)

    Tavri, O.J.


    The advances in imaging techniques for better and efficient diagnosis have become possible with the advent of Magnetic Resonance Imaging (MRI). The modalities of MRI technique for indication and diagnosis are mentioned in with typical examples. (author)

  14. Endorectal magnetic resonance imaging of a rectal duplication cyst. (United States)

    Beattie, C H; Garvey, C J; Hershman, M J


    A case of a duplication cyst of the rectum is presented. This case highlights the potential role of endoluminal magnetic resonance imaging in the diagnosis of this uncommon condition. Alternative imaging modalities and differential diagnoses are discussed.

  15. Magnetic resonance imaging for clinical management of rectal cancer

    DEFF Research Database (Denmark)

    Beets-Tan, Regina G H; Lambregts, Doenja M J; Maas, Monique


    OBJECTIVES: To update the 2012 ESGAR consensus guidelines on the acquisition, interpretation and reporting of magnetic resonance imaging (MRI) for clinical staging and restaging of rectal cancer. METHODS: Fourteen abdominal imaging experts from the European Society of Gastrointestinal and Abdomin...

  16. Magnetic resonance imaging of experimental brain edema

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Chuzo; Naruse, Shoji; Horikawa, Yoshiharu; Higuchi, Toshihiro; Ebisu, Toshihiko; Hirakawa, Kimiyoshi; Ohno, Yoshioki; Maki, Sou


    Experimental brain edema was produced by either cold injury or TET (triethyl-tin) intoxication in twenty-five Wistar rats, weighing about 250 g each, and then analyzed using MRI (magnetic resonance imaging). The MRI was carried out with a 0.1 Tesla clinical apparatus (Asahi Mark J), using a special coil (7 cm in diameter) devised for small animals in order to obtain SR, SE, IR, and calculated T/sub 1/ and T/sub 2/ images. A dose of 0.5 mmol/kg of Gd-DTPA was injected intravenously for the cold-injury edema, and MRIs of the rat brains were started immediately and obtained successively for 3 hours. MRI showed spatial resolution sufficient to differentiate the cortex from the caudate nucleus, even in such a small rat brain. Rat brains with TET intoxication (cytotoxic edema) showed a marked prolongation of T/sub 1/ and T/sub 2/ in the white matter. Consequently, the TET-intoxication images reflected these characteristic findings. Cold-induced edema showed an increased signal intensity in the injured cortex, the white matter, and the opposite white matter when compared with a normal brain. These changes correlate well with the previously reported in vitro data. When Gd-DTPA was administered to the rats with cold-induced edema, the signal intensity of the cold-injury lesion was significantly reduced. These changes were clearly demonstrated by the calculated T/sub 1/ images. To two rats we administered a dose of 0.5 mmol/kg of Gd-DTPA; The T/sub 1/ values for the cold-injury lesions, before and after the injection, were about 445 msec and about 200 msec respectively. These studies were useful not only in evaluating brain edema, but also in analysing the effect of Gd-DTPA on the brain edema.

  17. Role of chelates in magnetic resonance imaging studies

    Directory of Open Access Journals (Sweden)

    Tripathi Laxmi


    Full Text Available Imaging studies are tests performed with a variety of techniques that produce pictures of the inside of a patient′s body. Magnetic resonance imaging (MRI is an imaging technique based on the principles of nuclear magnetic resonance. MRI uses a powerful magnetic field, radio waves, and a computer to produce detailed pictures of organs, soft tissues, bone, and virtually all other internal body structures. Chelates have a wide application in such imaging techniques. Chelates in imaging studies are used alone as radioactive agents or conjugated to monoclonal antibodies or to DNA as radioactive agents. Technetium chelates and gadolinium chelates are being widely used as magnetic resonance contrast media.

  18. Whiplash Injuries Can be Visible by Functional Magnetic Resonance Imaging

    Directory of Open Access Journals (Sweden)

    Bengt H Johansson


    Full Text Available Whiplash trauma can result in injuries that are difficult to diagnose. Diagnosis is particularly difficult in injuries to the upper segments of the cervical spine (craniocervical joint [CCJ] complex. Studies indicate that injuries in that region may be responsible for the cervicoencephalic syndrome, as evidenced by headache, balance problems, vertigo, dizziness, eye problems, tinnitus, poor concentration, sensitivity to light and pronounced fatigue. Consequently, diagnosis of lesions in the CCJ region is important. Functional magnetic resonance imaging is a radiological technique that can visualize injuries of the ligaments and the joint capsules, and accompanying pathological movement patterns.

  19. Magnetic resonance imaging of the bone marrow in hematological malignancies

    International Nuclear Information System (INIS)

    Berg, B.C. vande; Lecouvet, F.E.; Maldague, B.; Malghem, J.; Michaux, L.; Ferrant, A.


    Despite its lack of specificity, magnetic resonance imaging (MRI) of the bone marrow has the potential to play a role in the management of patients with primary neoplastic disorders of the hematopoietic system, including lymphomas, leukemias and multiple myeloma. In addition to its use in the assessment of suspected spinal cord compression, bone marrow MRI could be used as a prognostic method or as a technique to assess the response to treatment. The current review addresses the common patterns of bone marrow involvement observed in primary neoplasms of the bone marrow, basic technical principles of bone marrow MRI, and several applications of MRI in selected clinical situations. (orig.) (orig.)

  20. The assessment of local response using magnetic resonance imaging at 3- and 6-month post chemoradiotherapy in patients with anal cancer

    Energy Technology Data Exchange (ETDEWEB)

    Kochhar, Rohit [The Christie NHS Foundation Trust, Department of Radiology, Manchester (United Kingdom); The University of Manchester, Manchester Academic Health Science Centre, Institute of Cancer Sciences, Manchester (United Kingdom); Renehan, Andrew G. [The University of Manchester, Manchester Academic Health Science Centre, Institute of Cancer Sciences, Manchester (United Kingdom); The Christie NHS Foundation Trust, Department of Surgery, Manchester (United Kingdom); Mullan, Damian; Carrington, Bernadette M. [The Christie NHS Foundation Trust, Department of Radiology, Manchester (United Kingdom); Chakrabarty, Bipasha [The Christie NHS Foundation Trust, Department of Histopathology, Manchester (United Kingdom); Saunders, Mark P. [The Christie NHS Foundation Trust, Department of Clinical Oncology, Manchester (United Kingdom)


    To assess the use of MRI-determined tumour regression grading (TRG) in local response assessment and detection of salvageable early local relapse after chemoradiotherapy (CRT) in patients with anal squamous cell carcinoma (ASCC). From a prospective database of patients with ASCC managed through a centralised multidisciplinary team, 74 patients who completed routine post-CRT 3- and 6-month MRIs (2009-2012) were reviewed. Two radiologists blinded to the outcomes consensus read and retrospectively assigned TRG scores [1 (complete response) to 5 (no response)] and related these to early local relapse (within 12 months) and disease-free survival (DFS). Seven patients had early local relapse. TRG 1/2 scores at 3 and 6 months had a 100 % negative predictive value; TRG 4/5 scores at 6 months had a 100 % positive predictive value. All seven patients underwent salvage R0 resections. We identified a novel 'tram-track' sign on MRI in over half of patients, with an NPV for early local relapse of 83 % at 6 months. No imaging characteristic or TRG score independently prognosticated for late relapse or 3-year DFS. Post-CRT 3- and 6-month MRI-determined TRG scores predicted salvageable R0 early local relapses in patients with ASCC, challenging current clinical guidelines. (orig.)