Effects of adrenergic agents on the expression of zebrafish (Danio rerio) vitellogenin Ao1
International Nuclear Information System (INIS)
Yin Naida; Jin Xia; He Jiangyan; Yin Zhan
2009-01-01
Teleost vitellogenins (VTGs) are large multidomain apolipoproteins, traditionally considered to be estrogen-responsive precursors of the major egg yolk proteins, expressed and synthesized mainly in hepatic tissue. The inducibility of VTGs has made them one of the most frequently used in vivo and in vitro biomarkers of exposure to estrogen-active substances. A significant level of zebrafish vtgAo1, a major estrogen responsive form, has been unexpectedly found in heart tissue in our present studies. Our studies on zebrafish cardiomyopathy, caused by adrenergic agonist treatment, suggest a similar protective function of the cardiac expressed vtgAo1. We hypothesize that its function is to unload surplus intracellular lipids in cardiomyocytes for 'reverse triglyceride transportation' similar to that found in lipid transport proteins in mammals. Our results also demonstrated that zebrafish vtgAo1 mRNA expression in heart can be suppressed by both α-adrenergic agonist, phenylephrine (PE) and β-adrenergic agonist, isoproterenol (ISO). Furthermore, the strong stimulation of zebrafish vtgAo1 expression in plasma induced by the β-adrenergic antagonist, MOXIsylyl, was detected by Enzyme-Linked ImmunoSorbent Assay (ELISA). Such stimulation cannot be suppressed by taMOXIfen, an antagonist to estrogen receptors. Thus, our present data indicate that the production of teleost VTG in vivo can be regulated not only by estrogenic agents, but by adrenergic signals as well.
Holbech, Henrik; Schröder, Kristoffer D; Nielsen, Marie L; Brande-Lavridsen, Nanna; Holbech, Bente Frost; Bjerregaard, Poul
2013-11-15
Isoflavones with estrogenic activity produced in Fabaceae plants are known to leach from agricultural areas to freshwater systems, but the effect of waterborne isoflavones in fish has not been thoroughly characterized. Therefore, the estrogenic effect of waterborne biochanin A was investigated in zebrafish (Danio rerio) and juvenile brown trout (Salmo trutta). Exposure of juvenile brown trout to 10 μg biochanin AL(-1) or higher caused marked vitellogenin induction after 9-10 days of exposure and so did exposure to 186 μg biochanin AL(-1) for 6h. Following 8d of exposure, a NOEC for induction of vitellogenin production in male zebrafish was 70 and LOEC 114 μg biochanin AL(-1). Exposure to 209 μg biochanin AL(-1) from hatch to 60 days post hatch (dph) caused a skewing of the sex ratio toward more phenotypic female zebrafish, but did not cause induction of vitellogenin in male and undifferentiated fish. (1) biochanin A elicits estrogenic effects in trout at environmentally realistic concentrations, (2) brown trout plasma vitellogenin concentrations respond to lower biochanin A exposure concentrations than vitellogenin concentrations in zebrafish homogenates and (3) concerning vitellogenin induction, the hypothesis should be tested if short term tests with zebrafish may show a higher sensitivity than partial life cycle tests. Copyright © 2013 Elsevier B.V. All rights reserved.
Mullinix, K P; Wetekam, W; Deeley, R G; Gordon, J I; Meyers, M; Kent, K A; Goldberger, R F
1976-01-01
We have investigated the estrogen-mediated induction of vitellogenin synthesis in rooster liver. We compared the concentrations of vitellogenin messenger RNA (mRNA) in the liver with the concentrations of vitellogenin in the sera of roosters that had recieved various treatments with estrogen. We found no vitellogenin mRNA in the livers of the unstimulated roosters. An initial injection of estrogen was attended by de novo synthesis of vitellogenin mRNA in the liver and accumulation of vitellogenin in the serum. When vitellogenin was no longer present in the serum or liver (the "post-estrogen-serum-negative" state), the liver was found to contain appreciable amounts of vitellogenin mRNA. This mRNA was of the same size as that found in the liver of the rooster actively synthesizing vitellogenin in response to estrogen. Whereas vitellogenin mRNA was in large polysomes in the livers of the roosters actively synthesizing vitellogenin, the vitellogenin mRNA in the liver of the post-estrogen-serum-negative rooster was not associated with polysomes. The possible relevance of these findings to the fact that the rooster responds differently to a primary stimulation with estrogen than to subsequent stimulations is discussed. PMID:1064017
Energy Technology Data Exchange (ETDEWEB)
Bourrachot, Stéphanie [Institut de Radioprotection et de Sûreté Nucléaire (IRSN), PRP-ENV/SERIS/LECO, Cadarache, Saint-Paul-lez-Durance 13115 (France); Brion, François [Institut National de l’Environnement Industriel et des Risques (INERIS), Unité d’évaluation des risques écotoxicologiques, BP2, 60550 Verneuil-en-Halatte (France); Pereira, Sandrine; Floriani, Magali; Camilleri, Virginie; Cavalié, Isabelle [Institut de Radioprotection et de Sûreté Nucléaire (IRSN), PRP-ENV/SERIS/LECO, Cadarache, Saint-Paul-lez-Durance 13115 (France); Palluel, Olivier [Institut National de l’Environnement Industriel et des Risques (INERIS), Unité d’évaluation des risques écotoxicologiques, BP2, 60550 Verneuil-en-Halatte (France); Adam-Guillermin, Christelle, E-mail: christelle.adam-guillermin@irsn.fr [Institut de Radioprotection et de Sûreté Nucléaire (IRSN), PRP-ENV/SERIS/LECO, Cadarache, Saint-Paul-lez-Durance 13115 (France)
2014-09-15
Highlights: • The effect of depleted uranium on zebrafish reproduction was studied. • An inhibition of egg production and an increase of F1 embryo mortality were observed. • Decreased circulating concentration of vitellogenin was observed in females. • Increased DNA damages were observed in parent gonads and in embryos. • U environmental concentration impairs reproduction and genetic integrity of fish. - Abstract: Despite the well-characterized occurrence of uranium (U) in the aquatic environment, very little is known about the chronic exposure of fish to low levels of U and its potential effect on reproduction. Therefore, this study was undertaken to investigate the effects of environmental concentrations of depleted U on the reproductive output of zebrafish (Danio rerio) and on survival and development of the F1 embryo-larvae following parental exposure to U. For that purpose, sexually mature male and female zebrafish were exposed to 20 and 250 μg/L of U for 14 days and allowed to reproduce in clean water during a further 14-day period. At all sampling times, whole-body vitellogenin concentrations and gonad histology were analyzed to investigate the effects of U exposure on these reproductive endpoints. In addition, accumulation of U in the gonads and its genotoxic effect on male and female gonad cells were quantified. The results showed that U strongly affected the capability of fish to reproduce and to generate viable individuals as evidenced by the inhibition of egg production and the increased rate of mortality of the F1 embryos. Interestingly, U exposure resulted in decreased circulating concentrations of vitellogenin in females. Increased concentrations of U were observed in gonads and eggs, which were most likely responsible for the genotoxic effects seen in fish gonads and in embryos exposed maternally to U. Altogether, these findings highlight the negative effect of environmentally relevant concentrations of U which alter the reproductive
International Nuclear Information System (INIS)
Bourrachot, Stéphanie; Brion, François; Pereira, Sandrine; Floriani, Magali; Camilleri, Virginie; Cavalié, Isabelle; Palluel, Olivier; Adam-Guillermin, Christelle
2014-01-01
Highlights: • The effect of depleted uranium on zebrafish reproduction was studied. • An inhibition of egg production and an increase of F1 embryo mortality were observed. • Decreased circulating concentration of vitellogenin was observed in females. • Increased DNA damages were observed in parent gonads and in embryos. • U environmental concentration impairs reproduction and genetic integrity of fish. - Abstract: Despite the well-characterized occurrence of uranium (U) in the aquatic environment, very little is known about the chronic exposure of fish to low levels of U and its potential effect on reproduction. Therefore, this study was undertaken to investigate the effects of environmental concentrations of depleted U on the reproductive output of zebrafish (Danio rerio) and on survival and development of the F1 embryo-larvae following parental exposure to U. For that purpose, sexually mature male and female zebrafish were exposed to 20 and 250 μg/L of U for 14 days and allowed to reproduce in clean water during a further 14-day period. At all sampling times, whole-body vitellogenin concentrations and gonad histology were analyzed to investigate the effects of U exposure on these reproductive endpoints. In addition, accumulation of U in the gonads and its genotoxic effect on male and female gonad cells were quantified. The results showed that U strongly affected the capability of fish to reproduce and to generate viable individuals as evidenced by the inhibition of egg production and the increased rate of mortality of the F1 embryos. Interestingly, U exposure resulted in decreased circulating concentrations of vitellogenin in females. Increased concentrations of U were observed in gonads and eggs, which were most likely responsible for the genotoxic effects seen in fish gonads and in embryos exposed maternally to U. Altogether, these findings highlight the negative effect of environmentally relevant concentrations of U which alter the reproductive
Influence of Propylparaben on Vitellogenesis and Sex Ratio in Juvenile Zebrafish (Danio rerio
Directory of Open Access Journals (Sweden)
Přemysl Mikula
2009-01-01
Full Text Available The aim of the study was to evaluate the xeno-oestrogenic potential of propylparaben in vivo using zebrafish (Danio rerio. Experimental juvenile zebrafish (20 days post hatching were fed a feed containing 500, 1000, or 2000 mg kg-1 of propylparaben, fish in a positive control group were given a feed treated with 20 mg kg-1 of 17β-oestradiol, and the control fish were given the feed free of either tested substance. The exposure of fish to propylparaben did not affect vitellogenesis after 20 days exposure but seemed to influence the sex differentiation processes, as evidenced by a sex ratio significantly skewed towards females in the group fed 500 mg kg-1 of propylparaben following 45 days of exposure. The potential of the fish to respond to oestrogenic stimulation was confirmed, since significantly higher vitellogenin concentrations were detected in the fish from the positive control group.
Energy Technology Data Exchange (ETDEWEB)
Wallace, R A; Deufel, R A; Misulovin, Z
1980-01-01
1. Labeled vitellogenins were isolated from the sera of several amphibians, a turtle, and a pigeon, and were incubated in vitro with oocytes from Xenopus laevis and Rana pipiens. 2. Oocytes from X. laevis sequestered vitellogenin from salamanders, turtle, and pigeon at rates comparable to that for autologous vitellogenin, while anuran vitellogenins were sequestered at somewhat lower rates. 3. Oocytes from R. pipiens sequestered X. laevis vitellogenin at a rate comparable to autologous vitellogenin, while salamander, turtle, and pigeon vitellogenins were sequestered at faster rates. 4. All vitellogenins examined appear to be recognized and incorporated specifically by X. laevis and R. pipiens oocytes.
DEFF Research Database (Denmark)
Baumann, Lisa; Knörr, Susanne; Keiter, Susanne
2014-01-01
The aim of the present study was to investigate the effects of the androgenic endocrine disruptor 17β-trenbolone on the sexual development of zebrafish (Danio rerio) with special emphasis on the question whether adverse outcomes of developmental exposure are reversible or persistent. An exposure...... scenario including a recovery phase was chosen to assess the potential reversibility of androgenic effects. Zebrafish were exposed to environmentally relevant concentrations of 17β-trenbolone (1 - 30 ng/L) from fertilization until completion of gonad sexual differentiation (60 days post-hatch, dph...... with respect to exposure duration nor to concentration. Gonad morphological masculinization as well as the decrease of vitellogenin persisted after depuration over 40 d in clean water. This lack of recovery suggests that androgenic effects on sexual development of zebrafish are irreversible....
AB, G.; Roskam, W. G.; Dijkstra, J.; Mulder, J.; Willems, M.; van der Ende, A.; Gruber, M.
1976-01-01
The messenger RNA of the hormone-induced protein vitellogenin was isolated from the liver of estrogen-treated roosters. Starting from total polysomal RNA, the vitellogenin messenger was purified 67-fold by oligo (dT)-cellulose chromatography and sizing on a sucrose gradient. The messenger was
cis- and trans-acting elements of the estrogen-regulated vitellogenin gene B1 of Xenopus laevis.
Wahli, W; Martinez, E; Corthésy, B; Cardinaux, J R
1989-01-01
Vitellogenin genes are expressed under strict estrogen control in the liver of female oviparous vertebrates. Gene transfer experiments using estrogen-responsive cells have shown that the 13 bp perfect palindromic element GGTCACTGTGACC found upstream of the Xenopus laevis vitellogenin gene A2 promoter mediates hormonal stimulation and thus, was called the estrogen-responsive element (ERE). In the Xenopus vitellogenin genes B1 and B2 there are two closely adjacent EREs with one or more base substitutions when compared to the consensus ERE GGTCANNNTGACC. On their own, these degenerated elements have only a low or no regulatory capacity at all but act together synergistically to form an estrogen-responsive unit (ERU) with the same strength as the perfect palindromic 13 bp element. Analysis of estrogen receptor binding to the gene B1 ERU revealed a cooperative interaction of receptor dimers to the two adjacent imperfect EREs which most likely explains the synergistic stimulation observed in vivo. Furthermore, a promoter activator element located between positions --113 and --42 of the gene B1 and functional in the human MCF-7 and the Xenopus B3.2 cells has been identified and shown to be involved in the high level of induced transcription activity when the ERE is placed at a distance from the promoter. Finally, a hormone-controlled in vitro transcription system derived from Xenopus liver nuclear extracts was exploited to characterize two additional novel cis-acting elements within the vitellogenin gene B1 promoter. One of them, a negative regulatory element (NRE), is responsible for repression of promoter activity in the absence of hormone. The second is related to the NF-I binding site and is required, together with the ERE, to mediate hormonal induction. Moreover, we detected three trans-acting activities in Xenopus liver nuclear extracts that interact with these regions and demonstrated that they participate in the regulation of the expression of the vitellogenin
The induction of vitellogenin mRNA in avian liver
Boogaart, Paul van den
1980-01-01
Vitellogenine is het precursor eiwit van de belangrijkste dooiereiwitten lipovitelline en fosvitine; vitellogenine wordt gemaakt in de lever van leggende hennen onder invloed van oestrogenen. In hanen kan de synthese van vitellogenine worden geïnduceerd door inspuiting van 17B-oestradiol. Na
DEFF Research Database (Denmark)
Örn, Stefan; Holbech, Henrik; Norrgren, Leif
2016-01-01
was to evaluate feminization and masculinization effects in zebrafish (Danio rerio) exposed to combinations of two synthetic steroid hormones detected in environmental waters: the androgen 17β-trenbolone (Tb) and the oestrogen 17α-ethinylestradiol (EE2). Juvenile zebrafish were exposed between days 20 and 60 post......Environmental estrogens and androgens can be present simultaneously in aquatic environments and thereby interact to disturb multiple physiological systems in organisms. Studies on interaction effects in fish of androgenic and estrogenic chemicals are limited. Therefore, the aim of the present study......-hatch to different binary mixtures of Tb (1, 10, and 50 ng/L) and EE2 (2 and 5 ng/L). The endpoints studied were whole-body homogenate vitellogenin concentration at 40 days post-hatch, and sex ratio including gonad maturation at 60 days post-hatch. The feminizing potency of 5 ng/L of EE2, alone as well...
Plasma vitellogenin in Morelet's crocodiles from contaminated habitats in northern Belize
International Nuclear Information System (INIS)
Rainwater, Thomas R.; Selcer, Kyle W.; Nespoli, Lisa M.; Finger, Adam G.; Ray, David A.; Platt, Steven G.; Smith, Philip N.; Densmore, Llewellyn D.; Anderson, Todd A.; McMurry, Scott T.
2008-01-01
Vitellogenin induction has been widely used as a biomarker of endocrine disruption in wildlife, but few studies have investigated its use in wild reptiles living in contaminated habitats. This study examined vitellogenin induction in Morelet's crocodiles (Crocodylus moreletii) from wetlands in northern Belize contaminated with organochlorine (OC) pesticides. Vitellogenin was measured in 381 crocodile plasma samples using a vitellogenin ELISA previously developed for this species. Vitellogenin was detected in nine samples, all from adult females sampled during the breeding season. Males and juvenile females did not contain detectable levels of vitellogenin; however, many of these animals contained OC pesticides in their caudal scutes, confirming contaminant exposure. The lack of a vitellogenic response in these animals may be attributable to several factors related to the timing and magnitude of exposure to endocrine-disrupting chemicals and should not be interpreted as an absence of other contaminant-induced biological responses. - Wild crocodiles living in habitats polluted with organochlorine pesticides did not exhibit contaminant-induced vitellogenin induction in blood plasma
The temporal pattern of vitellogenin synthesis in Drosophila grimshawi
International Nuclear Information System (INIS)
Kambysellis, M.P.; Hatzopoulos, P.; Craddock, E.M.
1989-01-01
The temporal pattern of protein production and, in particular, vitellogenin protein synthesis during the sexual maturation of Drosophila grimshawi females has been studied in vivo by briefly feeding the flies with 35S-methionine and 3H-amino acids. The overall level of incorporation was very low in young flies; it then progressively increased to reach a maximum with the onset of sexual maturity at 13-15 days. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analyses revealed three classes of proteins: those synthesized throughout the age spectrum, which constitute the majority of protein species; proteins synthesized primarily or only in young flies; and proteins synthesized only by the older flies. In this Drosophila species, the three vitellogenins (V1, V2, and V3) appeared to be synthesized in a two-phase pattern. In the first phase, small quantities of V1 and V2 were detected immunologically in the fat body and hemolymph of newly emerged and 1 day-old flies. These proteins did not accumulate in the hemolymph or the ovaries, apparently being unstable proteins. The second phase commenced in early vitellogenesis (7-9 days of age) with synthesis in the fat body of small quantities of V1 and V2, followed by V3 proteins. These proteins were secreted and accumulated in the hemolymph and 24 h later were found in the ovaries. Their quantities increased rapidly and a steady state of synthesis, release into the hemolymph, and uptake by the ovaries was reached by days 13-15. We have estimated that during the steady state of vitellogenin synthesis, a fly can synthesize in 24 h at least 152 micrograms of vitellogenins, which is more than 2% of its body weight, at an average rate of about 6.3 micrograms vitellogenins/h. About 2 micrograms of this are synthesized in the fat body, and about 4 micrograms in the ovaries
Directory of Open Access Journals (Sweden)
Kimberly Smelker
2014-01-01
Full Text Available Vitellogenin is the egg yolk precursor protein produced by oviparous vertebrates. As endogenous estrogen increases during early reproductive activity, hepatic production of vitellogenin is induced and is assumed to be complete in female sea turtles before the first nesting event. Until the present study, innate production of vitellogenin has not been described in free-ranging sea turtles. Our study describes circulating concentrations of vitellogenin in loggerhead sea turtles (Caretta caretta from the Northwest Atlantic Ocean. We collected blood samples from juveniles and adults via in-water captures off the coast of the Southeast USA from May to August, and from nesting females in June and July at Hutchinson Island, Florida. All samples were analyzed using an in-house ELISA developed specifically to measure Caretta caretta vitellogenin concentration. As expected, plasma vitellogenin declined in nesting turtles as the nesting season progressed, although it still remained relatively elevated at the end of the season. In addition, mean vitellogenin concentration in nesting turtles was 1,000 times greater than that measured in samples from in-water captures. Our results suggest that vitellogenesis may continue throughout the nesting season, albeit at a decreasing rate. Further, vitellogenin detected in turtles captured in-water may have resulted from exposure to endocrine disrupting chemicals.
Primary induction of vitellogenin mRNA in the rooster by 17beta-estradiol.
Burns, A T; Deeley, R G; Gordon, J I; Udell, D S; Mullinix, K P; Goldberger, R F
1978-01-01
We have studied the kinetics of vitellogenin mRNA accumulation in rooster liver after a primary injection of 17beta-estradiol. The levels of vitellogenin mRNA have been determined both by hybridization of total cellular RNA to vitellogenin cDNA and by translation of vitellogenin mRNA in a wheat germ cell-free system. The results obtained by both methods of analysis are in good agreement and indicate that vitellogenin mRNA is present in the liver of normal roosters at a level of 0-5 molecules per liver cell and increases in amount during the 3 days following injection of estrogen, reaching a level of almost 6000 molecules per cell at the peak of the response. The level of vitellogenin mRNA declined exponentially during the next 14 days with a half-life of 29 hr, reaching a level of less than 10 molecules per cell at 17 days after injection of the hormone. The levels of vitellogenin mRNA after stimulation with estrogen have been correlated with the in vivo rate of synthesis of the vitellogenin polypeptide. The results indicate that the rate of vitellogenin synthesis is closely correlated with the level of vitellogenin mRNA. On the basis of these findings, we conclude that vitellogenin mRNA does not exist in the liver in an untranslated form after withdrawal from estrogen. PMID:273910
Oral exposure of adult zebrafish (Danio rerio) to 2,4,6-tribromophenol affects reproduction
DEFF Research Database (Denmark)
Halden, Anna Norman; Nyholm, Jenny Rattfelt; Andersson, Patrik L
2010-01-01
The bromophenol 2,4,6-tribromophenol (TBP) is widely used as an industrial chemical, formed by degradation of tetrabromobisphenol-A, and it occurs naturally in marine organisms. Concentrations of TBP in fish have been related to intake via feed, but little is known about effects on fish health...... after oral exposure. In this study, we exposed adult male and female zebrafish (Danio rerio) to TBP via feed in nominal concentrations of 33, 330, and 3300 mu g/g feed (or control feed) for 6 weeks to assess the effects of TBP on reproductive output, gonad morphology, circulatory vitellogenin levels......, and early embryo development. The aim was also to investigate the extent to which TBP was metabolised to 2,4,6-tribromoanisole (IBA) in dietary exposed zebrafish, and the amounts of TBP and TBA found in offspring. After 6 weeks of exposure, we found about 3% of the daily dose of TBP in adult fish...
Tokar, Derek R; Veleta, Katherine A; Canzano, Joseph; Hahn, Daniel A; Hatle, John D
2014-11-01
Reduced reproduction extends lifespan of females in many animals. To test the effects of reproduction on storage of macronutrients, we block reproductive output in the lubber grasshopper by injecting RNAi against the precursor to egg-yolk protein, vitellogenin, in early adulthood. Controls were injected with either buffer or RNAi against the major storage protein in the hemolymph, hexamerin-90. Vitellogenin RNAi greatly reduced both levels of mRNA for vitellogenin and ovarian growth, in comparison to both controls. Fat body mass was increased upon vitellogenin RNAi, but concentrations of the three hexameric storage proteins from the hemolymph were not. Surprisingly, hemolymph vitellogenin levels were increased upon vitellogenin RNAi. Total reproductive protein (hemolymph vitellogenin plus ovarian vitellin) was unchanged by vitellogenin RNAi, as reproductive protein was diverted to the hemolymph. Similarly, the increased lipid storage upon vitellogenin RNAi was largely attributable to the reduction in lipid in the ovary, due to decreased ovarian growth. A BLAST search revealed that the 515 bp sequence of vitellogenin used for RNAi had three 11 bp regions identical to the vitellogenin receptor of the cockroach Leucophaea maderae. This suggests that our treatment, in addition to reducing levels of vitellogenin transcript, may have also blocked transport of vitellogenin from the hemolymph to the ovary. This would be consistent with halted ovarian growth simultaneous with high levels of vitellogenin in the hemolymph. Nonetheless, the accumulation of vitellogenin, instead of hexameric storage proteins, is inconsistent with a simple model of the trade-off between reproduction and storage. This was observed in young females; future studies will address whether investment of proteins may shift to the soma as individuals age. Overall, our results suggest that blockage of reproduction in young grasshoppers redirects lipids to storage and reproductive proteins to the hemolymph
International Nuclear Information System (INIS)
Gapp, D.A.; Ho, S.M.; Callard, I.P.
1979-01-01
A RIA for turtle (Chrysemys picta) vitellogenin is described. After dimethylformamide precipitation of vitellogenin from the plasma of estrogen-treated female turtles, antibodies were developed in rabbits. The dimethylformamide precipitate was further purified by o-triethylaminoethyl cellulose column chromatography; the vitellogenin component eluted as a single peak. This material was used for iodination by a mild chloramine method. Antibodies to turtle vitellogenin did not cross-react with plasma from male turtles or vitellogenic females of other vertebrate groups, including lizards and snakes. Limited cross-reactivity exists among the chelonians, however. Using a 1:5000 dilution of antiserum, the limit of detection was 15 ng, and the midrange was 320 +- 45 ng. For an antiserum dilution of 1:1000, these figures were 30 and 600 +- 37 ng, respectively. Using this assay, the seasonal pattern of plasma vitellogenin in the turtle has been described, and preliminary studies on in vitro hepatic vitellogenesis have been performed
Plasma vitellogenin in Morelet's crocodiles from contaminated habitats in northern Belize
Energy Technology Data Exchange (ETDEWEB)
Rainwater, Thomas R. [Institute of Environmental and Human Health and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States)], E-mail: thomas.rainwater@gmail.com; Selcer, Kyle W. [Department of Biological Sciences, Bayer School of Natural and Environmental Sciences, Duquesne University, Pittsburgh, PA 15282 (United States)], E-mail: selcer@duq.edu; Nespoli, Lisa M. [Department of Biological Sciences, Bayer School of Natural and Environmental Sciences, Duquesne University, Pittsburgh, PA 15282 (United States)], E-mail: nespoli345@duq.edu; Finger, Adam G. [Institute of Environmental and Human Health and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States)], E-mail: agfinger@tiehh.ttu.edu; Ray, David A. [Department of Biological Sciences, Texas Tech University, Lubbock, TX 79409 (United States)], E-mail: david.ray@mail.wvu.edu; Platt, Steven G. [Department of Biology, P.O. Box C-64, Sul Ross State University, Alpine, TX 79832 (United States)], E-mail: splatt@sulross.edu; Smith, Philip N. [Institute of Environmental and Human Health and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States)], E-mail: philip.smith@tiehh.ttu.edu; Densmore, Llewellyn D. [Department of Biological Sciences, Texas Tech University, Lubbock, TX 79409 (United States)], E-mail: lou.densmore@ttu.edu; Anderson, Todd A. [Institute of Environmental and Human Health and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States)], E-mail: todd.anderson@tiehh.ttu.edu; McMurry, Scott T. [Institute of Environmental and Human Health and Department of Environmental Toxicology, Texas Tech University, Box 41163, Lubbock, TX 79409-1163 (United States)], E-mail: scott.mcmurry@tiehh.ttu.edu
2008-05-15
Vitellogenin induction has been widely used as a biomarker of endocrine disruption in wildlife, but few studies have investigated its use in wild reptiles living in contaminated habitats. This study examined vitellogenin induction in Morelet's crocodiles (Crocodylus moreletii) from wetlands in northern Belize contaminated with organochlorine (OC) pesticides. Vitellogenin was measured in 381 crocodile plasma samples using a vitellogenin ELISA previously developed for this species. Vitellogenin was detected in nine samples, all from adult females sampled during the breeding season. Males and juvenile females did not contain detectable levels of vitellogenin; however, many of these animals contained OC pesticides in their caudal scutes, confirming contaminant exposure. The lack of a vitellogenic response in these animals may be attributable to several factors related to the timing and magnitude of exposure to endocrine-disrupting chemicals and should not be interpreted as an absence of other contaminant-induced biological responses. - Wild crocodiles living in habitats polluted with organochlorine pesticides did not exhibit contaminant-induced vitellogenin induction in blood plasma.
DNA sequence and prokaryotic expression analysis of vitellogenin ...
African Journals Online (AJOL)
In this study, the DNA sequence of vitellogenin from Antheraea pernyi (Ap-Vg) was identified and its functional domain (30-740 aa, Ap-Vg-1) was expressed in Escherichia coli BL21 (DE3) cells. The recombinant Ap-Vg-1 proteins were purified and used for antibody preparation. The results showed that the intact DNA ...
International Nuclear Information System (INIS)
Kraugerud, Marianne; Doughty, Richard William; Lyche, Jan L.; Berg, Vidar; Tremoen, Nina H.; Alestrøm, Peter; Aleksandersen, Mona; Ropstad, Erik
2012-01-01
Persistent organic pollutants such as polychlorinated biphenyls (PCBs), polybrominated diphenyl ethers (PBDEs) and dichlorodiphenyltrichloroethane (DDT) are present in high concentrations in livers of burbot (Lota lota) in Lake Mjøsa, Norway. In order to assess effects of such pollutants on fish gonadal morphology, female zebrafish were exposed in two generations by food to mixtures of pollutants extracted from livers of burbot from Lake Mjøsa (high and low dose) and Lake Losna, which represents background pollution, and compared to a control group. Ovarian follicle counts detected a significant decrease in late vitellogenic follicle stages in fish exposed to the Losna and the high concentrations of Mjøsa mixtures in fish from the first generation. In addition, proliferation of granulosa cells, visualized by immunohistochemistry against proliferating cell nuclear antigen (PCNA), was decreased in all exposure groups in either early or late vitellogenic follicle stages compared to control. This was accompanied by increased apoptosis of granulosa cells. There was a decrease in proliferation of liver hepatocytes with exposure to both Mjøsa mixtures. In addition, immunopositivity for vitellogenin in the liver was significantly lower in the Mjøsa high group than in the control group. When analysing effects of parental exposure, fish with parents exposed to Mjøsa high mixture had significantly higher numbers of perinucleolar follicles than fish with control parents. We conclude that long-term exposure of a real-life mixture of pollutants containing high- and background levels of chemicals supress ovarian follicle development, liver vitellogenin immunostaining intensity and hepatocyte proliferation in the zebrafish model.
Energy Technology Data Exchange (ETDEWEB)
Kraugerud, Marianne, E-mail: Marianne.Kraugerud@nvh.no [Dept. of Basic Sciences and Aquatic Medicine, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway); Doughty, Richard William, E-mail: vetrwdoughty@yahoo.co.uk [Sundveien 22, 2015 Leirsund (Norway); Lyche, Jan L., E-mail: Jan.Lyche@nvh.no [Dept. of Food Safety and Infection Biology, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway); Berg, Vidar, E-mail: Vidar.Berg@nvh.no [Dept. of Food Safety and Infection Biology, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway); Tremoen, Nina H., E-mail: Nina.Hardnes@nvh.no [Dept. of Production Animal Clinical Sciences, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway); Alestrom, Peter, E-mail: Peter.Alestrom@nvh.no [Dept. of Basic Sciences and Aquatic Medicine, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway); Aleksandersen, Mona, E-mail: Mona.Aleksandersen@nvh.no [Dept. of Basic Sciences and Aquatic Medicine, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway); Ropstad, Erik, E-mail: Erik.Ropstad@nvh.no [Dept. of Production Animal Clinical Sciences, Norwegian School of Veterinary Science, POB 8146 Dep., 0033 Oslo (Norway)
2012-07-15
Persistent organic pollutants such as polychlorinated biphenyls (PCBs), polybrominated diphenyl ethers (PBDEs) and dichlorodiphenyltrichloroethane (DDT) are present in high concentrations in livers of burbot (Lota lota) in Lake Mjosa, Norway. In order to assess effects of such pollutants on fish gonadal morphology, female zebrafish were exposed in two generations by food to mixtures of pollutants extracted from livers of burbot from Lake Mjosa (high and low dose) and Lake Losna, which represents background pollution, and compared to a control group. Ovarian follicle counts detected a significant decrease in late vitellogenic follicle stages in fish exposed to the Losna and the high concentrations of Mjosa mixtures in fish from the first generation. In addition, proliferation of granulosa cells, visualized by immunohistochemistry against proliferating cell nuclear antigen (PCNA), was decreased in all exposure groups in either early or late vitellogenic follicle stages compared to control. This was accompanied by increased apoptosis of granulosa cells. There was a decrease in proliferation of liver hepatocytes with exposure to both Mjosa mixtures. In addition, immunopositivity for vitellogenin in the liver was significantly lower in the Mjosa high group than in the control group. When analysing effects of parental exposure, fish with parents exposed to Mjosa high mixture had significantly higher numbers of perinucleolar follicles than fish with control parents. We conclude that long-term exposure of a real-life mixture of pollutants containing high- and background levels of chemicals supress ovarian follicle development, liver vitellogenin immunostaining intensity and hepatocyte proliferation in the zebrafish model.
Acute toxicity and gene responses induced by endosulfan in zebrafish (Danio rerio embryos
Directory of Open Access Journals (Sweden)
Young-Sun Moon
2016-10-01
Full Text Available Endosulfan has been listed as a persistent organic pollutant, and is frequently found in agricultural environments during monitoring processes owing to its heavy use and persistent characteristics. This study was conducted to understand the effects of endosulfan on the development of zebrafish (Danio rerio embryos by exposing them to a specific range of endosulfan concentrations. Exposing zebrafish embryos to endosulfan for 96 h yielded no acute toxicity until the concentration reached 1500 μg L−1, whereas malformed zebrafish larvae developed severely curved spines and shortened tails. About 50% of zebrafish larvae were malformed when exposed to 600 μg L−1 of endosulfan. Comparative gene expression using real-time quantitative polymerase chain reaction was assessed using endosulfan-exposed zebrafish embryos. CYP1A and CYP3A were significantly enhanced in response to endosulfan treatment. Two genes, acacb and fasn, encoding acetyl-CoA carboxylase b and fatty acid synthase proteins, respectively, were also up-regulated after treating zebrafish embryos with endosulfan. These genes are also involved in fatty acid biosynthesis. The genes encoding vitellogenin and Hsp70 increased in a concentration-dependent manner in embryos. Finally, biochemical studies showed that acetylcholinesterase activity was reduced, whereas glutathione S-transferase and carboxylesterase activities were enhanced in zebrafish embryos after endosulfan treatment. These biochemical and molecular biological differences might be used for tools to determine contamination of endosulfan in the aquatic environment.
Regulation and dysregulation of vitellogenin mRNA accumulation in daphnids (Daphnia magna)
Energy Technology Data Exchange (ETDEWEB)
Hannas, Bethany R.; Wang, Ying H.; Thomson, Susanne; Kwon, Gwijun; Hong, Li [Department of Environmental and Molecular Toxicology, North Carolina State University, Raleigh, NC 27695-7633 (United States); LeBlanc, Gerald A., E-mail: Gerald_LeBlanc@ncsu.edu [Department of Environmental and Molecular Toxicology, North Carolina State University, Raleigh, NC 27695-7633 (United States)
2011-01-25
The induction of vitellogenin in oviparous vertebrates has become the gold standard biomarker of exposure to estrogenic chemicals in the environment. This biomarker of estrogen exposure also has been used in arthropods, however, little is known of the factors that regulate the expression of vitellogenin in these organisms. We investigated changes in accumulation of mRNA products of the vitellogenin gene Vtg2 in daphnids (Daphnia magna) exposed to a diverse array of chemicals. We further evaluated the involvement of hormonal factors in the regulation of vitellogenin expression that may be targets of xenobiotic chemicals. Expression of the Vtg2 gene was highly responsive to exposure to various chemicals with an expression range spanning approximately four orders of magnitude. Chemicals causing the greatest induction were piperonyl butoxide, chlordane, 4-nonylphenol, cadmium, and chloroform. Among these, only 4-nonylphenol is recognized to be estrogenic. Exposure to several chemicals also suppressed Vtg2 mRNA levels, as much as 100-fold. Suppressive chemicals included cyproterone acetate, acetone, triclosan, and atrazine. Exposure to the estrogens diethylstilbestrol and bisphenol A had little effect on vitellogenin mRNA levels further substantiating that these genes are not induced by estrogen exposure. Exposure to the potent ecdysteroids 20-hydroxyecdysone and ponasterone A revealed that Vtg2 was subject to strong suppressive control by these hormones. Vtg2 mRNA levels were not significantly affected from exposure to several juvenoid hormones. Results indicate that ecdysteroids are suppressors of vitellogenin gene expression and that vitellogenin mRNA levels can be elevated or suppressed in daphnids by xenobiotics that elicit antiecdysteroidal or ecdysteroidal activity, respectively. Importantly, daphnid Vtg2 is not elevated in response to estrogenic activity.
Regulation and dysregulation of vitellogenin mRNA accumulation in daphnids (Daphnia magna)
International Nuclear Information System (INIS)
Hannas, Bethany R.; Wang, Ying H.; Thomson, Susanne; Kwon, Gwijun; Li Hong; LeBlanc, Gerald A.
2011-01-01
The induction of vitellogenin in oviparous vertebrates has become the gold standard biomarker of exposure to estrogenic chemicals in the environment. This biomarker of estrogen exposure also has been used in arthropods, however, little is known of the factors that regulate the expression of vitellogenin in these organisms. We investigated changes in accumulation of mRNA products of the vitellogenin gene Vtg2 in daphnids (Daphnia magna) exposed to a diverse array of chemicals. We further evaluated the involvement of hormonal factors in the regulation of vitellogenin expression that may be targets of xenobiotic chemicals. Expression of the Vtg2 gene was highly responsive to exposure to various chemicals with an expression range spanning approximately four orders of magnitude. Chemicals causing the greatest induction were piperonyl butoxide, chlordane, 4-nonylphenol, cadmium, and chloroform. Among these, only 4-nonylphenol is recognized to be estrogenic. Exposure to several chemicals also suppressed Vtg2 mRNA levels, as much as 100-fold. Suppressive chemicals included cyproterone acetate, acetone, triclosan, and atrazine. Exposure to the estrogens diethylstilbestrol and bisphenol A had little effect on vitellogenin mRNA levels further substantiating that these genes are not induced by estrogen exposure. Exposure to the potent ecdysteroids 20-hydroxyecdysone and ponasterone A revealed that Vtg2 was subject to strong suppressive control by these hormones. Vtg2 mRNA levels were not significantly affected from exposure to several juvenoid hormones. Results indicate that ecdysteroids are suppressors of vitellogenin gene expression and that vitellogenin mRNA levels can be elevated or suppressed in daphnids by xenobiotics that elicit antiecdysteroidal or ecdysteroidal activity, respectively. Importantly, daphnid Vtg2 is not elevated in response to estrogenic activity.
Transfer of Immunity from Mother to Offspring Is Mediated via Egg-Yolk Protein Vitellogenin.
Directory of Open Access Journals (Sweden)
Heli Salmela
2015-07-01
Full Text Available Insect immune systems can recognize specific pathogens and prime offspring immunity. High specificity of immune priming can be achieved when insect females transfer immune elicitors into developing oocytes. The molecular mechanism behind this transfer has been a mystery. Here, we establish that the egg-yolk protein vitellogenin is the carrier of immune elicitors. Using the honey bee, Apis mellifera, model system, we demonstrate with microscopy and western blotting that vitellogenin binds to bacteria, both Paenibacillus larvae--the gram-positive bacterium causing American foulbrood disease--and to Escherichia coli that represents gram-negative bacteria. Next, we verify that vitellogenin binds to pathogen-associated molecular patterns; lipopolysaccharide, peptidoglycan and zymosan, using surface plasmon resonance. We document that vitellogenin is required for transport of cell-wall pieces of E. coli into eggs by imaging tissue sections. These experiments identify vitellogenin, which is distributed widely in oviparous species, as the carrier of immune-priming signals. This work reveals a molecular explanation for trans-generational immunity in insects and a previously undescribed role for vitellogenin.
Cohen, Alejandro M.; Banoub, Joseph H.
Vitellogenin is a complex phosphoglycolipoprotein that is secreted into the bloodstream of sexually mature, female, oviparous animals in response to circulating estrogens. It is then incorporated into the ovaries by receptor mediated endocytosis, where it is further cleaved to form the major constituents of the egg yolk proteins. It is generally accepted that these protein and peptide products serve as the main nutritional reserve for the developing embryo. Quantification of vitellogenin in blood is useful for different purposes. The reproductive status and degree of sexual maturation of oviparous animals can be assessed according to the levels of vitellogenin in plasma. The expression of this protein can also be induced in males under the effect of estrogenic compounds. Relying on this observation, vitellogenin has been used as a unique biomarker of environmental endocrine disruption in many species. In this respect, vitellogenin levels could potentially be used to assess the use of chemical warefare compounds with estrogenic activity. In this paper we review a technique developed for measuring vitellogenin plasma levels of different fish species using high performance liquid chromatography coupled to tandem mass spectrometry.
Roex, E.W.M.; Giovannangelo, M.E.C.A.; van Gestel, C.A.M.
2001-01-01
Most organic pollutants are supposed to act via the mechanism of nonpolar narcosis upon acute exposure. Because the chronic effects of these compounds are still relatively unknown, in this study a chronic toxicity experiment was performed with zebrafish, Danio rerio, exposed to 1, 2,
Vitellogenin messenger rna in rooster liver
Bos, Ebo Sijbren
1975-01-01
The investigations described in this thesis were carried out as a part of the studies in our laboratory on the control of gene expression in animal cells. They represent an example of the hormonal regulation of protein synthesis, viz. the induction of vitellogenin synthesis in rooster liver by the
Dominguez, Gustavo A.; Quattro, Joseph M.; Denslow, Nancy D.; Kroll, Kevin J.; Prucha, Melinda S.; Porak, Wesley F.; Grier, Harry J.; Sabo-Attwood, Tara L.
2012-01-01
Fish vitellogenin synthesized and released from the liver of oviparous animals is taken up into oocytes by the vitellogenin receptor. This is an essential process in providing nutrient yolk to developing embryos to ensure successful reproduction. Here we disclose the full length vtgr cDNA sequence for largemouth bass (LMB) that reveals greater than 90% sequence homology with other fish vtgr sequences. We classify LMB Vtgr as a member of the low density lipoprotein receptor superfamily based o...
Nitrite toxicity assessment in Danio rerio and Poecilia reticulata
Directory of Open Access Journals (Sweden)
Petra Doleželová
2011-01-01
Full Text Available Nitrite is a natural component of the nitrogen cycle in the environment. Although it usually occurs in low concentrations, elevated concentrations caused by effluents or affected nitrification process can lead to serious health deterioration of fish. Two aquarium fish zebrafish (Danio rerio and guppy (Poecilia reticulata are recommended to use as model organisms in toxicity tests. However, their sensitivity to nitrite can differ. The aim of this study was to define acute toxicity of nitrite by the semistatic method according to OECD No. 203 (Fish, Acute toxicity test. The series of 4 acute toxicity tests was performed, with 10 fish of both species used for each concentration and for the control. The 96hLC50 NO2- value for D. rerio and P. reticulata was 242.55 ± 15.79 mg·l-1 and 30.2 ± 8.74 mg·l-1, respectively. We have proved significant difference (p D. rerio and P. reticulata. The results showed different sensitivities to nitrites in tested fish species, which could be related to species-specific branchial chloride uptake mechanism. This is the first study on this fish species.
Marco Antonio, David Santos; Guidugli-Lazzarini, Karina Rosa; Do Nascimento, Adriana Mendes; Simões, Zilá Luz Paulino; Hartfelder, Klaus
2008-10-01
The switch from within-hive activities to foraging behavior is a major transition in the life cycle of a honeybee ( Apis mellifera) worker. A prominent regulatory role in this switch has long been attributed to juvenile hormone (JH), but recent evidence also points to the yolk precursor protein vitellogenin as a major player in behavioral development. In the present study, we injected vitellogenin double-stranded RNA (dsVg) into newly emerged worker bees of Africanized genetic origin and introduced them together with controls into observation hives to record flight behavior. RNA interference-mediated silencing of vitellogenin gene function shifted the onset of long-duration flights (>10 min) to earlier in life (by 3 4 days) when compared with sham and untreated control bees. In fact, dsVg bees were observed conducting such flights extremely precociously, when only 3 days old. Short-duration flights (<10 min), which bees usually perform for orientation and cleaning, were not affected. Additionally, we found that the JH titer in dsVg bees collected after 7 days was not significantly different from the controls. The finding that depletion of the vitellogenin titer can drive young bees to become extremely precocious foragers could imply that vitellogenin is the primary switch signal. At this young age, downregulation of vitellogenin gene activity apparently had little effect on the JH titer. As this unexpected finding stands in contrast with previous results on the vitellogenin/JH interaction at a later age, when bees normally become foragers, we propose a three-step sequence in the constellation of physiological parameters underlying behavioral development.
Lafontaine, Anne; Hanikenne, Marc; Boulangé-Lecomte, Céline; Forget-Leray, Joëlle; Thomé, Jean-Pierre; Gismondi, Eric
2016-10-01
Chlordecone is a persistent organochlorine pesticide widely used in Guadeloupe (French West Indies) to control the banana weevil Cosmopolites sordidus. Although it was previously highlighted that chlordecone may affect the reproduction and growth of vertebrate species, little information is available on the chlordecone effects in invertebrates. The present study investigated the effects of chlordecone on a hormone and a protein having key roles in reproduction and growth of the decapod crustacean Macrobrachium rosenbergii, by measuring the 20-hydroxyecdysone concentration, vitellogenin, and vitellogenin receptor gene expression, as well as the bioconcentration of chlordecone in exposed prawns. First, the results revealed that chlordecone was accumulated in M. rosenbergii. Then, it was found that Vg and VgR gene expression were increased in male and female M. rosenbergii exposed to chlordecone for 90 and 240 days, while the 20-hydroxyecdysone concentrations were decreased. This work suggests that chlordecone accumulates in prawn tissues and could affect key molecules involved in the reproduction and the growth of the invertebrate M. rosenbergii. However, many questions remain unresolved regarding the impacts of chlordecone on growth and reproduction and the signaling pathways responsible for these effects, as well as the potential role of confounding factors present in in situ studies.
Quantification of vitellogenin in Atlantic salmon (Salmo salar) plasma by radioimmunoassay
International Nuclear Information System (INIS)
Idler, D.R.; Hwang, S.J.; Crim, L.W.
1979-01-01
An antibody prepared against salmon egg yolk proteins has been used to quantify Atlantic salmon (Salmo salar) plasma vitellogenin using radioimmunoassay. A low molecular weight fraction isolated from salmon egg yolk was used for radioiodination and as standard solution because plasma vitellogenin could not be iodinated successfully. Parallelism of the egg yolk standard to displacement given by a fraction isolated from vitellogenic salmon plasma and dilutions of plasma samples allowed the assay to be used to evaluate the state of gonadal development of migrating females several months in advance of spawning and for sexing relatively immature salmon. (author)
International Nuclear Information System (INIS)
Moncaleano-Niño, Angela M.; Barrios-Latorre, Sergio A.; Poloche-Hernández, Javier F.; Becquet, Vanessa; Huet, Valérie; Villamil, Luisa; Thomas-Guyon, Hélène; Ahrens, Michael J.; Luna-Acosta, Andrea
2017-01-01
Highlights: • The cup oyster Saccostrea sp. is present in Santa Marta, Colombian Caribbean. • 96 h exposure of oysters to Cd increased metallothionein concentrations in digestive glands up to 2-fold. • 96 h exposure of oysters to Cd decreased vitellogenin concentrations in gonads up to 6-fold. • Metallothionein and vitellogenin tissue concentrations correlated with whole tissue Cd concentrations. • Significant changes in metallothionein and vitellogenin levels were only evident at Cd concentrations above 100 μg/L. - Abstract: Metallothioneins and vitellogenins are low molecular weight proteins that have been used widely in environmental monitoring as biomarkers of exposure and damage to metals and estrogenic compounds, respectively. In the present study, the responses of metallothionein and vitellogenin tissue concentrations were measured following acute (96 h) aqueous exposures to cadmium in Saccostrea sp., a tropical cup oyster native to the Western Pacific Ocean that has recently established itself in the Caribbean Sea. Adult oysters (1.5–5.0 cm shell length) collected from the municipal marina of Santa Marta, Colombia (Caribbean Sea) and acclimated for 5 days in the laboratory, were exposed to Cd at five concentrations (0, 1, 10, 100 and 1000 μg/L) and their tissues (gills, digestive gland and adductor muscle) were analyzed in pools of 5 individuals (3 replicates per concentration). Metallothioneins in digestive glands of oysters exposed to Cd concentrations ≥ 100 μg/L showed a significant increase, from 8.0 to 14.8 μg MT/mg total protein, whereas metallothionein concentrations in gills increased to lesser extent, and no differences were observed in adductor muscle. Metallothionein concentrations in digestive gland and gills correlated directly with whole soft tissue Cd concentrations (ranging from 2 to 297 μg/g dw Cd). Vitellogenin in homogenates of oyster gonad tissue, after 96 h of exposure to 1000 μg/L Cd, were significantly lower (0
Energy Technology Data Exchange (ETDEWEB)
Moncaleano-Niño, Angela M.; Barrios-Latorre, Sergio A.; Poloche-Hernández, Javier F. [Department of Biological Sciences, Universidad de Bogota Jorge Tadeo Lozano, Carrera 4 No. 22-61, Bogota (Colombia); Becquet, Vanessa; Huet, Valérie [Littoral Environnement et Sociétés (LIENSs) – UMR 7266, CNRS-Université de La Rochelle, Bâtiment ILE 2, rue Olympe de Gouges, 17 000 La Rochelle (France); Villamil, Luisa [Department of Biological Sciences, Universidad de Bogota Jorge Tadeo Lozano, Carrera 4 No. 22-61, Bogota (Colombia); Thomas-Guyon, Hélène [Littoral Environnement et Sociétés (LIENSs) – UMR 7266, CNRS-Université de La Rochelle, Bâtiment ILE 2, rue Olympe de Gouges, 17 000 La Rochelle (France); Ahrens, Michael J., E-mail: michael.ahrens@utadeo.edu.co [Department of Biological Sciences, Universidad de Bogota Jorge Tadeo Lozano, Carrera 4 No. 22-61, Bogota (Colombia); Luna-Acosta, Andrea [Department of Biological Sciences, Universidad de Bogota Jorge Tadeo Lozano, Carrera 4 No. 22-61, Bogota (Colombia)
2017-04-15
Highlights: • The cup oyster Saccostrea sp. is present in Santa Marta, Colombian Caribbean. • 96 h exposure of oysters to Cd increased metallothionein concentrations in digestive glands up to 2-fold. • 96 h exposure of oysters to Cd decreased vitellogenin concentrations in gonads up to 6-fold. • Metallothionein and vitellogenin tissue concentrations correlated with whole tissue Cd concentrations. • Significant changes in metallothionein and vitellogenin levels were only evident at Cd concentrations above 100 μg/L. - Abstract: Metallothioneins and vitellogenins are low molecular weight proteins that have been used widely in environmental monitoring as biomarkers of exposure and damage to metals and estrogenic compounds, respectively. In the present study, the responses of metallothionein and vitellogenin tissue concentrations were measured following acute (96 h) aqueous exposures to cadmium in Saccostrea sp., a tropical cup oyster native to the Western Pacific Ocean that has recently established itself in the Caribbean Sea. Adult oysters (1.5–5.0 cm shell length) collected from the municipal marina of Santa Marta, Colombia (Caribbean Sea) and acclimated for 5 days in the laboratory, were exposed to Cd at five concentrations (0, 1, 10, 100 and 1000 μg/L) and their tissues (gills, digestive gland and adductor muscle) were analyzed in pools of 5 individuals (3 replicates per concentration). Metallothioneins in digestive glands of oysters exposed to Cd concentrations ≥ 100 μg/L showed a significant increase, from 8.0 to 14.8 μg MT/mg total protein, whereas metallothionein concentrations in gills increased to lesser extent, and no differences were observed in adductor muscle. Metallothionein concentrations in digestive gland and gills correlated directly with whole soft tissue Cd concentrations (ranging from 2 to 297 μg/g dw Cd). Vitellogenin in homogenates of oyster gonad tissue, after 96 h of exposure to 1000 μg/L Cd, were significantly lower (0
International Nuclear Information System (INIS)
Soverchia, L.; Ruggeri, B.; Palermo, F.; Mosconi, G.; Cardinaletti, G.; Scortichini, G.; Gatti, G.; Polzonetti-Magni, A.M.
2005-01-01
Many synthetic chemicals, termed xenoestrogens, have been shown to interact as agonists with the estrogen receptor (ER) to elicit biological responses similar to those of natural hormones. To date, the regulation of vitellogenesis in oviparous vertebrates has been widely used for evaluation of estrogenic effects. Therefore, Carassius auratus juveniles were chosen as a fish model for studying the effects of estradiol-17β and different concentrations (10 -6 and 10 -7 M) of 4-nonylphenol (4-NP) on the expression of liver ERβ-1 subtype; plasma vitellogenin and sex steroids (androgens and estradiol-17β) were also evaluated together with the bioaccumulation process, through mass-spectrometry. C. auratus is a species widespread in the aquatic environment and, on the toxicological point of view, can be considered a good 'sentinel' species. Juveniles of goldfish were maintained in tanks with only tap water or water with different concentrations (10 -6 and 10 -7 M) of 4-nonylphenol (4-NP), or 10 -7 M of estradiol-17β. After 3 weeks of treatment, animals were anesthetized within 5 min after capture, and blood was immediately collected into heparinized syringes by cardiac puncture and stored at -70 deg. C; the gonads were fixed, then frozen and stored at -70 deg. C; the whole fish, liver, and muscle tissues were harvested and immediately stored at -70 deg. C for molecular biology experiments and bioaccumulation measurements. The estrogenic effects of 4-NP were evidenced by the presence of plasma vitellogenin in juveniles exposed both to estradiol-17β and the two doses of 4-NP; moreover, exposure to 4-NP also increased aromatization of androgens, as suggested by decreasing androgens and increasing estradiol-17β plasma levels. The changes of these parameters were in agreement with the increasing transcriptional rate of ERβ-1 mRNA in the liver, demonstrating that both estradiol-17β and 4-NP modulate the vitellogenin rate through interaction with the ERβ-1 subtype. The
International Nuclear Information System (INIS)
Leanos-Castaneda, Olga; Kraak, Glen van der
2007-01-01
The estrogen-dependent process of vitellogenesis is a key function on oviparous fish reproduction and it has been widely used as an indicator of xenoestrogen exposure. The two estrogen receptor (ER) subtypes, ERα and ERβ, are often co-expressed in the liver of fish. The relative contribution of each ER subtype to modulate vitellogenin production by hepatocytes was studied using selected compounds known to preferentially interact with specific ER subtypes: propyl-pyrazole-triol (PPT) an ERα selective agonist, methyl-piperidino-pyrazole (MPP) an ERα selective antagonist, and diarylpropionitrile (DPN) an ERβ selective agonist. First, the relative binding affinity of the test compounds to estradiol for rainbow trout hepatic nuclear ER was determined using a competitive ligand binding assay. All the test ligands achieved complete displacement of specific [ 3 H]-estradiol binding from the nuclear ER extract. This indicates that the test ligands have the potential to modify the ER function in the rainbow trout liver. Secondly, the ability of the test compounds to induce or inhibit vitellogenin production by primary cultures of rainbow trout hepatocytes was studied. Estradiol and DPN were the only compounds that induced a dose-dependent increase on vitellogenin synthesis. The lack of vitellogenin induction by PPT indicates that ERα could not have a role on this reproductive process whereas the ability of DPN to induce vitellogenin production supports the participation of ERβ. In addition, this hypothesis is reinforced by the results obtained from MPP plus estradiol. On one hand, the absence of suppressive activity of MPP in the estradiol-induced vitellogenin production does not support the participation of ERα. On the other hand, once blocked ERα with MPP, the only manifestation of agonist activity of estradiol would be achieved via ERβ. In conclusion, the present results indicate that vitellogenin production is mainly mediated through ERβ, implying, furthermore
DEVELOPMENT OF MONOCLONAL ANTIBODIES AGAINST FATHEAD MINNOW (PIMEPHALES PROMELAS) VITELLOGENIN
We have obtained a panel of monoclonal antibodies directed against fathead minnow vitellogenin (Vtg) for use in sensitive ELISAs to quantify the response of exposure in vivo to estrogen or estrogen mimics.
Zhao, Jing; Sun, Yang; Xiao, Liubin; Tan, Yongan; Jiang, Yiping; Bai, Lixin
2018-04-01
The beet armyworm Spodoptera exigua, a worldwide phytophagous pest, causes considerable economic agricultural losses. Understanding the relationship between its fecundity and the host plant is a basic and important component of early forecasting of beet armyworm outbreaks. However, little is known about the molecular mechanism by which distinct hosts affect S. exigua fecundity. In this study, key life-history parameters of S. exigua reared on distinct hosts were investigated; the host plants could be ranked as lettuce > shallot > tomato > celery in their order of suitability. Full-length S. exigua vitellogenin receptor (SeVgR) cDNA was cloned, and sex-, stage- and tissue-specific expression characteristics were assessed. Spodoptera exigua vitellogenin (SeVg) and SeVgR expression levels were markedly modulated by host nutrients (P lettuce, the most preferred and most nutritive host, than in those reared on tomato and celery. Interestingly, significant linear regression correlations were found between SeVg and SeVgR expression levels and key S. exigua life-history parameters, especially life span, pupa weight, and female fecundity (P < 0.01). Host plant type and suitability could affect the expression pattern of SeVg and SeVgR, which influenced S. exigua fecundity. Vg and VgR have the potential to be used as molecular markers of S. exigua fecundity and for forecasting outbreaks of S. exigua on different hosts. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Effect of Bisphenol A on the Levels of Vitellogenin and ...
African Journals Online (AJOL)
Effect of Bisphenol A on the Levels of Vitellogenin and Metallothionein in Adult ... Purpose: To investigate the potential role of bisphenol A (BPA) in inducing endocrine disruption in fish. ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
Steen, van der J.J.M.; Martel, Anne Claire; Hendrickx, Patrick
2015-01-01
The number of bees, amount of brood and haemolymph vitellogenin titre are parameters to establish the vitality of a honey bee colony. Increasing numbers of bees during summer until autumn; increasing amounts of brood in spring towards summer followed by a decrease; and low haemolymph vitellogenin
Experimental evaluation of vitellogenin as a predictive biomarker for reproductive disruption.
Cheek, A.O.; Brouwer, T.H.; Carroll, S.; Manning, S.; McLachlan, J.A.; Brouwer, M.H.J.
2001-01-01
Vitellogenin (VTG) synthesis in male oviparous vertebrates is used as an indicator of environmental estrogen exposure, but the relationship between elevated VTG levels and the effects of environmental estrogens on reproductive success are poorly understood. To examine whether altered VTG expression
Energy Technology Data Exchange (ETDEWEB)
Blüthgen, Nancy [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH‐4132 Muttenz (Switzerland); University of Basel, Division of Molecular and Systems Toxicology, Department of Pharmaceutical Sciences, Klingelbergstrasse 50, CH-4056 Basel (Switzerland); Zucchi, Sara [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH‐4132 Muttenz (Switzerland); Fent, Karl, E-mail: karl.fent@fhnw.ch [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH‐4132 Muttenz (Switzerland); Swiss Federal Institute of Technology (ETHZ), Department of Environmental Sciences, CH‐8092 Zürich (Switzerland)
2012-09-01
Organic UV filters including benzophenone-3 (BP-3) are widely used to protect humans and materials from damage by UV irradiation. Despite the environmental occurrence of BP-3 in the aquatic environment, little is known about its effects and modes of action. In the present study we assess molecular and physiological effects of BP-3 in adult male zebrafish (Danio rerio) and in eleuthero-embryos by a targeted gene expression approach focusing on the sex hormone system. Fish and embryos are exposed for 14 days and 120 hours post fertilization, respectively, to 2.4–312 μg/L and 8.2–438 μg/L BP-3. Chemical analysis of water and fish demonstrates that BP-3 is partly transformed to benzophenone-1 (BP-1) and both compounds are accumulated in adult fish. Biotransformation to BP-1 is absent in eleuthero-embryos. BP-3 exposure leads to similar alterations of gene expression in both adult fish and eleuthero-embryos. In the brain of adult males esr1, ar and cyp19b are down-regulated at 84 μg/L BP-3. There is no induction of vitellogenin expression by BP-3, both at the transcriptional and protein level. An overall down-regulation of the hsd3b, hsd17b3, hsd11b2 and cyp11b2 transcripts is observed in the testes, suggesting an antiandrogenic activity. No histological changes were observed in the testes after BP-3 treatment. The study leads to the conclusion that low concentrations of BP-3 exhibit similar multiple hormonal activities at the transcription level in two different life stages of zebrafish. Forthcoming studies should show whether this translates to additional physiological effects. Highlights: ► Activity of UV filter benzophenone-3 (BP-3) is assessed in zebrafish. ► BP-3 is partly metabolized to benzophenone-1 by adult fish but not embryos. ► Alterations of gene expression are similar in adult males and embryos. ► Gene expression alterations point to multiple hormonal activity of BP-3.
Directory of Open Access Journals (Sweden)
Holly A. Basta
2007-01-01
Full Text Available Retroid agents are genomes that encode a reverse transcriptase (RT and replicate or transpose by way of an RNA intermediate. The Genome Parsing Suite (GPS is software created to identify and characterize Retroid agents in any genome database (McClure et al. 2005. The detailed analysis of all Retroid agents found by the GPS in Danio rerio (zebrafsh, Oryzias latipes (medaka, Gasterosteus aculeatus (stickleback and Tetraodon nigroviridis (spotted green pufferfish reveals extensive Retroid agent diversity in the compact genomes of all four fish. Novel Retroid agents were identified by the GPS software: the telomerase reverse transcriptase (TERT in O. latipes, G. aculeatus and T. nigroviridis and a potential TERT in D. rerio, a retrotransposon in D. rerio, and multiple lineages of endogenous retroviruses (ERVs in D. rerio, O. latipes and G. aculeatus.
Crystal structure of an eIF4G-like protein from Danio rerio
Energy Technology Data Exchange (ETDEWEB)
Bae, Euiyoung; Bitto, Eduard; Bingman, Craig A.; McCoy, Jason G.; Wesenberg, Gary E.; Phillips, Jr., George N. (UW)
2012-04-18
The gene LOC 91917 Danio rerio (zebrafish) encodes a protein annotated in the UniProt knowledgebase as the middle domain of eukaryotic initiation factor 4G domain containing protein b (MIF4Gdb). Its molecular weight is 25.8 kDa, and it comprises 222 amino acid residues. BLAST searches revealed homologues of D. rerio MIF4Gdb in many eukaryotes including humans. The homologue sand MIF4Gdb were identified as members of the Pfam family, MIF4G (PF2854), which is named after the middle domain of eukaryotic initiation factor 4G (eIF4G). eIF4G is a component of eukaryotic translational initiation complex, and contains binding sites for other initiation factors, suggesting its critical role in translational initiation. The MIF4G domain also occurs in several other proteins involved in RNA metabolism, including the Nonsense-mediated mRNA decay 2 protein (NMD2/UPF2), and the nuclear cap-binding protein 80-kDa subunit (CBP80). Sequence and structure analysis of the MIF4G domains in many proteins indicate that the domain assumes an all helical fold and has tandem repeated motifs. The zebrafish protein described here has homology to domains of other proteins variously referred to as NIC-containing proteins (NMD2, eIF4G, CBP80). The biological function of D. rerio MIF4Gdb has not yet been experimentally characterized, and the annotation is based on amino acid sequence comparison. D. rerio MIF4Gdb did not share more than 25% sequence identity with any protein for which the three-dimensional structure is known and was selected as a target for structure determination by the Center for Eukaryotic Structural Genomics (CESG). Here, they report the crystal structure of D. rerio MIF4Gdb (UniGene code Dr.79360, UniProt code Q5EAQ1, CESG target number GO.79294).
Blank, Simon; Seismann, Henning; McIntyre, Mareike; Ollert, Markus; Wolf, Sara; Bantleon, Frank I.; Spillner, Edzard
2013-01-01
Background/Objectives Anaphylaxis due to hymenoptera stings is one of the most severe clinical outcomes of IgE-mediated hypersensitivity reactions. Although allergic reactions to hymenoptera stings are often considered as a general model for the underlying principles of allergic disease, venom immunotherapy is still hampered by severe systemic side effects and incomplete protection. The identification and detailed characterization of all allergens of hymenoptera venoms might result in an improvement in this field and promote the detailed understanding of the allergological mechanism. Our aim was the identification and detailed immunochemical and allergological characterization of the low abundant IgE-reactive 200 kDa proteins of Apis mellifera and Vespula vulgaris venom. Methods/Principal Findings Tandem mass spectrometry-based sequencing of a 200 kDa venom protein yielded peptides that could be assigned to honeybee vitellogenin. The coding regions of the honeybee protein as well as of the homologue from yellow jacket venom were cloned from venom gland cDNA. The newly identified 200 kDa proteins share a sequence identity on protein level of 40% and belong to the family of vitellogenins, present in all oviparous animals, and are the first vitellogenins identified as components of venom. Both vitellogenins could be recombinantly produced as soluble proteins in insect cells and assessed for their specific IgE reactivity. The particular vitellogenins were recognized by approximately 40% of sera of venom-allergic patients even in the absence of cross-reactive carbohydrate determinants. Conclusion With the vitellogenins of Apis mellifera and Vespula vulgaris venom a new homologous pair of venom allergens was identified and becomes available for future applications. Due to their allergenic properties the honeybee and the yellow jacket venom vitellogenin were designated as allergens Api m 12 and Ves v 6, respectively. PMID:23626765
Vitellogenin Production by Fishmeal-Containing Diets in Male Tilapia (Oreochromis Mossambicus)
In a number of fish species, male plasma has been shown to contain substantial levels of l7~estradiol (E z) and in certain cases, vitellogenin (Vg), an Ez-induced precursor of egg yolk protein that is specific to females. The presence ofEz and Vg in males raises questions about ...
Corthésy, B; Cardinaux, J R; Claret, F X; Wahli, W
1989-01-01
A hormone-controlled in vitro transcription system derived from Xenopus liver nuclear extracts was exploited to identify novel cis-acting elements within the vitellogenin gene B1 promoter region. In addition to the already well-documented estrogen-responsive element (ERE), two elements were found within the 140 base pairs upstream of the transcription initiation site. One of them, a negative regulatory element, is responsible for the lack of promoter activity in the absence of the hormone and...
DEFF Research Database (Denmark)
Holbech, Henrik; Brande-Lavridsen, Nanna; Kinnberg, Karin Lund
2010-01-01
The Fish Sexual Development Test (FSDT) has gone through two validations as an OECD test guideline for the detection of endocrine active chemicals with different modes of action. The validation has been finalized on four species: Zebrafish (Danio rerio), Japanese medaka (Oryzias latipes), three s...... as a population relevant endpoint and the results of the two validation rounds will be discussed in relation to environmental risk assessment and species selection....... for histology. For all three methods, the fish parts were numbered and histology could therefore be linked to the vitellogenin concentration in individual fish. The two core endocrine relevant endpoints were vitellogenin concentrations and phenotypic sex ratio. Change in the sex ratio is presented...
Energy Technology Data Exchange (ETDEWEB)
Baumann, Lisa, E-mail: lisa.baumann@vetsuisse.unibe.ch [Centre for Fish and Wildlife Health, Vetsuisse Faculty, University of Bern, PO Box 8466, CH-3001 Bern (Switzerland); Aquatic Ecology and Toxicology Section, Centre for Organismal Studies, University of Heidelberg, Im Neuenheimer Feld 230, D-69120 Heidelberg (Germany); Knörr, Susanne, E-mail: susanne.knoerr@gmx.de [Aquatic Ecology and Toxicology Section, Centre for Organismal Studies, University of Heidelberg, Im Neuenheimer Feld 230, D-69120 Heidelberg (Germany); Keiter, Susanne, E-mail: susanne.keiter@cos.uni-heidelberg.de [Aquatic Ecology and Toxicology Section, Centre for Organismal Studies, University of Heidelberg, Im Neuenheimer Feld 230, D-69120 Heidelberg (Germany); Rehberger, Kristina, E-mail: k.rehberger@stud.uni-heidelberg.de [Aquatic Ecology and Toxicology Section, Centre for Organismal Studies, University of Heidelberg, Im Neuenheimer Feld 230, D-69120 Heidelberg (Germany); Volz, Sina, E-mail: s.volz@stud.uni-heidelberg.de [Aquatic Ecology and Toxicology Section, Centre for Organismal Studies, University of Heidelberg, Im Neuenheimer Feld 230, D-69120 Heidelberg (Germany); Schiller, Viktoria, E-mail: schiller@molbiotech.rwth-aachen.de [Fraunhofer Institute for Molecular Biology and Applied Ecology, Forckenbeckstr. 6, D-52074 Aachen (Germany); Fenske, Martina, E-mail: martina.fenske@ime.fraunhofer.de [Fraunhofer Institute for Molecular Biology and Applied Ecology, Forckenbeckstr. 6, D-52074 Aachen (Germany); Holbech, Henrik, E-mail: hol@biology.sdu.dk [Department of Biology, University of Southern Denmark, Campusvej 55, DK-5230 Odense M (Denmark); Segner, Helmut, E-mail: helmut.segner@vetsuisse.unibe.ch [Centre for Fish and Wildlife Health, Vetsuisse Faculty, University of Bern, PO Box 8466, CH-3001 Bern (Switzerland); Braunbeck, Thomas, E-mail: braunbeck@uni-hd.de [Aquatic Ecology and Toxicology Section, Centre for Organismal Studies, University of Heidelberg, Im Neuenheimer Feld 230, D-69120 Heidelberg (Germany)
2014-08-01
The aim of the present study was to investigate the persistence of the feminizing effects of discontinued 17α-ethinylestradiol (EE2) exposure on zebrafish (Danio rerio). An exposure scenario covering the sensitive phase of sexual differentiation, as well as final gonad maturation was chosen to examine the estrogenic effects on sexual development of zebrafish. Two exposure scenarios were compared: continuous exposure to environmentally relevant concentrations (0.1–10 ng/L EE2) up to 100 days post-hatch (dph) and developmental exposure up to 60 dph, followed by 40 days of depuration in clean water. The persistence of effects was investigated at different biological organization levels from mRNA to population-relevant endpoints to cover a broad range of important parameters. EE2 had a strong feminizing and inhibiting effect on the sexual development of zebrafish. Brain aromatase (cyp19b) mRNA expression showed no clear response, but vitellogenin levels were significantly elevated, gonad maturation and body growth were inhibited in both genders, and sex ratios were skewed towards females and undifferentiated individuals. To a large extent, all of these effects were reversed after 40 days of recovery, leading to the conclusion that exposure to the estrogen EE2 results in very strong, but reversible underdevelopment and feminization of zebrafish. The present study is the first to show this reversibility at different levels of organization, which gives better insight into the mechanistic basis of estrogenic effects in zebrafish. - Highlights: • Zebrafish were exposed to 17α-ethinylestradiol during their sexual differentiation. • Reversibility of effects was investigated after depuration of 40 days. • Morphological and physiological parameters were compared. • Zebrafish were able to recover at all different levels from mRNA to population.
International Nuclear Information System (INIS)
Baumann, Lisa; Knörr, Susanne; Keiter, Susanne; Rehberger, Kristina; Volz, Sina; Schiller, Viktoria; Fenske, Martina; Holbech, Henrik; Segner, Helmut; Braunbeck, Thomas
2014-01-01
The aim of the present study was to investigate the persistence of the feminizing effects of discontinued 17α-ethinylestradiol (EE2) exposure on zebrafish (Danio rerio). An exposure scenario covering the sensitive phase of sexual differentiation, as well as final gonad maturation was chosen to examine the estrogenic effects on sexual development of zebrafish. Two exposure scenarios were compared: continuous exposure to environmentally relevant concentrations (0.1–10 ng/L EE2) up to 100 days post-hatch (dph) and developmental exposure up to 60 dph, followed by 40 days of depuration in clean water. The persistence of effects was investigated at different biological organization levels from mRNA to population-relevant endpoints to cover a broad range of important parameters. EE2 had a strong feminizing and inhibiting effect on the sexual development of zebrafish. Brain aromatase (cyp19b) mRNA expression showed no clear response, but vitellogenin levels were significantly elevated, gonad maturation and body growth were inhibited in both genders, and sex ratios were skewed towards females and undifferentiated individuals. To a large extent, all of these effects were reversed after 40 days of recovery, leading to the conclusion that exposure to the estrogen EE2 results in very strong, but reversible underdevelopment and feminization of zebrafish. The present study is the first to show this reversibility at different levels of organization, which gives better insight into the mechanistic basis of estrogenic effects in zebrafish. - Highlights: • Zebrafish were exposed to 17α-ethinylestradiol during their sexual differentiation. • Reversibility of effects was investigated after depuration of 40 days. • Morphological and physiological parameters were compared. • Zebrafish were able to recover at all different levels from mRNA to population
Dominguez, Gustavo A.; Bisesi, Joseph H.; Kroll, Kevin J.; Denslow, Nancy D.; Sabo-Attwood, Tara
2014-01-01
The vitellogenin receptor (Vtgr) plays an important role in fish reproduction. This receptor functions to incorporate vitellogenin (Vtg), a macromolecule synthesized and released from the liver in the bloodstream, into oocytes where it is processed into yolk. Although studies have focused on the functional role of Vtgr in fish, the mechanistic control of this gene is still unexplored. Here we report the identification and analysis of the first piscine 5′ regulatory region of the vtgr gene whi...
Use of vitellogenin as a biomarker for estrogenic effect: What is the baseline?
DEFF Research Database (Denmark)
Bjerregaard, Poul; Holbech, Henrik; Pedersen, Knud Ladegaard
investigated in 2004 were revisited in the 2010 study and vitellogenin concentrations had decreased. Between 2004 and 2010 some discharges (via septic tanks) from scattered houses in the open land known to discharge estrogenic activity had been removed and this may have reduced the addition of estrogenicity...
The acute toxicity of clove oil to fish Danio rerio and Poecilia reticulata
Directory of Open Access Journals (Sweden)
Petra Doleželová
2011-01-01
Full Text Available Clove oil (active substance eugenol is an anaesthetic used in aquaculture for stress prevention and prevention of mechanical damage during veterinary procedures. The aim of this study was to determine the acute toxicity of clove oil in two aquarium fish species - zebrafish (Danio rerio and guppy (Poecilia reticulata, which are considered the most commonly used model organisms in toxicity testing. The semi-static method according to OECD no. 203 (Fish, Acute toxicity test was used for testing the toxicity of clove oil for juvenile fish. A series of 5 acute toxicity tests was performed, with 10 fish of both species used for each concentration and for the control. The results obtained (number of dead individuals at particular test concentrations were subjected to a probit analysis using the EKO-TOX 5.2 program in order to determine 96hLC50 clove oil values. The significance of the difference between 96hLC50 values in D. rerio and P. reticulata was tested using the Mann-Whitney non-parametric test. The 96hLC50 mean value for clove oil was 18.2 ± 5.52 mg·l–1 in juvenile D. rerio and 21.7 ± 0.8 mg·l–1 in P. reticulata. In spite of variability in clove oil composition, acute toxicity values of clove oil for juvenile stages of both fish species were comparable. The results did not show different sensitivities to clove oil in tested fish species. This is the first similar study in these fish species.
Gupta, S; Upadhayay, R; Kanungo, M S
1996-08-01
This study was directed at achieving an understanding of the mechanisms by which steroid hormones control the synthesis of vitellogenin (VTG) protein in the liver of the Japanese quail. Northern hybridization shows that administration of estradiol alone or with progesterone stimulates the synthesis of VTG mRNA. Gel mobility shift assay of DNA fragments containing the ERE and NF 1 shows that estradiol alone or with progesterone increases the levels of nuclear proteins that bind to these cis-acting elements of the promoter of the VTG gene. The cooperative effect of the two hormones seen at the level of expression of the VTG gene may be due to protein-protein interactions of trans-acting factors that bind to ERE and NF 1.
Thyroidal angiogenesis in zebrafish (Danio rerio) exposed to high ...
African Journals Online (AJOL)
STORAGESEVER
2009-04-20
Apr 20, 2009 ... As a well known environmental contaminant, perchlorate inhibits thyroidal iodide uptake and reduces thyroid hormone levels. In zebrafish (Danio rerio) exposed to high concentrations of sodium perchlorate (200, 350 and 500 mg/L) for 10 days, remarkable angiogenesis was identified, not only.
Fadrozole inhibits aromatase (CYP19A), a key enzyme that converts testosterone to estradiol (E2). In fish, E2 concentrations control hepatic synthesis ofthe glycolipoprotein vitellogenin (VTG), an egg yolk precursor protein essential to oocyte development and larval survival. Whe...
Thyroidal angiogenesis in zebrafish ( Danio rerio ) exposed to high ...
African Journals Online (AJOL)
As a well known environmental contaminant, perchlorate inhibits thyroidal iodide uptake and reduces thyroid hormone levels. In zebrafish (Danio rerio) exposed to high concentrations of sodium perchlorate (200, 350 and 500 mg/L) for 10 days, remarkable angiogenesis was identified, not only histopathologically but also ...
Directory of Open Access Journals (Sweden)
María Pilar Castañeda-Ojeda
2017-05-01
Full Text Available The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts.
Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia
2017-01-01
The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516
Toxicity of tetrabromobisphenol A (TBBPA) in zebrafish (Danio rerio) in a partial life-cycle test.
Kuiper, R V; Brandhof, E J van den; Leonards, P E G; Ven, L T M van der; Wester, P W; Vos, J G
2006-01-01
Toxicological effects of the widely used flame retardant, tetrabromobisphenol A (TBBPA) were assessed in a partial life-cycle test with zebrafish (Danio rerio). Exposure of adult fish during 30 days to water-borne TBBPA in nominal concentrations ranging from 0 (control) to 1.5 muM was followed by
Toxicity of tetrabromobisphenol A (TBBPA) in zebrafish (Danio rerio) in a partial life-cycle test
Kuiper, R.V.; Brandhof, Van den E.J.; Leonards, P.E.G.; Ven, van der L.T.M.; Wester, P.W.; Vos, J.G.
2007-01-01
Toxicological effects of the widely used flame retardant, tetrabromobisphenol A (TBBPA) were assessed in a partial life-cycle test with zebrafish (Danio rerio). Exposure of adult fish during 30 days to water-borne TBBPA in nominal concentrations ranging from 0 (control) to 1.5 ¿M was followed by
Methylation of the chicken vitellogenin gene: influence of estradiol administration.
Meijlink, F C; Philipsen, J N; Gruber, M; Ab, G
1983-01-01
The degree of methylation of the chicken vitellogenin gene has been investigated. Upon induction by administration of estradiol to a rooster, methyl groups at specific sites near the 5'-end of the gene are eliminated. The process of demethylation is slower than the activation of the gene. Demethylation is therefore probably not a prerequisite to gene transcription. At least two other sites in the coding region of the gene are methylated in the liver of estrogenized roosters, but not in the liver of a laying hen, where the gene is naturally active. Images PMID:6298743
A bioenergetic model for zebrafish Danio rerio (Hamilton)
Chizinski, C.J.; Sharma, Bibek; Pope, K.L.; Patino, R.
2008-01-01
A bioenergetics model was developed from observed consumption, respiration and growth rates for zebrafish Danio rerio across a range (18-32?? C) of water temperatures, and evaluated with a 50 day laboratory trial at 28?? C. No significant bias in variable estimates was found during the validation trial; namely, predicted zebrafish mass generally agreed with observed mass. ?? 2008 The Authors.
Daily shoaling patterns in the zebrafish Danio rerio
Directory of Open Access Journals (Sweden)
Timothy PACIOREK, Scott McROBERT
2013-12-01
Full Text Available Shoaling intensity in zebrafish Danio rerio is believed to vary throughout subjective day and night hours. This experiment examines long term variations in shoaling behavior. Adult zebrafish Danio rerio were maintained under a 12:12 LD cycle (with dim red light serving as reduced visibility during subjective dark hours, and their shoaling behavior was monitored every hours for a three-day period of time. Our results show that zebrafish perform shoaling behavior throughout subjective day and under reduced visibility conditions, although mean shoaling times during the light phase were significantly higher than mean shoaling times during the dark phase. However, on the 3rd day of the experiment, mean shoaling times during the subjective night had increased and mean shoaling times during the subjective day had decreased. This shift in intensity was not seen on the first two days of the study, and may represent the influence of experience on the behavior of the test fish. We believe this study shows that shoaling behavior changes with light/dark cycles and that fish shoal even during reduced visibility conditions [Current Zoology 59 (6:754–760, 2013].
Choi, Min Seop; Kwon, Se Ryun; Choi, Seong Hee; Kwon, Hyuk Chu
2012-12-01
Gene expressions of cytochrome P4501A (CYP1A), aryl hydrocarbon receptor (AhR) and vitellogenin (Vg) by endocrine disruptors, benzo[α]pyrene (B[a]P) and tributyltin (TBT) were examined in cultured eel hepatocytes which were isolated from eels treated previously with B[a]P (10 mg/kg) or estradiol-17β (20 mg/kg) in vivo, and the relationship between CYP1A, AhR and Vg genes were studied. When the cultured eel hepatocytes were treated with B[a]P (10(-6)-10(-5) M) the gene expressions of CYP1A and AhR were enhanced in a concentration-dependent manner. However, when treated with TBT (10(-9)-10(-5) M) the gene expressions of CYP1A and AhR were suppressed at high concentrations (10(-6)-10(-5) M), while having no effects at low concentrations (10(-9)-10(-7) M). Gene expression of Vg was also suppressed by TBT in a concentration-dependent manner in cultured eel hepatocytes which was previously treated in vivo with estradiol-17β.
Is nitrate an endocrine active compound in fish?
DEFF Research Database (Denmark)
Mose, M. P.; Kinnberg, Karin Lund; Bjerregaard, Poul
Nitrate and nitrite taken up into fish may be reduced to NO which is known to be a signalling compound in the organism contributing to the regulation of i.e. steroid synthesis. Exposure of male rats to nitrate and nitrite results in reduced plasma concentrations of testosterone (also nitrate...... concentrations around or below the limits for drinking water). Nitrate concentrations in streams may be elevated due to releases from agricultural practices. The effects of nitrate and nitrite on endocrine relevant endpoints were investigated in zebrafish (Danio rerio) and brown trout (Salmo trutta). Zebrafish...... were exposed to nitrate and nitrite from hatch to sexual maturation (60 d) and sex ratio and vitellogenin concentrations were determined. Juvenile brown trout were exposed in a short-term experiment and the concentrations of vitellogenin were determined. The sex ratio in zebrafish was not affected...
Directory of Open Access Journals (Sweden)
Y.S. Zaghloul
2017-07-01
Full Text Available The eggs deposited by oviparous organisms contain large amounts of vitellus, or yolk, which are utilized by the growing embryo. Vitellogenesis is the process of vitellus accumulation involves massive heterosynthetic synthesis of the protein vitellogenin (Vg and its deposition in the oocyte. Vg levels are indicative for the efficiency of the oogenesis process. This work summarizes data on Vg levels in Galleria mellonella females exposed to various doses of gamma radiation. The results stated that vitellogenin was affected by irradiation. The decreased levels of Vg was dose dependent reaching an undetermined level at 160Gy which is the sterileing dose for G. mellonella female that suppress the egg production by them.
Brain gene expression changes elicited by peripheral vitellogenin knockdown in the honey bee.
Wheeler, M M; Ament, S A; Rodriguez-Zas, S L; Robinson, G E
2013-10-01
Vitellogenin (Vg) is best known as a yolk protein precursor. Vg also functions to regulate behavioural maturation in adult honey bee workers, but the underlying molecular mechanisms by which it exerts this novel effect are largely unknown. We used abdominal vitellogenin (vg) knockdown with RNA interference (RNAi) and brain transcriptomic profiling to gain insights into how Vg influences honey bee behavioural maturation. We found that vg knockdown caused extensive gene expression changes in the bee brain, with much of this transcriptional response involving changes in central biological functions such as energy metabolism. vg knockdown targeted many of the same genes that show natural, maturation-related differences, but the direction of change for the genes in these two contrasts was not correlated. By contrast, vg knockdown targeted many of the same genes that are regulated by juvenile hormone (JH) and there was a significant correlation for the direction of change for the genes in these two contrasts. These results indicate that the tight coregulatory relationship that exists between JH and Vg in the regulation of honey bee behavioural maturation is manifest at the genomic level and suggest that these two physiological factors act through common pathways to regulate brain gene expression and behaviour. © 2013 Royal Entomological Society.
A single Danio rerio hars gene encodes both cytoplasmic and mitochondrial histidyl-tRNA synthetases.
Directory of Open Access Journals (Sweden)
Ashley L Waldron
Full Text Available Histidyl tRNA Synthetase (HARS is a member of the aminoacyl tRNA synthetase (ARS family of enzymes. This family of 20 enzymes is responsible for attaching specific amino acids to their cognate tRNA molecules, a critical step in protein synthesis. However, recent work highlighting a growing number of associations between ARS genes and diverse human diseases raises the possibility of new and unexpected functions in this ancient enzyme family. For example, mutations in HARS have been linked to two different neurological disorders, Usher Syndrome Type IIIB and Charcot Marie Tooth peripheral neuropathy. These connections raise the possibility of previously undiscovered roles for HARS in metazoan development, with alterations in these functions leading to complex diseases. In an attempt to establish Danio rerio as a model for studying HARS functions in human disease, we characterized the Danio rerio hars gene and compared it to that of human HARS. Using a combination of bioinformatics, molecular biology, and cellular approaches, we found that while the human genome encodes separate genes for cytoplasmic and mitochondrial HARS protein, the Danio rerio genome encodes a single hars gene which undergoes alternative splicing to produce the respective cytoplasmic and mitochondrial versions of Hars. Nevertheless, while the HARS genes of humans and Danio differ significantly at the genomic level, we found that they are still highly conserved at the amino acid level, underscoring the potential utility of Danio rerio as a model organism for investigating HARS function and its link to human diseases in vivo.
Corthésy, B; Cardinaux, J R; Claret, F X; Wahli, W
1989-12-01
A hormone-controlled in vitro transcription system derived from Xenopus liver nuclear extracts was exploited to identify novel cis-acting elements within the vitellogenin gene B1 promoter region. In addition to the already well-documented estrogen-responsive element (ERE), two elements were found within the 140 base pairs upstream of the transcription initiation site. One of them, a negative regulatory element, is responsible for the lack of promoter activity in the absence of the hormone and, as demonstrated by DNA-binding assays, interacts with a liver-specific transcription factor. The second is required in association with the estrogen-responsive element to mediate hormonal induction and is recognized by the Xenopus liver homolog of nuclear factor I.
Effect of Enriched Feed by n-3 fatty acids and 2% of n-6 fatty acid on Danio rerio Reproduction
Directory of Open Access Journals (Sweden)
N.B.P Utomo
2007-07-01
Full Text Available This experiment was conducted to determine the optimum n-3 fatty acid level in the diet containing 2 % of n-6 fatty acid on the reproductive performance of zebra fish (Danio rerio. There experimental diets containing 0.0; 1.0; 1.5 % n-3 fatty acid with 2.0 % n-6 fatty acid was fed to the fish, three times daily, at satiation, for two months. In order to evaluate the gonadal development of the broodstock, two gonads og fish was used for histologis preparation in every 7 days. At the end of the second month, reproductive performance was evaluated through parameters of gonad somato indeks, fecundity, fertilization rate, hatching rate, yolk egg absorbtion rate, survival rate of 3 days old larvae. Sample of fish also was taken for proximate composition as the end of this experiment. Results shows that at the fifth weeks of this experiment, gonad of fish fed on 1.0 % of n-3 fatty acid and 2.0 % n-6 fatty acid already produce eggs with the some size, while others. Still produce small size of eggs. It was found also that the whole body of fish fed an diet with 1.0% n-3 fatty acid contain the highest protein level compare to two other diets. Based on the evaluation of reproduction performance parameters, it was concluded that the optimum dietary level of n-3 fatty acid with 2.0 % n-6 fatty acid for Danio rerio was 0.81 - 0.90 %. Keywords: essential fatty, acids, reproduction, zebra fish, Danio rerio ABSTRAK Penelitian ini bertujuan untuk menentukan kadar asam lemak n-3 optimum dalam pakan yang mempunyai kadar asam lemak n-6 tetap. Tiga macam pakan dengan kadar asam lemak n-3 berbeda yaitu 0.0; 1.0; dan 2.0 % diberikan pada ikan dengan bobot rata-rata 0.12 g. Pakan diberikan secara at satiation, 4 kali sehari selama 60 hari. Setiap 7 hari sekali diambil sampel ikan untuk pembentukan preparat histologi gonad dengan tujuan untuk mengevaluasi perkembangan gonad. Pada akhir penelitian, induk dipijahkan dan dievaluasi performan reproduksi berdasarkan
Expression analysis of vitellogenins in the workers of the red imported fire ant (Solenopsis invicta
Directory of Open Access Journals (Sweden)
Chloe Hawkings
2018-05-01
Full Text Available Vitellogenin has been proposed to regulate division of labor and social organization in social insects. The red imported fire ant (Solenopsis invicta harbors four distinct, adjacent vitellogenin genes (Vg1, Vg2, Vg3, and Vg4. Contrary to honey bees that have a single Vg ortholog as well as potentially fertile nurses, and to other ant species that lay trophic eggs, S. invicta workers completely lack ovaries or the ability to lay eggs. This provides a unique model to investigate whether Vg duplication in S. invicta was followed by subfunctionalization to acquire non-reproductive functions and whether Vg was co-opted to regulate behavior within the worker caste. To investigate these questions, we compared the expression patterns of S. invicta Vg genes among workers from different morphological subcastes or performing different tasks. RT-qPCRs revealed higher relative expression of Vg1 in major workers compared to both medium and minor workers, and of Vg2 in major workers when compared to minor workers. Relative expression of Vg1 was also higher in carbohydrate foragers when compared to nurses and protein foragers. By contrast, the level of expression of Vg2, Vg3, and Vg4 were not significantly different among the workers performing the specific tasks. Additionally, we analyzed the relationship between the expression of the Vg genes and S-hydroprene, a juvenile hormone analog. No changes in Vg expression were recorded in workers 12 h after application of the analog. Our results suggest that in S. invicta the Vg gene underwent subfunctionalization after duplication to new functions based on the expression bias observed in these data. This may suggest an alternative and still unknown function for Vg in the workers that needs to be investigated further.
Dominguez, Gustavo A.; Quattro, Joseph M.; Denslow, Nancy D.; Kroll, Kevin J.; Prucha, Melinda S.; Porak, Wesley F.; Grier, Harry J.; Sabo-Attwood, Tara L.
2012-01-01
ABSTRACT Fish vitellogenin synthesized and released from the liver of oviparous animals is taken up into oocytes by the vitellogenin receptor. This is an essential process in providing nutrient yolk to developing embryos to ensure successful reproduction. Here we disclose the full length vtgr cDNA sequence for largemouth bass (LMB) that reveals greater than 90% sequence homology with other fish vtgr sequences. We classify LMB Vtgr as a member of the low density lipoprotein receptor superfamily based on conserved domains and categorize as the short variant that is devoid of the O-glycan segment. Phylogenetic analysis places LMB Vtgr sequence into a well-supported monophyletic group of fish Vtgr. Real-time PCR showed that the greatest levels of LMB vtgr mRNA expression occurred in previtellogenic ovarian tissues. In addition, we reveal the effects of insulin, 17beta-estradiol (E2), and 11-ketotestosterone (11-KT) in modulation of vtgr, esr, and ar mRNAs in previtellogenic oocytes. Insulin increased vtgr expression levels in follicles ex vivo while exposure to E2 or 11-KT did not result in modulation of expression. However, both steroids were able to repress insulin-induced vtgr transcript levels. Coexposure with insulin and E2 or of insulin and 11-KT increased ovarian esr2b and ar mRNA levels, respectively, which suggest a role for these nuclear receptors in insulin-mediated signaling pathways. These data provide the first evidence for the ordered stage-specific expression of LMB vtgr during the normal reproductive process and the hormonal influence of insulin and sex steroids on controlling vtgr transcript levels in ovarian tissues. PMID:22786822
Joint toxic effects of triazophos and imidacloprid on zebrafish (Danio rerio).
Wu, Shenggan; Li, Xinfang; Liu, Xinju; Yang, Guiling; An, Xuehua; Wang, Qiang; Wang, Yanhua
2018-04-01
Pesticide contamination is more often found as a mixture of different pesticides in water bodies rather than individual compounds. However, regulatory risk evaluation is mostly based on the effects of individual pesticides. In the present study, we aimed to investigate the individual and joint toxicities of triazophos (TRI) and imidacloprid (IMI) to the zebrafish (Danio rerio) using acute indices and various sublethal endpoints. Results from 96-h semi-static test indicated that the LC 50 values of TRI to D. rerio at multiple life stages (embryonic, larval, juvenile and adult stages) ranged from 0.49 (0.36-0.71) to 4.99 (2.06-6.81) mg a.i. L -1 , which were higher than those of IMI ranging from 26.39 (19.04-38.01) to 128.9 (68.47-173.6) mg a.i. L -1 . Pesticide mixtures of TRI and IMI displayed synergistic response to zebrafish embryos. Activities of carboxylesterase (CarE) and catalase (CAT) were significantly changed in most of the individual and joint exposures of pesticides compared with the control group. The expressions of 26 genes related to oxidative stress, cellular apoptosis, immune system, hypothalamic-pituitary-thyroid and hypothalamic-pituitary-gonadal axis at the mRNA level revealed that zebrafish embryos were affected by the individual or joint pesticides, and greater changes in the expressions of six genes (Mn-sod, CXCL-CIC, Dio1, Dio2, tsh and vtg1) were observed when exposed to joint pesticides compared with their individual pesticides. Taken together, the synergistic effects indicated that it was highly important to incorporate joint toxicity studies, especially at low concentrations, when assessing the risk of pesticides. Copyright © 2018 Elsevier Ltd. All rights reserved.
Joshi, Vani; Katti, Pancharatna
Tartrazine (TTZ) is an azo dye used as a colorant in food products, drugs, and cosmetics. The present study evaluates the impacts of TTZ on embryonic development of zebrafish ( Danio rerio). Laboratory-raised D. rerio embryos (n = 20/concentration) were exposed to graded dilutions of TTZ (0, 0.1, 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 75, and 100 mM) from gastrulation stage (5.25 hours postfertilization [hpf]) until hatching and developmental trajectory was traced up to day 7. The no observed effect concentration (NOEC), median lethal concentration (LC 50 ), median effective concentration (EC 50 ), and teratogenic index (TI) were calculated. Exposure of embryos to effects; 20 to 30 mM TTZ caused tail bending, cardiac and yolk sac edema in 50% of larvae; in 30 to 50 mM TTZ-exposed embryos the heart rates declined along with the above mentioned deformities, causing mortality within 96 to 144 hpf; development ceased completely at 75 to 100 mM concentration. The NOEC and LC 50 were recorded at 5 and 29.4 mM dose, respectively. The EC 50 values for heart rate, cardiac edema, tail bending, and hatching success were at 59.60, 53.81, 98.28, and 58.97 mM with TI quotient 0.49, 0.54, 0.29, and 0.49, respectively. We conclude that TTZ is not embryo toxic/teratogenic for zebrafish embryos up to a dose level of 10 mM concentration.
International Nuclear Information System (INIS)
Srivastava, A.; Reddy, S.J.; Kelber, O.; Urich, K.; Denschlag, H.O.
1994-01-01
The uptake and release kinetics of 134 Cs by Goldfish (Carassius auratus) and 137 Cs by Zebra Fish (Brachydanio rerio) from aquatic media of different ionic compositions and temperature was studied in controlled laboratory conditions. The accumulation of radiocesium in the case of Brachydanio rerio is observed to be strongly dependent on the potassium ion concentration of the aquatic medium, but in the case of Carassius auratus this dependence is quite weak. The biological half-lives of the cesium isotopes incorporated into the fish investigated in the present work vary from 19 to 80 days and are influenced by the temperature and the ionic composition of the aquatic medium. (author) 19 refs.; 1 fig.; 3 tabs
Tao, Xianji; Li, Cuilan; Zhang, Bo; He, Yiliang
2016-02-01
Understanding the nanomaterial potential to the food conversion of two food chain levels is important in the ecosystem assessment as manufactured nanomaterials are being released into the environment. In this investigation, the food conversion from Daphnia magna (D. magna) (prey) to Danio rerio (D. rerio) (predator) was used as the study object of aqueous stable fullerene nanocrystals (nC60). Accumulated nC60 of D. magna was determined as the nominal initial exposure concentration for D. rerio. The results of 21-d dietary exposure experiment demonstrate that nC60 in D. magna decreased the body weight growths and condition factors of D. rerio, and reduced the food conversion ratio by 20% (from D. magna to D. rerio). Further, the experiments present that nC60 decrease three digestive enzymes activities of trypsinase, lipase, and amylase by 30, 29, and 55% in vivo, and by 60, 90, and 42% in vitro, respectively. Both in vivo and in vitro experiments indicated that nC60 was involved with the decrements of digestive enzymes activities. These decrements in digestive enzymes activities may be due to the deactivation caused by the adsorption of nC60 particles onto the surface or active center of digestive enzymes. Sum up, these results not only describe the nC60 deleterious effects on the food conversion from D. magna to D. rerio, but also provide some information regarding a probable food conversion inhibition mechanism of nC60. Copyright © 2015 Elsevier Ltd. All rights reserved.
International survey on the use and welfare of zebrafish Danio rerio in research.
Lidster, K; Readman, G D; Prescott, M J; Owen, S F
2017-05-01
A survey was conducted regarding zebrafish Danio rerio use for scientific research with a focus on: anaesthesia and euthanasia; housing and husbandry; breeding and production; refinement opportunities. A total of 98 survey responses were received from laboratories in 22 countries in Europe, North America, South America, Asia and Australia. There appears a clear and urgent need to identify the most humane methods of anaesthesia and euthanasia. Aversive responses to MS-222 were widely observed raising concerns about the use of this anaesthetic for D. rerio. The use of anaesthesia in fin clipping for genetic identification is widely practised and there appears to be an opportunity to further develop less invasive methods and refine this process. Optimization (and potentially standardization) of feeding is an area for further investigation. Given that diet and body condition can have such profound effects on results of experiments, differences in practice could have significant scientific implications. Further research into transition between dark and light phases in the laboratory appears to represent an opportunity to establish best practice. Plants and gravel were not considered practical by many laboratories. The true value and benefits need to be established and communicated. Overproduction is a concern both from ethical and financial viewpoints. There is an opportunity to further reduce wastage of D. rerio. There are clear concerns and opportunities for the scientific community to work together to further improve the welfare of these important laboratory models. © 2017 The Authors. Journal of Fish Biology published by John Wiley & Sons Ltd on behalf of The Fisheries Society of the British Isles.
Directory of Open Access Journals (Sweden)
WR Barrionuevo
2010-05-01
Full Text Available In order to verify the influence of chronic and acute ambient oxygen levels from egg to adult stage of the zebrafish, in vivo oxygen consumption (MO2, critical tensions of oxygen (Pcrit, heart rate (fH and total body lactate concentration (Lc were determined for Danio rerio (Hamilton, 1822 raised at 28 °C under normoxic (7.5 mgO2.L-1 or 80 mm.Hg-1 and hypoxic conditions (4.3 mgO2.L-1 and exposed to acute hypoxia during different developmental stages. Our findings confirmed that very early stages do not respond effectively to ambient acute hypoxia. However, after the stage corresponding to the age of 30 days, D. rerio was able to respond to acute hypoxia through effective physiological mechanisms involving aerobic and anaerobic metabolism. Such responses were more efficient for the fishes reared under hypoxia which showed that D. rerio survival capability increased during acclimation to mild hypoxia. Measurements of body mass and length showed that moderate hypoxia did not affect growth significantly until the fish reached the stage of 60 days. Moreover, a growth delay was verified for the hypoxic-reared animals. Also, the D. rerio eggs-to-larvae survival varied from 87.7 to 62.4% in animals reared under normoxia and mild hypoxia, respectively. However, the surviving animals raised under moderated hypoxia showed a better aptitude to regulate aerobic and anaerobic capacities when exposed to acute hypoxia.A influência de diferentes níveis de oxigênio no desenvolvimento (ovos a adulto do peixe paulistinha Danio rerio (Hamilton, 1822 foi verificada por meio de medidas experimentais de consumo de oxigênio (MO2, tensões críticas de oxigênio (Pcrit, taxa de batimentos cardíacos (fH e concentração total de lactato nos tecidos (Lc, para os animais mantidos a 28 ºC sob níveis normóxicos de oxigênio (7.5 mgO2.L-1 ou 80 mmHg e hipóxicos (4.3 mgO2.L-1 e submetidos a hipóxia ambiental aguda, em diferentes estágios de desenvolvimento. Os
International Nuclear Information System (INIS)
Eide, Marta; Rusten, Marte; Male, Rune; Jensen, Knut Helge Midtbø; Goksøyr, Anders
2014-01-01
Highlights: •The ZFL cell line and primary hepatocytes were characterized. •Basic and induced expression of nuclear receptors and target genes were found. •The ZFL cell line expresses very low basic levels of most genes. •The ZFL cells have low induction of gene expression following exposures. •Primary hepatocytes show large sex-dependent differences in gene expression. -- Abstract: The zebrafish (Danio rerio) is a widely used model species in biomedical research. The ZFL cell line, established from zebrafish liver, and freshly isolated primary hepatocytes from zebrafish have been used in several toxicological studies. However, no previous report has compared and characterized these two systems at the level of gene expression. The aim of this study was to evaluate the ZFL cell line in comparison to primary hepatocytes as in vitro models for studying effects of environmental contaminants in zebrafish liver. Using quantitative real-time PCR, the basal level and transcriptional induction potential of key genes involved in toxic responses in the ZFL cell line, primary hepatocytes and whole liver from zebrafish were compared. The study showed that the ZFL cells have lower levels of mRNA of most selected genes compared to zebrafish liver. The induced gene transcription following exposure to ligand was much lower in ZFL cells compared to zebrafish primary hepatocytes at the doses tested. Importantly, oestrogen receptor and vitellogenin genes showed low basal transcription and no induction response in the ZFL cell line. In conclusion, it appears that primary hepatocytes are well suited for studying environmental contaminants including xenoestrogens, but may show large sex-dependent differences in gene transcription. The ZFL cell line shows potential in toxicological studies involving the aryl hydrocarbon receptor pathway. However, low potential for transcriptional induction of genes in general should be expected, especially notable when studying estrogenic
Energy Technology Data Exchange (ETDEWEB)
Eide, Marta, E-mail: marta.eide@bio.uib.no [Department of Biology, University of Bergen, Bergen (Norway); Rusten, Marte; Male, Rune [Department of Molecular Biology, University of Bergen, Bergen (Norway); Jensen, Knut Helge Midtbø; Goksøyr, Anders [Department of Biology, University of Bergen, Bergen (Norway)
2014-02-15
Highlights: •The ZFL cell line and primary hepatocytes were characterized. •Basic and induced expression of nuclear receptors and target genes were found. •The ZFL cell line expresses very low basic levels of most genes. •The ZFL cells have low induction of gene expression following exposures. •Primary hepatocytes show large sex-dependent differences in gene expression. -- Abstract: The zebrafish (Danio rerio) is a widely used model species in biomedical research. The ZFL cell line, established from zebrafish liver, and freshly isolated primary hepatocytes from zebrafish have been used in several toxicological studies. However, no previous report has compared and characterized these two systems at the level of gene expression. The aim of this study was to evaluate the ZFL cell line in comparison to primary hepatocytes as in vitro models for studying effects of environmental contaminants in zebrafish liver. Using quantitative real-time PCR, the basal level and transcriptional induction potential of key genes involved in toxic responses in the ZFL cell line, primary hepatocytes and whole liver from zebrafish were compared. The study showed that the ZFL cells have lower levels of mRNA of most selected genes compared to zebrafish liver. The induced gene transcription following exposure to ligand was much lower in ZFL cells compared to zebrafish primary hepatocytes at the doses tested. Importantly, oestrogen receptor and vitellogenin genes showed low basal transcription and no induction response in the ZFL cell line. In conclusion, it appears that primary hepatocytes are well suited for studying environmental contaminants including xenoestrogens, but may show large sex-dependent differences in gene transcription. The ZFL cell line shows potential in toxicological studies involving the aryl hydrocarbon receptor pathway. However, low potential for transcriptional induction of genes in general should be expected, especially notable when studying estrogenic
TERATOLOGIC EFFECTS OF BISPHENOL A ON ZEBRAFISH (Danio rerio
Directory of Open Access Journals (Sweden)
Cansu Akbulut
2013-01-01
Full Text Available Zebrafish (Danio rerio has easy reproductive capacity and transparent embryos and therefore generally preffered for scientific studies as a vertebrate model. Because of bisphenol A is produced too much and used for making plastics, many organisms including human are exposed to this substance. Bisphenol A has estrogenic activity and thus it effects fertility. So, in our study, effects of low doses of bisphenol A (4mg/L and 8 mg/L on embryo and larva development was investigated.
Dominguez, Gustavo A; Bisesi, Joseph H; Kroll, Kevin J; Denslow, Nancy D; Sabo-Attwood, Tara
2014-10-01
The vitellogenin receptor (Vtgr) plays an important role in fish reproduction. This receptor functions to incorporate vitellogenin (Vtg), a macromolecule synthesized and released from the liver in the bloodstream, into oocytes where it is processed into yolk. Although studies have focused on the functional role of Vtgr in fish, the mechanistic control of this gene is still unexplored. Here we report the identification and analysis of the first piscine 5' regulatory region of the vtgr gene which was cloned from largemouth bass (Micropterus salmoides). Using this putative promoter sequence, we investigated a role for hormones, including insulin and 17β-estradiol (E2), in transcriptional regulation through cell-based reporter assays. No effect of insulin was observed, however, E2 was able to repress transcriptional activity of the vtgr promoter through select estrogen receptor subtypes, Esr1 and Esr2a but not Esr2b. Electrophoretic mobility shift assay demonstrated that Esr1 likely interacts with the vtgr promoter region through half ERE and/or SP1 sites, in part. Finally we also show that ethinylestradiol (EE2), but not bisphenol-A (BPA), represses promoter activity similarly to E2. These results reveal for the first time that the Esr1 isoform may play an inhibitory role in the expression of LMB vtgr mRNA under the influence of E2, and potent estrogens such as EE2. In addition, this new evidence suggests that vtgr may be a target of select endocrine disrupting compounds through environmental exposures. © The Author 2014. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Henneberg, Anja; Triebskorn, Rita
2015-01-01
Endocrine effects in the aquatic environment are in the focus of scientists and media along with debates on the necessity of further steps in wastewater treatment. In the present study VTG responses were compared to evaluate upgrades at wastewater treatment plants (WWTPs). We investigated several advanced sewage treatment technologies at two WWTPs connected to the Schussen, a tributary of Lake Constance, for the reduction of hormonal activity: (1) a powdered activated charcoal filter at the WWTP Langwiese; and (2) a combination of ozonation, sand filter, and granulated activated carbon filter at the WWTP Eriskirch. Rainbow trout and brown trout were either directly exposed to the effluents in aquaria or cages, or in a bypass system flown through by surface water of the Schussen. As a reference, trout were kept in bypass aquaria at the Argen River, which is less influenced by micropollutants. As a biomarker for estrogenicity, we analyzed the yolk precursor protein vitellogenin in immature rainbow trout and brown trout and in trout larvae (100 days post-fertilization) prior to and after the upgrade with the new technologies. Trout of different ages and species were used to detect differences in their sensitivity. At both bypass stations, larvae of brown trout showed significantly higher vitellogenin levels prior to the upgrade compared to negative control levels. Female brown trout exposed at the bypass station downstream of the WWTP showed decreased vitellogenin levels after the upgrade. In 1-year-old immature trout directly exposed to the respective effluents, no significant effects of the upgrades on vitellogenin levels were found. In general, larger effects were observed in brown trout than in rainbow trout, indicating that they are more sensitive test organisms.
Rocha, Otávio Pelegrino; De Oliveira, Danielle Palma
2017-01-01
Tannery effluents consist of a complex chemical composition not only limited to primary pollutants, which also require biological detection as these compounds may produce adverse effects. The fish embryo toxicity (FET) test with Danio rerio is an alternative method in hazard and risk assessment for determination of chemical-mediated effects. The aim of this investigation was to use the FET test to detect compounds and consequent effects in Brazilian tannery effluents. Samples were collected from the inlet and outlet of the effluent treatment plant at a tannery located in Restinga, São Paulo, Brazil. The toxicological effects were assessed using FET assay for a period of 144 hr using indices such as (1) coagulation of fertilized eggs, (2) lack of detachment of tail-bud from yolk sac, (3) absence of spontaneous movement, (4) yolk sack edema, (5) malformation of the tail, (6) scoliosis, and (7) deformation of swim bladder in the embryos. Data showed that effluent treatment plant exposure produced acute toxicity in D. rerio embryos as evidenced by coagulation of fertilized eggs in up to 5% of all diluted samples 24 hr post fertilization for inlet effluent samples compared to 100% coagulation for outlet samples. Results demonstrated that these effects may not be attributed to metals, but to other non-detected components, such as dyes, pigments, biocides, carriers, surfactants, or other organic compounds that might be present in these complex mixtures. The use of D. rerio embryos was found to be useful as an additional tool for ecotoxicity testing to assess the potential environmental acute toxicity influence of tannery effluents.
Aurori, Cristian M; Buttstedt, Anja; Dezmirean, Daniel S; Mărghitaş, Liviu A; Moritz, Robin F A; Erler, Silvio
2014-06-01
To date five different theories compete in explaining the biological mechanisms of senescence or ageing in invertebrates. Physiological, genetical, and environmental mechanisms form the image of ageing in individuals and groups. Social insects, especially the honeybee Apis mellifera, present exceptional model systems to study developmentally related ageing. The extremely high phenotypic plasticity for life expectancy resulting from the female caste system provides a most useful system to study open questions with respect to ageing. Here, we used long-lived winter worker honeybees and measured transcriptional changes of 14 antioxidative enzyme, immunity, and ageing-related (insulin/insulin-like growth factor signaling pathway) genes at two time points during hibernation. Additionally, worker bees were challenged with a bacterial infection to test ageing- and infection-associated immunity changes. Gene expression levels for each group of target genes revealed that ageing had a much higher impact than the bacterial challenge, notably for immunity-related genes. Antimicrobial peptide and antioxidative enzyme genes were significantly upregulated in aged worker honeybees independent of bacterial infections. The known ageing markers vitellogenin and IlP-1 were opposed regulated with decreasing vitellogenin levels during ageing. The increased antioxidative enzyme and antimicrobial peptide gene expression may contribute to a retardation of senescence in long-lived hibernating worker honeybees. © The Author 2013. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Sex-specific vitellogenin production in immature rainbow trout
Energy Technology Data Exchange (ETDEWEB)
Carlson, D.B.; Williams, D.E.
1999-10-01
Many xenobiotics interact with hormone systems of animals, potentially leading to a phenomenon commonly called endocrine disruption. Much attention has focused on steroid hormone systems and corresponding receptor proteins, particularly estrogens. Vitellogenin (Vg) was measured in sexually immature rainbow trout (Oncorhynchus mykiss) exposed to 17{beta}-estradiol (E{sub 2}) in the diet. Mixed-sex populations of trout aged 3, 6, 12, or 18 months were maintained separately and fed E{sub 2} at 0.05 or 2.5 mg/kg for 7d. Females fed E{sub 2} at 0.05 mg/kg consistently produced three- to fourfold greater amounts of Vg than similarly aged males. Age- and sex-matched fish fed E{sub 2} at 2.5 mg/kg produced equivalent amounts of Vg. Sex differences in Vg production were apparent only at a dose of E{sub 2} (0.05 mg/kg) that results in submaximal Vg induction. Their results document the importance of considering the sex of juvenile fish when using Vg production as a marker of xenoestrogen exposure.
Vitellogenin from the silkworm, Bombyx mori: an effective anti-bacterial agent.
Singh, Nitin Kumar; Pakkianathan, Britto Cathrin; Kumar, Manish; Prasad, Tulika; Kannan, Mani; König, Simone; Krishnan, Muthukalingan
2013-01-01
Silkworm, Bombyx mori, vitellogenin (Vg) was isolated from perivisceral fat body of day 3 of pupa. Both Vg subunits were co-purified as verified by mass spectrometry and immunoblot. Purified Vg responded to specific tests for major posttranslational modifications on native gels indicating its nature as lipo-glyco-phosphoprotein. The Vg fraction had strong antibacterial activity against Gram negative bacterium Escherichia coli and Gram positive bacterium Bacillus subtilis. Microscopic images showed binding of Vg to bacterial cells and their destruction. When infected silkworm larvae were treated with purified Vg they survived the full life cycle in contrast to untreated animals. This result showed that Vg has the ability to inhibit the proliferation of bacteria in the silkworm fluid system without disturbing the regular metabolism of the host.
Palumbo, Amanda J.
2008-01-01
Vitellogenin (Vg), the estrogen inducible protein precursor to egg yolk, serves as an indicator of exposure to estrogen mimicking environmental contaminants. Vg was isolated by size exclusion and ion exchange chromatography from plasma of California halibut (Paralichthys californicus) treated with estrogen. MALDI TOF mass spectrometry (MS) analysis resulted in a molecular mass of 188 kDa. MS/MS de novo sequencing provided evidence that California halibut has more than one form of Vg. Similar ...
Detection of vitellogenin incorporation into zebrafish oocytes by FITC fluorescence
Directory of Open Access Journals (Sweden)
Yokoi Hayato
2011-04-01
Full Text Available Abstract Background Large volumes of lymph can be collected from the eye-sacs of bubble-eye goldfish. We attempted to induce vitellogenin (Vtg in the eye-sac lymph of bubble-eye goldfish and develop a method for visualizing Vtg incorporation by zebrafish oocytes using FITC-labeling. Methods Estrogen efficiently induced Vtg in the eye-sac lymph of goldfish. After FITC-labeled Vtg was prepared, it was injected into mature female zebrafish. Results Incorporation of FITC-labeled Vtg by zebrafish oocytes was detected in in vivo and in vitro experiments. The embryos obtained from zebrafish females injected with FITC-labeled Vtg emitted FITC fluorescence from the yolk sac and developed normally. Conclusion This method for achieving Vtg incorporation by zebrafish oocytes could be useful in experiments related to the development and endocrinology of zebrafish oocytes.
SIMS chemical and isotopic analysis of impact features from LDEF experiments AO187-1 and AO187-2
Stadermann, Frank J.; Amari, Sachiko; Foote, John; Swan, Pat; Walker, Robert M.; Zinner, Ernst
1995-01-01
Previous secondary ion mass spectrometry (SIMS) studies of extended impact features from LDEF capture cell experiment AO187-2 showed that it is possible to distinguish natural and man-made particle impacts based on the chemical composition of projectile residues. The same measurement technique has now been applied to specially prepared gold target impacts from experiment AO187-1 in order to identify the origins of projectiles that left deposits too thin to be analyzed by conventional energy-dispersive x-ray (EDX) spectroscopy. The results indicate that SIMS may be the method of choice for the analysis of impact deposits on a variety of sample surfaces. SIMS was also used to determine the isotopic compositions of impact residues from several natural projectiles. Within the precision of the measurements all analyzed residues show isotopically normal compositions.
Lee, Soo Rin; Lee, Ji-Hyun; Kim, Ah Ran; Kim, Sanghee; Park, Hyun; Baek, Hea Ja; Kim, Hyun-Woo
2016-02-01
Three full-length cDNAs encoding lipoprotein homologs were identified in Tigriopus kingsejongensis, a newly identified copepod from Antarctica. Structural and transcriptional analyses revealed homology with two vitellogenin-like proteins, Tik-Vg1 and Tik-Vg2, which were 1855 and 1795 amino acids in length, respectively, along with a third protein, Tik-MEP, which produced a 1517-residue protein with similarity to a melanin engaging protein (MEP) in insects Phylogenetic analysis showed that Vgs in Maxillopods including two Tik-Vgs belong to the arthropod vitellogenin-like clade, which includes clottable proteins (CPs) in decapod crustaceans and vitellogenins in insects. Tik-MEP clustered together with insect MEPs, which appear to have evolved before the apoB-like and arthropod Vg-like clades. Interestingly, no genes orthologous to those found in the apoB clade were identified in Maxillopoda, suggesting that functions of large lipid transfer proteins (LLTPs) in reproduction and lipid metabolism may be different from those in insect and decapod crustaceans. As suggested by phylogenetic analyses, the two Tik-Vgs belonging to the arthropod Vg-like clade appear to play major roles in oocyte maturation, while Vgs belonging to the apoB clade function primarily in the reproduction of decapod crustaceans. Transcriptional analysis of Tik-Vg expression revealed a 24-fold increase in mature and ovigerous females compared with immature female, whereas expression of Tik-MEP remained low through all reproductive stages. Acute temperature changes did not affect the transcription of Tik-Vg genes, whereas Tik-MEP appeared to be affected by temperature change. Among the three hormones thought to be involved in molting and reproduction in arthropods, only farnesoic acid (FA) induced transcription of the two Tik-Vg genes. Regardless of developmental stage and hormone treatment, Tik-Vg1 and Tik-Vg2 exhibited a strong positive correlation in expression, suggesting that expression of these
Endocrine-disrupting effect of the ultraviolet filter benzophenone-3 in zebrafish, Danio rerio
DEFF Research Database (Denmark)
Kinnberg, Karin Lund; Petersen, Gitte I.; Albrektsen, Mette
2015-01-01
of BP-3 in zebrafish (Danio rerio) in the Fish Sexual Development Test (Organisation for Economic Co-operation and Development TG 234) and a 12 day adult male zebrafish study. In TG 234, exposure from 0 to 60 d posthatch caused a monotone dose-dependent skewing of the phenotypic sex ratio towards less...
A tapeworm molecule manipulates vitellogenin expression in the beetle Tenebrio molitor
Warr, E.; Meredith, J. M.; Nimmo, D. D.; Basu, S.; Hurd, H.; Eggleston, P.
2006-01-01
Metacestodes of Hymenolepis diminuta secrete a molecule that decreases vitellogenin (Vg) synthesis in the beetle host, Tenebrio molitor. The 5608 bp T. molitor Vg cDNA represents a single-copy gene encoding a single open reading frame of 1821 amino acids with a predicted molecular mass of 206 kDa. Northern blot analysis revealed detectable levels of transcripts only in adult females. In vivo, Vg mRNA abundance was significantly higher in fat bodies from infected females compared with control females at all but the earliest time point. In vitro, Vg mRNA abundance was significantly increased in fat bodies incubated with live stage I–II parasites. The apparent conflict between increased Vg mRNA abundance and decreased Vg protein in fat bodies from infected females is discussed. PMID:16907836
Vitellogenin from the silkworm, Bombyx mori: an effective anti-bacterial agent.
Directory of Open Access Journals (Sweden)
Nitin Kumar Singh
Full Text Available Silkworm, Bombyx mori, vitellogenin (Vg was isolated from perivisceral fat body of day 3 of pupa. Both Vg subunits were co-purified as verified by mass spectrometry and immunoblot. Purified Vg responded to specific tests for major posttranslational modifications on native gels indicating its nature as lipo-glyco-phosphoprotein. The Vg fraction had strong antibacterial activity against Gram negative bacterium Escherichia coli and Gram positive bacterium Bacillus subtilis. Microscopic images showed binding of Vg to bacterial cells and their destruction. When infected silkworm larvae were treated with purified Vg they survived the full life cycle in contrast to untreated animals. This result showed that Vg has the ability to inhibit the proliferation of bacteria in the silkworm fluid system without disturbing the regular metabolism of the host.
Phototoxicity of TiO2 nanoparticles to zebrafish (Danio rerio) is dependent on life stage
The zebrafish (Danio rerio) embryo has been increasingly used as a model to evaluate toxicity of manufactured nanomaterials. Many studies indicate that the embryo chorion may protect animals from toxic effects of nanomaterials, suggesting that post-hatch life stages may be more s...
The studies presented in this manuscript focus on characterization of genomic responses to anti-androgens in zebrafish (Danio rerio). Research of the effects of anti-androgens in fish has been characterized by a heavy reliance on apical endpoints, and molecular mechanisms of acti...
Osterauer, Raphaela; Köhler, Heinz-R; Triebskorn, Rita
2010-08-01
The platinum group metals (PGMs) platinum (Pt), palladium (Pd), and rhodium (Rh) are used in automobile catalytic converters, from which they have been emitted into the environment to an increasing degree during the last 20 years. Despite the bioavailability of these metals to plants and animals, studies determining the effects of PGMs on organisms are extremely rare. In the present study, effects of various concentrations of PtCl(2) (0.1, 1, 10, 50 and 100 microg/L) were investigated with respect to the induction of hsp70 and histopathological alterations in the zebrafish, Danio rerio and the ramshorn snail, Marisa cornuarietis. Histopathological investigations revealed effects of Pt on both species, which varied between slight and strong cellular reactions, depending on the PtCl(2) concentration. The hsp70 level in M. cornuarietis did not show an increase following Pt exposure whereas it was significantly elevated at 100 micorg/L PtCl(2) in D. rerio. Copyright 2010 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Perović Andrej
2013-01-01
Full Text Available As a part of Sediment Quality Triad (SQT, organic extracts of sediment from Skadar Lake (a Mediterranean lake and the largest freshwater reservoir in southeastern Europe were investigated in order to evaluate possible ecotoxicological contamination by organic pollutants and to obtain a comprehensive insight into the ecotoxicological hazard. Sediments were investigated for toxicity by two different bioassays. Acute cytotoxicity was investigated using the fibroblast-like cell line RTL-W1 (Oncorhynchus mykiss in combination with the neutral red retention assay. The embryos of zebrafish (Danio rerio were used to assess the toxic and teratogenic potential of organic extracts of the sediment. Preliminary results point to the presence of a cytotoxic and teratogenic potential in Skadar Lake sediment extracts in certain locations.
Chronic effects of clofibric acid in zebrafish (Danio rerio): A multigenerational study
Energy Technology Data Exchange (ETDEWEB)
Coimbra, Ana M., E-mail: acoimbra@utad.pt [Centre for The Research and Technology of Agro-Environmental and Biological Sciences (CITAB), University of Trás-os-Montes e Alto Douro (UTAD), Quinta de Prados, 5000-801 Vila Real (Portugal); Department of Biology and Environment, Life Sciences and Environment School (ECVA), University of Trás-os-Montes e Alto Douro (UTAD), Quinta de Prados, 5000-801 Vila Real (Portugal); Peixoto, Maria João [CIMAR/CIIMAR, Interdisciplinary Centre for Marine and Environmental Research, University of Porto, Rua dos Bragas 177, 4050-123 Porto (Portugal); Department of Biology and Environment, Life Sciences and Environment School (ECVA), University of Trás-os-Montes e Alto Douro (UTAD), Quinta de Prados, 5000-801 Vila Real (Portugal); Coelho, Inês; Lacerda, Ricardo [CIMAR/CIIMAR, Interdisciplinary Centre for Marine and Environmental Research, University of Porto, Rua dos Bragas 177, 4050-123 Porto (Portugal); Carvalho, António Paulo [CIMAR/CIIMAR, Interdisciplinary Centre for Marine and Environmental Research, University of Porto, Rua dos Bragas 177, 4050-123 Porto (Portugal); FCUP, Faculty of Sciences University of Porto, Department of Biology, Rua do Campo Alegre, 4169-007 Porto (Portugal); Gesto, Manuel [CIMAR/CIIMAR, Interdisciplinary Centre for Marine and Environmental Research, University of Porto, Rua dos Bragas 177, 4050-123 Porto (Portugal); Department of Functional Biology and Health Sciences, Faculty of Biology, University of Vigo, As Lagoas-Marcosende s/n, 36310, Vigo (Spain); Lyssimachou, Angeliki; Lima, Daniela; Soares, Joana; André, Ana; Capitão, Ana [CIMAR/CIIMAR, Interdisciplinary Centre for Marine and Environmental Research, University of Porto, Rua dos Bragas 177, 4050-123 Porto (Portugal); and others
2015-03-15
Highlights: • Clofibric acid (CA) induces multigenerational effects in zebrafish (Danio rerio). • CA impacts fish lipid metabolism, with similarities to those reported in mammals. • Weight is impacted in F1 and F2 generations, thought with opposite patterns. - Abstract: Clofibric acid (CA) is an active metabolite of the blood lipid lowering agent clofibrate, a pharmaceutical designed to work as agonist of peroxisome proliferator-activated receptor alpha (PPARa). It is the most commonly reported fibrate in aquatic environments with low degradation rate and potential environmental persistence. Previous fish exposures showed that CA may impact spermatogenesis, growth and the expression of fat binding protein genes. However, there are limited data on the effects of chronic multigenerational CA exposures. Here, we assessed chronic multigenerational effects of CA exposure using zebrafish (Danio rerio) as a teleost model. Zebrafish were exposed through the diet to CA (1 and 10 mg/g) during their whole lifetime. Growth, reproduction-related parameters and embryonic development were assessed in the exposed fish (F1 generation) and their offspring (F2 generation), together with muscle triglyceride content and gonad histology. In order to study the potential underlying mechanisms, the transcription levels of genes coding for enzymes involved in lipid metabolism pathways were determined. The results show that chronic life-cycle exposure to CA induced a significant reduction in growth of F1 generation and lowered triglyceride muscle content (10 mg/g group). Also, an impact in male gonad development was observed together with a decrease in the fecundity (10 mg/g group) and higher frequency of embryo abnormalities in the offspring of fish exposed to the lowest CA dose. The profile of the target genes was sex- and tissue-dependent. In F1 an up-regulation of male hepatic pparaa, pparb and acox transcript levels was observed, suggesting an activation of the fatty acid
Chronic effects of clofibric acid in zebrafish (Danio rerio): A multigenerational study
International Nuclear Information System (INIS)
Coimbra, Ana M.; Peixoto, Maria João; Coelho, Inês; Lacerda, Ricardo; Carvalho, António Paulo; Gesto, Manuel; Lyssimachou, Angeliki; Lima, Daniela; Soares, Joana; André, Ana; Capitão, Ana
2015-01-01
Highlights: • Clofibric acid (CA) induces multigenerational effects in zebrafish (Danio rerio). • CA impacts fish lipid metabolism, with similarities to those reported in mammals. • Weight is impacted in F1 and F2 generations, thought with opposite patterns. - Abstract: Clofibric acid (CA) is an active metabolite of the blood lipid lowering agent clofibrate, a pharmaceutical designed to work as agonist of peroxisome proliferator-activated receptor alpha (PPARa). It is the most commonly reported fibrate in aquatic environments with low degradation rate and potential environmental persistence. Previous fish exposures showed that CA may impact spermatogenesis, growth and the expression of fat binding protein genes. However, there are limited data on the effects of chronic multigenerational CA exposures. Here, we assessed chronic multigenerational effects of CA exposure using zebrafish (Danio rerio) as a teleost model. Zebrafish were exposed through the diet to CA (1 and 10 mg/g) during their whole lifetime. Growth, reproduction-related parameters and embryonic development were assessed in the exposed fish (F1 generation) and their offspring (F2 generation), together with muscle triglyceride content and gonad histology. In order to study the potential underlying mechanisms, the transcription levels of genes coding for enzymes involved in lipid metabolism pathways were determined. The results show that chronic life-cycle exposure to CA induced a significant reduction in growth of F1 generation and lowered triglyceride muscle content (10 mg/g group). Also, an impact in male gonad development was observed together with a decrease in the fecundity (10 mg/g group) and higher frequency of embryo abnormalities in the offspring of fish exposed to the lowest CA dose. The profile of the target genes was sex- and tissue-dependent. In F1 an up-regulation of male hepatic pparaa, pparb and acox transcript levels was observed, suggesting an activation of the fatty acid
Coelho, Roberta R; de Souza Júnior, José Dijair Antonino; Firmino, Alexandre A P; de Macedo, Leonardo L P; Fonseca, Fernando C A; Terra, Walter R; Engler, Gilbert; de Almeida Engler, Janice; da Silva, Maria Cristina M; Grossi-de-Sa, Maria Fatima
2016-09-01
Vitellogenin (Vg), a yolk protein precursor, is the primary egg nutrient source involved in insect reproduction and embryo development. The Cotton Boll weevil (CBW) Anthonomus grandis Boheman, the most important cotton pest in Americas, accumulates large amounts of Vg during reproduction. However, the precise role of this protein during embryo development in this insect remains unknown. Herein, we investigated the effects of vitellogenin (AgraVg) knockdown on the egg-laying and egg viability in A. grandis females, and also characterized morphologically the unviable eggs. AgraVg transcripts were found during all developmental stages of A. grandis, with highest abundance in females. Silencing of AgraVg culminated in a significant reduction in transcript amount, around 90%. Despite this transcriptional reduction, egg-laying was not affected in dsRNA-treated females but almost 100% of the eggs lost their viability. Eggs from dsRNA-treated females showed aberrant embryos phenotype suggesting interference at different stages of embryonic development. Unlike for other insects, the AgraVg knockdown did not affect the egg-laying ability of A. grandis, but hampered A. grandis reproduction by perturbing embryo development. We concluded that the Vg protein is essential for A. grandis reproduction and a good candidate to bio-engineer the resistance against this devastating cotton pest.
DEFF Research Database (Denmark)
Boucard, C.G.V.; Levy, P.; Ceccaldi, H.J.
2002-01-01
The objective of the present study was to characterize the relationship between vitellogenin (Vtg) and vitellin (Vt) concentration profiles during the reproductive cycle of the penaeid prawn Fenneropenaeus indicus. Vt was purified from ovaries of vitellogenic females by gradient ultracentrifugati...
Efficacy of Cleaning and Disinfection Procedures in a Zebrafish (Danio rerio) Facility
Garcia, Rachel L; Sanders, George E
2011-01-01
Appropriate cleaning and disinfection procedures in zebrafish (Danio rerio) laboratories are crucial in preventing the spread of aquatic animal pathogens and minimizing the build-up of waste products and biologic matter. The procedures selected should accomplish these goals and incorporate the individual needs of various laboratories. In this study of a single zebrafish facility, we assessed the efficacy of 2 different cleaning and disinfection procedures for nets, tanks, and lids. ATP levels...
AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.
Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel
2017-05-01
Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.
Because Zebrafish (Danio rerio) have become a popular and important model for scientific research, the capability to rear larval zebrafish to adulthood is of great importance. Recently research examining the effects of diet (live versus processed) have been published. In the cu...
Zhang, Yi-Fan
2012-09-18
Isocyanide is a potential antifouling compound in marine environments. In this study, we investigated its mode of action in three aquatic organisms. Two of them, the bryozoan Bugula neritina and the barnacle Balanus amphitrite, are major marine fouling invertebrates, and the other organism is the non-target species zebrafish Danio rerio. In the swimming larvae of B. neritina, isocyanide did not affect the total attachment rate (≤50 µg ml^(−1)), but it did change the attachment site by increasing the percentage of attachment on the bottom of the container rather than on the wall or air-water inter-surface. Isocyanide binds several proteins in B. neritina as identified via SDS-PAGE-LC-MS/MS: 1) a 30 kD protein band containing two proteins similar to voltage dependent anion channels (VDAC), which control the direct coupling of the mitochondrial matrix to the energy maintenance of the cytosol and the release of apoptogenic factors from mitochondria of mammalian cells; and 2) an unknown 39 kD protein. In B. amphitrite cyprids, the isocyanide binding protein were 1) a protein similar to NADH-ubiquinone oxidoreductase, which is the “entry enzyme” of oxidative phosphorylation in mitochondria; and 2) cytochrome P450. In Danio rerio embryos, isocyanide caused “wavy” notochords, hydrocephalus, pericardial edema, poor blood circulation, and defects in pigmentation and hematopoiesis, which phenocopied copper deficiency. This is the first report on isocyanide binding proteins in fouling organisms, as well as the first description of its phenotype and potential toxicology in zebrafish.
Wang, Yanhua; Wu, Shenggan; Chen, Jine; Zhang, Changpeng; Xu, Zhenlan; Li, Gang; Cai, Leiming; Shen, Weifeng; Wang, Qiang
2018-02-01
Pesticides usually present in mixtures in surface waters, although they are traditionally regulated on an individual basis in aquatic ecosystems. In this study, we aimed to investigate the lethal and transcriptional responses of individual and combined pesticides (iprodione, pyrimethanil, pyraclostrobin and acetamiprid) on zebrafish (Danio rerio). Semi-static toxicity test indicated that the greatest toxicity to the four life stages (embryonic, larval, juvenile and adult stages) of D. rerio was detected from pyraclostrobin, followed by iprodione and pyrimethanil. In contrast, the lowest toxicity to the organisms was found from acetamiprid. Most of the selected pesticides exerted greater toxicities to D. rerio of embryonic stage compared with other life stages. Synergistic responses were observed from all binary mixtures of iprodione in combination with pyrimethanil or acetamiprid and ternary mixtures of iprodione+pyraclostrobin in combination with pyrimethanil or acetamiprid. The expressions of 16 genes related to cell apoptosis pathway, oxidative stress response, innate immunity and endocrine disruption at the mRNA level showed that zebrafish embryos were affected by the individual or combined pesticides. The expressions of P53, Tnf, TRβ, Tsh and Cyp19a exhibited greater changes upon exposure to combined pesticides compared with individual pesticides. Taken together, increased toxicity might be triggered by the simultaneous presence of several pesticides in the aquatic environment, which seriously damaged the non-target organisms. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Gordon, Denise A.; Toth, Gregory P.; Graham, David W.; Lazorchak, James M.; Reddy, Tirumuru V.; Knapp, Charles W.; Noyelles, Frank de; Campbell, Scott; Lattier, David L.
2006-01-01
This study evaluated the effect of aquatic secondary nutrient supply levels (nitrogen and phosphorus) on the subcellular response of adult male fathead minnows (Pimephales promelas) exposed to a single nominal concentration of 17α-ethynylestradiol (EE2), a potent synthetic estrogen, under quasi-natural field conditions. Outdoor mesocosms were maintained under low, medium, and high nutrient supply conditions as categorized by total phosphorus (TP) level (nominal 0.012, 0.025, and 0.045 mg TP/L, respectively), and treated with EE2 with and without a carrier solvent. Using reverse transcription-polymerase chain reaction methods, vitellogenin gene (Vg) expression was determined in the fish collected at 0 h, 8 h, 24 h, 4 d, 7 d, and 14 d post-exposure. Induction of Vg was detected as early as 8 h post-exposure, with and without the carrier solvent, and persisted through Day 14. Results showed Vg to be significantly greater at low nutrient levels (p < 0.05), suggesting that EE2 bioavailability to the fish was likely greater under less-turbid water conditions. - Nutrient condition in surface waters strongly influences vitellogenin gene expression in male fathead minnows
Dicty_cDB: Contig-U05312-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 246 ) PDUts1124F05 Porcine testis cDNA library I Sus sc... 48 0.32 1 ( CT631096 ) Danio rerio EST, clone ZF_mu... 46 1.2 1 ( CV877151 ) PDUts1160G12 Porcine testis cDNA library I Sus sc... 46 1.2 1 ( CT729188 ) Danio rerio EST, clone ZF_mu... 44 4.9 1 ( CV865498 ) PDUts1018G06 Porcine testis cDNA library I Sus sc... 44 4.9 1 ( CT735187 ) Danio rerio EST, clone ZF_mu...774433 ) McClintock41_B07.ab1 Homarus EST library project ... 54 0.005 1 ( AU269391 ) Dictyostelium discoideum vegetati...1 3'. 46 1.2 1 ( CK415565 ) AUF_IpPit_32_p21 Pituitary cDNA library Ictalurus...
DEFF Research Database (Denmark)
Morthorst, Jane Ebsen; Mathiesen, Karsten Korsholm; Holbech, Henrik
2018-01-01
biomarkers for estrogenic exposure, and feminized fish have been observed downstream WWTP outlets in many countries. Danish central WWTPs reduce effluent estrogenicity effectively by advanced sewage treatment, and feminizations have not been observed downstream central WWTP outlets. However, between 2000......Feminization of male and juvenile fish caused by exposure to estrogens or estrogenic chemicals in effluents from central wastewater treatment plants (WWTP) is a worldwide issue of concern. Intersex and induction of the female yolk protein, vitellogenin, in male and juvenile fish are robust...
Ossa-López, Paula A; Castaño-Villa, Gabriel J; Rivera-Páez, Fredy A
2017-09-25
The zebrafish (Danio rerio) is one of the most studied aquatic organisms for water biomonitoring, due to its sensitivity to environmental degradation and resistance to toxic substances. This study determined the presence of micronuclei and nuclear abnormalities in peripheral blood erythrocytes, and assessed the gene expression of caspase-3 (CASP-3) and metallothionein 1 (MT-1) in the gills and liver of D. rerio. The study fish (n = 45) were exposed to water collected from two stations with mining impact (E2 and E3) and a reference station without evident mining contamination (E1), all located in La Elvira stream (Manizales-Colombia). In addition, a positive control (PC) with HgCl 2 (50 μg/L) and negative control (NC) with tap water were included. The fish from the PC and E2 and E3 treatments displayed genotoxic effects and changes in gene expression, with significant differences in micronuclei formation and the presence of blebbed nuclei. The cytochrome oxidase subunit I (COI) gene was used as reference and proved to be stable compared to the β-actin and 28S ribosomal RNA (28S) genes. In gills, CASP-3 expression was higher in the PC, and MT-1 expression was higher in the PC and E3 treatment. In liver, CASP-3 was expressed in the E2 treatment, and MT-1 expression was low. These results show that the genotoxic effects and differential gene expression observed in fish exposed to water from La Elvira stream could also be affecting the organisms present in this habitat.
Genotoxic effects of boric acid and borax in zebrafish, Danio rerio using alkaline comet assay.
Gülsoy, Nagihan; Yavas, Cüneyd; Mutlu, Özal
2015-01-01
The present study is conducted to determine the potential mechanisms of Boron compounds, boric acid (BA) and borax (BX), on genotoxicity of zebrafish Danio rerio for 24, 48, 72 and 96-hours acute exposure (level:1, 4, 16, 64 mg/l BA and BX) in semi-static bioassay experiment. For that purpose, peripheral erythrocytes were drawn from caudal vein and Comet assay was applied to assess genotoxicity. Acute (96 hours) exposure and high concentrations of boric acid and borax increases % tail DNA and Olive tail moment. Genotoxicity was found for BA as concentration-dependent and BX as concentration and time dependent manner. In general, significant effects (P borax-induced genotoxicity in fish.
Probiotic supplementation promotes calcification in Danio rerio larvae: a molecular study.
Directory of Open Access Journals (Sweden)
Francesca Maradonna
Full Text Available A growing number of studies have been showing that dietary probiotics can exert beneficial health effects in both humans and animals. We previously demonstrated that dietary supplementation with Lactobacillus rhamnosus - a component of the human gut microflora - enhances reproduction, larval development, and the biomineralization process in Danio rerio (zebrafish. The aim of this study was to identify the pathways affected by L. rhamnosus during zebrafish larval development. Our morphological and histochemical findings show that L. rhamnosus accelerates bone deposition through stimulation of the expression of key genes involved in ossification, e.g. runt-related transcription factor 2 (runx2, Sp7 transcription factor (sp7, matrix Gla protein (mgp, and bone gamma-carboxyglutamate (gla protein (bglap as well as through inhibition of sclerostin (sost, a bone formation inhibitor. Western blot analysis of mitogen-activated protein kinase 1 and 3-(Mapk1 and Mapk3, which are involved in osteoblast and osteocyte differentiation, documented an increase in Mapk1 16 days post fertilization (dpf and of Mapk3 23 dpf in individuals receiving L. rhamnosus supplementation. Interestingly, a reduction of sost detected in the same individuals suggests that the probiotic may help treat bone disorders.
Jensen-Clem, Rebecca; Duev, Dmitry A.; Riddle, Reed; Salama, Maïssa; Baranec, Christoph; Law, Nicholas M.; Kulkarni, S. R.; Ramprakash, A. N.
2018-01-01
Robo-AO is an autonomous laser guide star adaptive optics (AO) system recently commissioned at the Kitt Peak 2.1 m telescope. With the ability to observe every clear night, Robo-AO at the 2.1 m telescope is the first dedicated AO observatory. This paper presents the imaging performance of the AO system in its first 18 months of operations. For a median seeing value of 1.″44, the average Strehl ratio is 4% in the i\\prime band. After post processing, the contrast ratio under sub-arcsecond seeing for a 2≤slant i\\prime ≤slant 16 primary star is five and seven magnitudes at radial offsets of 0.″5 and 1.″0, respectively. The data processing and archiving pipelines run automatically at the end of each night. The first stage of the processing pipeline shifts and adds the rapid frame rate data using techniques optimized for different signal-to-noise ratios. The second “high-contrast” stage of the pipeline is eponymously well suited to finding faint stellar companions. Currently, a range of scientific programs, including the synthetic tracking of near-Earth asteroids, the binarity of stars in young clusters, and weather on solar system planets are being undertaken with Robo-AO.
Functional characterization of the vitellogenin promoter in the silkworm, Bombyx mori.
Xu, J; Wang, Y Q; Li, Z Q; Ling, L; Zeng, B S; You, L; Chen, Y Z; Aslam, A F M; Huang, Y P; Tan, A J
2014-10-01
Genetic transformation and genome editing technologies have been successfully established in the lepidopteran insect model, the domesticated silkworm, Bombyx mori, providing great potential for functional genomics and practical applications. However, the current lack of cis-regulatory elements in B. mori gene manipulation research limits further exploitation in functional gene analysis. In the present study, we characterized a B. mori endogenous promoter, Bmvgp, which is a 798-bp DNA sequence adjacent to the 5'-end of the vitellogenin gene (Bmvg). PiggyBac-based transgenic analysis shows that Bmvgp precisely directs expression of a reporter gene, enhanced green fluorescent protein (EGFP), in a sex-, tissue- and stage-specific manner. In transgenic animals, EGFP expression can be detected in the female fat body from larval-pupal ecdysis to the following pupal and adult stage. Furthermore, in vitro and in vivo experiments revealed that EGFP expression can be activated by 20-hydroxyecdysone, which is consistent with endogenous Bmvg expression. These data indicate that Bmvgp is an effective endogenous cis-regulatory element in B. mori. © 2014 The Royal Entomological Society.
Sensibilidade da rosa 'Osiana' ao etileno
Directory of Open Access Journals (Sweden)
Delaine Cristina Cordeiro
2011-01-01
Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.
Directory of Open Access Journals (Sweden)
Cristina Mendes Peter
Full Text Available RESUMO: Dentre as propriedades biológicas da própolis, a atividade antimicrobiana tem merecido destacada atenção. No presente trabalho, descreve-se a ação antiviral e virucida de três extratos hidroalcoólicos de própolis (marrom, verde e de abelhas jataí (Tetragonisca angustula, frente ao Herpesvírus Bovino tipo (BoHV-1 e ao Vírus da Diarreia Viral Bovina (BVDV. Os três extratos hidroalcoólicos foram obtidos de extração etanólica e são oriundos do sul do Brasil. A composição química dos extratos de própolis foi determinada pela cromatografia líquida de alta eficiência acoplada a espectrômetro de massas (UFLC-PDA-ESI-TOF/MS que identificou e quantificou compostos como: ácido cafeico e ácido p-cumárico, ácido clorogênico, ácido ferúlico, além de flavonoides como a rutina. A toxicidade celular bem como a atividade antiviral dos extratos de própolis em monocamadas de células MDBK (Madin-Darby Bovine Kidney foi avaliada através de observação microscópica e quantificada pelo teste de MTT (3-(4,5 dimetiltiazol-2yl-2-5-difenil-2H tetrazolato de bromo. O extrato de própolis de abelhas jataí demonstrou ser menos citotóxico (1,57μg/mL, quando comparado aos extratos verde (0,78μg/mL e marrom (0,39μg/mL. Quanto a atividade antiviral, a própolis verde demostrou maior eficácia em ambos os tratamentos celulares (pós e pré-exposição frente ao BoHV-1 em relação aos outros extratos, ou seja, houve maior viabilidade celular quando comparada aos controles de células e vírus. Já a de jataí apresentou atividade frente aos dois vírus (BoHV-1 e BVDV no método pré-infecção, enquanto a própolis marrom demonstrou ação apenas frente ao BoHV-1 também no método pré-infecção. Para determinação da atividade virucida foram utilizadas diferentes diluições dos vírus, bem como temperaturas e tempos distintos de incubação. A própolis verde a 37°C propiciou a maior redução no título viral (4,33log em
Kalicharan, D; Jongebloed, WL; Rawson, DM; Zhang, TT
1998-01-01
The morphology of embryos of the fresh water teleost, Brachydania rerio (zebrafish), was examined in a parallel FE-SEM/TEM study, after various pre- and post-fixation regimes. Special attention was paid to the chorion, the contents of the peri-vitelline space, the plasma membrane, the syncytial
Inward rectifier potassium current (I K1) and Kir2 composition of the zebrafish (Danio rerio) heart.
Hassinen, Minna; Haverinen, Jaakko; Hardy, Matt E; Shiels, Holly A; Vornanen, Matti
2015-12-01
Electrophysiological properties and molecular background of the zebrafish (Danio rerio) cardiac inward rectifier current (IK1) were examined. Ventricular myocytes of zebrafish have a robust (-6.7 ± 1.2 pA pF(-1) at -120 mV) strongly rectifying and Ba(2+)-sensitive (IC50 = 3.8 μM) IK1. Transcripts of six Kir2 channels (drKir2.1a, drKir2.1b, drKir2.2a, drKir2.2b, drKir2.3, and drKir2.4) were expressed in the zebrafish heart. drKir2.4 and drKir2.2a were the dominant isoforms in both the ventricle (92.9 ± 1.5 and 6.3 ± 1.5%) and the atrium (28.9 ± 2.9 and 64.7 ± 3.0%). The remaining four channels comprised together less than 1 and 7 % of the total transcripts in ventricle and atrium, respectively. The four main gene products (drKir2.1a, drKir2.2a, drKir2.2b, drKir2.4) were cloned, sequenced, and expressed in HEK cells for electrophysiological characterization. drKir2.1a was the most weakly rectifying (passed more outward current) and drKir2.2b the most strongly rectifying (passed less outward current) channel, whilst drKir2.2a and drKir2.4 were intermediate between the two. In regard to sensitivity to Ba(2+) block, drKir2.4 was the most sensitive (IC50 = 1.8 μM) and drKir2.1a the least sensitive channel (IC50 = 132 μM). These findings indicate that the Kir2 isoform composition of the zebrafish heart markedly differs from that of mammalian hearts. Furthermore orthologous Kir2 channels (Kir2.1 and Kir2.4) of zebrafish and mammals show striking differences in Ba(2+)-sensitivity. Structural and functional differences needs to be taken into account when zebrafish is used as a model for human cardiac electrophysiology, cardiac diseases, and in screening cardioactive substances.
In Vivo Toxicity of Silver Nanoparticles and Silver Ions in Zebrafish (Danio rerio
Directory of Open Access Journals (Sweden)
Katrine Bilberg
2012-01-01
Full Text Available The influence of water chemistry on characterised polyvinyl pyrrolidone- (PVP- coated silver nanoparticles (81 nm was investigated. NaCl solution series of 100–800 mg L−1 lead to initial and temporal increase in nanoparticles size, but agglomeration was limited. pH variation (5–8 had only minor influence on the hydrodynamic particle size. Acute toxicity of nanosivler to zebrafish (Danio rerio was investigated in a 48-hour static renewal study and compared with the toxicity of silver ions (AgNO3. The nanosilver and silver ion 48-hour median lethal concentration (LC50 values were 84 μg L−1 and 25 μg L−1, respectively. To investigate exposure-related stress, the fish behaviour was observed visually after 0, 3, 6, 12, 24, 27, 30, and 48 hours of both nanosilver and ionic silver treatments. These observations revealed increased rate of operculum movement and surface respiration after nanosilver exposure, suggesting respiratory toxicity. The present study demonstrates that silver nanoparticles are lethal to zebrafish.
Bluhm, K.; Otte, J; Yang, L.; Zinsmeister, C.; Legradi, J.B.; Keiter, S.; Kosmehl, T.; Braunbeck, T.; Straehle, U.; Hollert, H.
2014-01-01
Purpose: Recently, a proof-of-concept study revealed the suitability of transcriptome analyses to obtain and assess changes in the abundance of transcripts in zebrafish (Danio rerio) embryos after exposure to organic sediment extracts. The present study investigated changes in the transcript
Cardoso-Júnior, Carlos A M; Guidugli-Lazzarini, Karina R; Hartfelder, Klaus
2018-01-01
The canonic regulatory module for lifespan of honey bee (Apis mellifera) workers involves a mutual repressor relationship between juvenile hormone (JH) and vitellogenin (Vg). Compared to vertebrates, however, little is known about a possible role of epigenetic factors. The full genomic repertoire of DNA methyltransferases (DNMTs) makes the honey bee an attractive emergent model for studying the role of epigenetics in the aging process of invertebrates, and especially so in social insects. We first quantified the transcript levels of the four DNMTs encoding genes in the head thorax and abdomens of workers of different age, showing that dnmt1a and dnmt3 expression is up-regulated in abdomens of old workers, whereas dnmt1b and dnmt2 are down-regulated in heads of old workers. Pharmacological genome demethylation by RG108 treatment caused an increase in worker lifespan. Next, we showed that the genomic DNA methylation status indirectly affects vitellogenin gene expression both in vitro and in vivo in young workers, and that this occurs independent of caloric restriction or JH levels, suggesting that a non-canonical circuitry may be acting in parallel with the JH/Vg module to regulate the adult life cycle of honey bee workers. Our data provide evidence that epigenetic factors play a role in regulatory networks associated with complex life history traits of a social insect. Copyright © 2017 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Keiter, Susanne; Baumann, Lisa; Farber, H
2012-01-01
aimed at evaluating the long-term effects and toxicity-increasing behavior of PFOS in vivo using the zebrafish (Danio rerio). Fish were maintained in flow-through conditions and exposed to single and binary mixtures of PFOS and the endocrine disruptor bisphenol A (BPA) at nominal concentrations of 0...
Resveratrol radiomodifier effect on Danio rerio embriolarval assay
Energy Technology Data Exchange (ETDEWEB)
Damasceno, Kelme C.; Mamede, Fernanda C.S.; Cavalcante, Adriana K.; Rogero, Sizue O.; Rogero, José R. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Ferreira, Monica L., E-mail: kelmecardoso@gmail.com, E-mail: monica.lopesferreira@butantan.gov.br [Instituto Butantan, São Paulo, SP (Brazil)
2017-07-01
The ionizing radiation can cause fatal damages to cells by the direct interaction with DNA and RNA or a series of toxic reactions occasioning chemical and biological changes. There are compounds with radioprotective potential, like resveratrol. For use these compounds it is necessary to know their toxicity and interaction with the organism. Resveratrol is a substance found in peanuts, grapes and wine and its production occurs in plants as a response to physical, chemical and biological stress. Some studies have indicated that it has many health benefits. Danio rerio (zebrafish) is a vertebrate animal and has become the model of several studies related to human diseases, due to its genomes similarity of 70 %, rapid embryonic development and the transparency of the eggs, which make it possible to observe the effects during the test period. The aim of the present study was to verify the resveratrol radiomodifier effect on zebrafish during the embryolarval development by modified Fish Embryo Acute Toxicity (FET) based on OECD236 and the obtained lethal concentration of resveratrol (LC50) was 66.9 mg.L{sup -1}. Before, to understand the effects of radiation, was carried out the gamma radiation lethal dose (LD50) assay and the LD50 was 25 Gy. With these results the project will continue later to finish the study of the radiomodifier effect of resveratrol in the presence of gamma radiation. (author)
Resveratrol radiomodifier effect on Danio rerio embriolarval assay
International Nuclear Information System (INIS)
Damasceno, Kelme C.; Mamede, Fernanda C.S.; Cavalcante, Adriana K.; Rogero, Sizue O.; Rogero, José R.; Ferreira, Monica L.
2017-01-01
The ionizing radiation can cause fatal damages to cells by the direct interaction with DNA and RNA or a series of toxic reactions occasioning chemical and biological changes. There are compounds with radioprotective potential, like resveratrol. For use these compounds it is necessary to know their toxicity and interaction with the organism. Resveratrol is a substance found in peanuts, grapes and wine and its production occurs in plants as a response to physical, chemical and biological stress. Some studies have indicated that it has many health benefits. Danio rerio (zebrafish) is a vertebrate animal and has become the model of several studies related to human diseases, due to its genomes similarity of 70 %, rapid embryonic development and the transparency of the eggs, which make it possible to observe the effects during the test period. The aim of the present study was to verify the resveratrol radiomodifier effect on zebrafish during the embryolarval development by modified Fish Embryo Acute Toxicity (FET) based on OECD236 and the obtained lethal concentration of resveratrol (LC50) was 66.9 mg.L -1 . Before, to understand the effects of radiation, was carried out the gamma radiation lethal dose (LD50) assay and the LD50 was 25 Gy. With these results the project will continue later to finish the study of the radiomodifier effect of resveratrol in the presence of gamma radiation. (author)
SRAO: the first southern robotic AO system
Law, Nicholas M.; Ziegler, Carl; Tokovinin, Andrei
2016-08-01
We present plans for SRAO, the first Southern Robotic AO system. SRAO will use AO-assisted speckle imaging and Robo-AO-heritage high efficiency observing to confirm and characterize thousands of planet candidates produced by major new transit surveys like TESS, and is the first AO system to be capable of building a comprehensive several-thousand-target multiplicity survey at sub-AU scales across the main sequence. We will also describe results from Robo-AO, the first robotic LGS-AO system. Robo-AO has observed tens of thousands of Northern targets, often using a similar speckle or Lucky-Imaging assisted mode. SRAO will be a moderate-order natural-guide-star adaptive optics system which uses an innovative photoncounting wavefront sensor and EMCCD speckle-imaging camera to guide on faint stars with the 4.1m SOAR telescope. The system will produce diffraction-limited imaging in the NIR on targets as faint as mν = 16. In AO-assisted speckle imaging mode the system will attain the 30-mas visible diffraction limit on targets at least as faint as mν = 17. The system will be the first Southern hemisphere robotic adaptive optics system, with overheads an order of magnitude smaller than comparable systems. Using Robo-AO's proven robotic AO software, SRAO will be capable of observing overheads on sub-minute scales, allowing the observation of at least 200 targets per night. SRAO will attain three times the angular resolution of the Palomar Robo-AO system in the visible.
Münch, Daniel; Ihle, Kate E; Salmela, Heli; Amdam, Gro V
2015-11-01
In comparative gerontology, highly social insects such as honey bees (Apis mellifera) receive much attention due to very different and flexible aging patterns among closely related siblings. While experimental strategies that manipulate socio-environmental factors suggest a causative link between aging and social signals and behaviors, the molecular underpinnings of this linkage are less well understood. Here we study the atypical localization of the egg-yolk protein vitellogenin (Vg) in the brain of the honey bee. Vg is known to influence honey bee social regulation and aging rate. Our findings suggest that Vg immunoreactivity in the brain is specifically localized within the class of non-neuronal glial cells. We discuss how these results can help explain the socially-dependent aging rate of honey bees. Copyright © 2015 Elsevier Inc. All rights reserved.
Tissue distribution and functional analysis of vitellogenin-6 of Toxocara canis.
Zhu, Hong-Hong; Ma, Guang-Xu; Luo, Yong-Fang; Luo, Yong-Li; Yin, Sha-Sha; Xiong, Yi; Zhou, Rong-Qiong
2017-06-01
Toxocara canis is an common intestinal nematode of canids and the principal causative agent of human toxocariasis. Vitellogenin (Vg), a source of amino acids and lipids in the eggs, are considered to play an important role in embryo development of a wide range of organisms. In the present study, the transcriptional levels of Tc-vit-6 gene in male and female adult T. canis were determined by quantitative real-time PCR, which indicated high transcription of Tc-vit-6 in the intestine, reproductive tract and body wall of male and female adult T. canis. The fragment of Tc-vit-6 encoding a vWD domain, was cloned and expressed to produce a rabbit anti-TcvWD polyclonal antibody. Tissue distribution of TcVg6 was detected by immunohistochemical assays, which showed predominant distribution of TcVg6 in the tissues of intestine, as well as reproductive tract (including some of the germ cells) and musculature of male and female adult worms. Collectively, these results indicated multiple biological roles of TcVg6 apart from that in the reproduction of T. canis. Copyright © 2017 Elsevier Inc. All rights reserved.
Evaluation of visible implant elastomer tags in zebrafish (Danio rerio
Directory of Open Access Journals (Sweden)
Claudia Hohn
2013-11-01
The use of the visible implant elastomer (VIE tagging system in zebrafish (Danio rerio was examined. Two tag orientations (horizontal and vertical at the dorsal fin base were tested for tag retention, tag fragmentation and whether VIE tags affected growth and survival of juvenile zebrafish (1–4 month post hatch. Six tag locations (abdomen, anal fin base, caudal peduncle, dorsal fin base, pectoral fin base, isthmus and 5 tag colors (yellow, red, pink, orange, blue were evaluated for ease of VIE tag application and tag visibility in adult zebrafish. Long-term retention (1 year and multiple tagging sites (right and left of dorsal fin and pectoral fin base were examined in adult zebrafish. Lastly, survival of recombination activation gene 1−/− (rag1−/− zebrafish was evaluated after VIE tagging. The best tag location was the dorsal fin base, and the most visible tag color was pink. Growth rate of juvenile zebrafish was not affected by VIE tagging. Horizontal tagging is recommended in early stages of fish growth (1–2 months post hatch. VIE tags were retained for 1 year and tagging did not interfere with long-term growth and survival. There was no mortality associated with VIE tagging in rag1−/− zebrafish. The VIE tagging system is highly suitable for small-sized zebrafish. When familiar with the procedure, 120 adult zebrafish can be tagged in one hour. It does not increase mortality in adult zebrafish or interfere with growth in juvenile or adult zebrafish.
Tetlak, Alicia G; Burnett, Jacob B; Hahn, Daniel A; Hatle, John D
2015-12-01
Reduced reproduction has been shown to increase lifespan in many animals, yet the mechanisms behind this trade-off are unclear. We addressed this question by combining two distinct, direct means of life-extension via reduced reproduction, to test whether they were additive. In the lubber grasshopper, Romalea microptera, ovariectomized (OVX) individuals had a ~20% increase in lifespan and a doubling of storage relative to controls (Sham operated). Similarly, young female grasshoppers treated with RNAi against vitellogenin (the precursor to egg yolk protein) had increased fat body mass and halted ovarian growth. In this study, we compared VgRNAi to two control groups that do not reduce reproduction, namely buffer injection (Buffer) and injection with RNAi against a hexameric storage protein (Hex90RNAi). Each injection treatment was tested with and without ovariectomy. Hence, we tested feeding, storage, and lifespans in six groups: OVX and Buffer, OVX and Hex90RNAi, OVX and VgRNAi, Sham and Buffer, Sham and Hex90RNAi, and Sham and VgRNAi. Ovariectomized grasshoppers and VgRNAi grasshoppers each had similar reductions in feeding (~40%), increases in protein storage in the hemolymph (150-300%), and extensions in lifespan (13-21%). Ovariectomized grasshoppers had higher vitellogenin protein levels than did VgRNAi grasshoppers. Last but not least, when ovariectomy and VgRNAi were applied together, there was no greater effect on feeding, protein storage, or longevity. Hence, feeding regulation, and protein storage in insects, may be conserved components of life-extension via reduced reproduction.
Robo-AO KP: A new era in robotic adaptive optics
Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy
2016-01-01
Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.
Osterauer, Raphaela
2010-01-01
Seit der Einführung des Kfz-Katalysators werden die Platingruppenelemente Platin, Palladium und Rhodium vermehrt in die Umwelt eingetragen und gelangen u.a. über Straßenabflussgewässer in aquatische Ökosysteme. Die vorliegende Arbeit untersuchte die Effekte verschiedener Konzentrationen des löslichen Platinchlorids (0, 0.1, 10, 50, 100 und 200 µg/L PtCl2) auf verschiedene Endpunkte während der frühen Individualentwicklung der beiden Süßwasserorganismen Zebrabärbling (Danio rerio) und Para...
Natural preference of zebrafish (Danio rerio for a dark environment
Directory of Open Access Journals (Sweden)
Serra E.L.
1999-01-01
Full Text Available The zebrafish (Danio rerio has been used as a model in neuroscience but knowledge about its behavior is limited. The aim of this study was to determine the preference of this fish species for a dark or light environment. Initially we used a place preference test and in a second experiment we applied an exit latency test. A two-chamber aquarium was used for the preference test. The aquarium consisted of a black chamber and a white chamber. In the first experiment the animal was placed in the aquarium and the time spent in the two compartments was recorded for 10 min. More time was spent in the black compartment (Wilcoxon matched-pairs signed-rank test, T = 7, N1 = N2 = 18, P = 0.0001. In the second experiment the animal was placed in the black or white compartment and the time it took to go from the initial compartment to the opposite one was recorded. The test lasted a maximum of 10 min. The results showed that the animal spent more time to go from the black to the white compartment (Mann-Whitney rank sum test, T = 48, N1 = 9, N2 = 8, P<0.0230. These data suggest that this fish species has a natural preference for a dark environment and this characteristic can be very useful for the development of new behavioral paradigms for fish.
DEFF Research Database (Denmark)
Baumann, Lisa; Holbech, Henrik; Schiller, V.S.
: the androgen trenbolone binds directly and very effectively to the androgen receptor. Ethinylestradiol, a synthetic derivative of estradiol, causes feminization in wildlife and humans. The fungicide prochloraz acts as an aromatase inhibitor by direct interference with the aromatization of androgens......Endocrine disrupting chemicals (EDCs) exert effects at very low concentrations and can cause serious problems for the hormonal balance of various organisms. Exposure of wildlife to EDCs is not necessarily continuous, but may often occur in pulses. Consequently for the evaluation of the long......-term effects on populations, it is essential to know whether such EDC-related effects are reversible. Three different substances selected for different modes of action were tested for their long-term impact on sex ratio, gonadal development, vitellogenin (VTG) induction and aromatase activity in zebrafish...
Dominguez, Gustavo A; Quattro, Joseph M; Denslow, Nancy D; Kroll, Kevin J; Prucha, Melinda S; Porak, Wesley F; Grier, Harry J; Sabo-Attwood, Tara L
2012-09-01
Fish vitellogenin synthesized and released from the liver of oviparous animals is taken up into oocytes by the vitellogenin receptor. This is an essential process in providing nutrient yolk to developing embryos to ensure successful reproduction. Here we disclose the full length vtgr cDNA sequence for largemouth bass (LMB) that reveals greater than 90% sequence homology with other fish vtgr sequences. We classify LMB Vtgr as a member of the low density lipoprotein receptor superfamily based on conserved domains and categorize as the short variant that is devoid of the O-glycan segment. Phylogenetic analysis places LMB Vtgr sequence into a well-supported monophyletic group of fish Vtgr. Real-time PCR showed that the greatest levels of LMB vtgr mRNA expression occurred in previtellogenic ovarian tissues. In addition, we reveal the effects of insulin, 17beta-estradiol (E(2)), and 11-ketotestosterone (11-KT) in modulation of vtgr, esr, and ar mRNAs in previtellogenic oocytes. Insulin increased vtgr expression levels in follicles ex vivo while exposure to E(2) or 11-KT did not result in modulation of expression. However, both steroids were able to repress insulin-induced vtgr transcript levels. Coexposure with insulin and E(2) or of insulin and 11-KT increased ovarian esr2b and ar mRNA levels, respectively, which suggest a role for these nuclear receptors in insulin-mediated signaling pathways. These data provide the first evidence for the ordered stage-specific expression of LMB vtgr during the normal reproductive process and the hormonal influence of insulin and sex steroids on controlling vtgr transcript levels in ovarian tissues.
DEFF Research Database (Denmark)
Skjolding, Lars Michael; Asmonaite, G.; Jolk, R.
2015-01-01
Despite nanoparticles being used in many different products and applications, the effects and fate in the environment are still not well understood. Uptake of nanoparticles into cells has been shown in vitro and in vivo. However, it is challenging to find suitable methods to identify uptake...... and determine localization on a whole organism level. Furthermore, methods used to identify nanoparticle uptake have been associated with artefacts induced by sample preparation including staining methods for electron microscopy. This study used Fluorescent Light Sheet Microscopy (FLSM) to determine uptake...... to the particles through the diet or the water phase in a series of separate experiments. In the dietary exposure experiments Artemia salina were exposed to 1 mg Au/L for 24h before being fed to D. rerio. For exposure through the water phase 1 mg Au/L was added directly to aquaria holding the fish and non...
Lambret-Frotté, Julia; Artico, Sinara; Muniz Nardeli, Sarah; Fonseca, Fernando; Brilhante Oliveira-Neto, Osmundo; Grossi-de-Sá, Maria Fatima; Alves-Ferreira, Marcio
2016-01-01
Cotton is one of the most economically important cultivated crops. It is the major source of natural fiber for the textile industry and an important target for genetic modification for both biotic stress and herbicide tolerance. Therefore, the characterization of genes and regulatory regions that might be useful for genetic transformation is indispensable. The isolation and characterization of new regulatory regions is of great importance to drive transgene expression in genetically modified crops. One of the major drawbacks in cotton production is pest damage; therefore, the most promising, cost-effective, and sustainable method for pest control is the development of genetically resistant cotton lines. Considering this scenario, our group isolated and characterized the promoter region of a MCO (multicopper oxidase) from Gossypium hirsutum, named GhAO-like1 (ascorbate oxidase-like1). The quantitative expression, together with the in vivo characterization of the promoter region reveals that GhAO-like1 has a flower- and fruit-specific expression pattern. The GUS activity is mainly observed in stamens, as expected considering that the GhAO-like1 regulatory sequence is enriched in cis elements, which have been characterized as a target of reproductive tissue specific transcription factors. Both histological and quantitative analyses in Arabidopsis thaliana have confirmed flower (mainly in stamens) and fruit expression of GhAO-like1. In the present paper, we isolated and characterized both in silico and in vivo the promoter region of the GhAO-like1 gene. The regulatory region of GhAO-like1 might be useful to confer tissue-specific expression in genetically modified plants.
Analysis of Lethality and Malformations During Zebrafish (Danio rerio) Development.
Raghunath, Azhwar; Perumal, Ekambaram
2018-01-01
The versatility offered by zebrafish (Danio rerio) makes it a powerful and an attractive vertebrate model in developmental toxicity and teratogenicity assays. Apart from the newly introduced chemicals as drugs, xenobiotics also induce abnormal developmental abnormalities and congenital malformations in living organisms. Over the recent decades, zebrafish embryo/larva has emerged as a potential tool to test teratogenicity potential of these chemicals. Zebrafish responds to compounds as mammals do as they share similarities in their development, metabolism, physiology, and signaling pathways with that of mammals. The methodology used by the different scientists varies enormously in the zebrafish embryotoxicity test. In this chapter, we present methods to assess lethality and malformations during zebrafish development. We propose two major malformations scoring systems: binomial and relative morphological scoring systems to assess the malformations in zebrafish embryos/larvae. Based on the scoring of the malformations, the test compound can be classified as a teratogen or a nonteratogen and its teratogenic potential is evaluated.
International Nuclear Information System (INIS)
Desantis, S.; Corriero, A.; Cirillo, F.; Deflorio, M.; Brill, R.; Griffiths, M.; Lopata, A.L.; Serna, J.M. de la; Bridges, C.R.; Kime, D.E.; De Metrio, G.
2005-01-01
Cytochrome P4501A (CYP1A) monoxygenase, vitellogenin (Vtg) and Zona radiata proteins (Zrp) are frequently used as biomarkers of fish exposure to organic contaminants. In this work, swordfish liver sections obtained from the Mediterranean Sea, the South African coasts (South Atlantic and South Western Indian Oceans) and the Central North Pacific Ocean were immunostained with antisera against CYP1A, Zrp, and Vtg. CYP1A induction was found in hepatocytes, epithelium of the biliary ductus and the endothelium of large blood vessels of fish from the Mediterranean Sea and South African waters, but not from the Pacific Ocean. Zrp and Vtg were immunolocalized in hepatocytes of male swordfish from the Mediterranean Sea and from South African waters. Plasma Dot-Blot analysis, performed in Mediterranean and Pacific specimens, revealed the presence of Zrp and Vtg in males from Mediterranean but not from Pacific. These results confirm previous findings about the potential exposure of Mediterranean swordfish to endocrine, disrupting chemicals and raise questions concerning the possible presence of xenobiotic contaminants off the Southern coasts of South Africa in both the South Atlantic and South Western Indian Oceans
To identify transcription factors (TFs), members of hypothalamic-pituitary- gonadal axis (HPG-axis), TF networks and signaling pathways underlying generalized effects of 3-beta hydroxysteroid dehydrogenase (HSD3B) inhibition, reproductively mature zebrafish (Danio rerio) were exp...
Fluoride caused thyroid endocrine disruption in male zebrafish (Danio rerio).
Jianjie, Chen; Wenjuan, Xue; Jinling, Cao; Jie, Song; Ruhui, Jia; Meiyan, Li
2016-02-01
Excessive fluoride in natural water ecosystem has the potential to detrimentally affect thyroid endocrine system, but little is known of such effects or underlying mechanisms in fish. In the present study, we evaluated the effects of fluoride on growth performance, thyroid histopathology, thyroid hormone levels, and gene expressions in the HPT axis in male zebrafish (Danio rerio) exposed to different determined concentrations of 0.1, 0.9, 2.0 and 4.1 M of fluoride to investigate the effects of fluoride on thyroid endocrine system and the potential toxic mechanisms caused by fluoride. The results indicated that the growth of the male zebrafish used in the experiments was significantly inhibited, the thyroid microtrastructure was changed, and the levels of T3 and T4 were disturbed in fluoride-exposed male fish. In addition, the expressional profiles of genes in HPT axis displayed alteration. The expressions of all studied genes were significantly increased in all fluoride-exposed male fish after exposure for 45 days. The transcriptional levels of corticotrophin-releasing hormone (CRH), thyroid-stimulating hormone (TSH), thyroglobulin (TG), sodium iodide symporter (NIS), iodothyronine I (DIO1), and thyroid hormone receptor alpha (TRα) were also elevated in all fluoride-exposed male fish after 90 days of exposure, while the inconsistent expressions were found in the mRNA of iodothyronineⅡ (DIO2), UDP glucuronosyltransferase 1 family a, b (UGT1ab), transthyretin (TTR), and thyroid hormone receptor beta (TRβ). These results demonstrated that fluoride could notably inhibit the growth of zebrafish, and significantly affect thyroid endocrine system by changing the microtrastructure of thyroid, altering thyroid hormone levels and endocrine-related gene expressions in male zebrafish. All above indicated that fluoride could pose a great threat to thyroid endocrine system, thus detrimentally affected the normal function of thyroid of male zebrafish. Copyright © 2015
Directory of Open Access Journals (Sweden)
José Eisenberg
2000-05-01
Full Text Available O texto resenha Ao leitor sem medo, de Renato Janine Ribeiro (Belo Horizonte, UFMG, 1999.This text is a review of Ao leitor sem medo by Renato Janine Ribeiro (Belo Horizonte, UFMG, 1999
Effect of tributyltin on antioxidant ability and immune responses of zebrafish (Danio rerio).
Zhang, Chun-Nuan; Zhang, Ji-Liang; Ren, Hong-Tao; Zhou, Bian-Hua; Wu, Qiu-Jue; Sun, Ping
2017-04-01
Tributyltin (TBT) is a toxic compound released into aquatic ecosystems through antifouling paints. This study was designed to examine the effects of TBT on antioxidant ability and immune responses of zebrafish (Danio rerio). Three hundred sixty healthy zebrafish were randomly grouped into four groups and exposed to different doses of TBT (0, 1, 10 and 100ngL -1 ). At the end of 8 weeks, the fish were sampled, and antioxidant capability, immune parameters and immune-related genes were assessed. The results showed that with an increase in TBT dose, the concentration of malonaldehyde in the liver was significantly increased (p<0.05), whereas the activities of total superoxide dismutase, catalase and glutathione peroxidase were significantly decreased (p<0.05) compared to the control. The activity and expression of lysozyme and the content of immunoglobulin M were significantly decreased compared to those of the fish exposed to 0ngL -1 TBT (p<0.05). However, the expression of the HSP70, HSP90, tumor necrosis factor-α(TNF-α), interleukins (IL-1β, IL-6), and nuclear factor-kappa B p65 (NF-κ B p65) genes were all enhanced with an increase in TBT dose. The results indicated that TBT induced oxidative stress and had immunotoxic effects on zebrafish. Copyright © 2016 Elsevier Inc. All rights reserved.
Tamanho ao nascer e problemas de saúde mental aos 11 anos em uma coorte brasileira de nascimentos
Directory of Open Access Journals (Sweden)
Erika Alejandra Giraldo Gallo
2011-08-01
Full Text Available O objetivo foi avaliar a associação entre tamanho ao nascer e problemas de saúde mental aos 11 anos na Coorte de Nascimentos de Pelotas, Rio Grande do Sul, Brasil, de 1993. Foram pesados e medidos ao nascer 4.358 recém-nascidos. Avaliou-se problemas de saúde mental com o questionário de capacidades e dificuldades (Strengths and Difficulties Questionnaire - SDQ. A prevalência de problemas de saúde mental foi de 32% (IC95%: 31-33. Na análise ajustada, os 291 (6,7% recém-nascidos com escorez de peso/idade e os 268 (6,2% com índice de massa corporal (IMC/idade +2 DP tiveram, respectivamente, 34% (IC95%: 6-71 e 19% (IC95%: 1-40 maior risco de apresentar esses problemas se comparados com aqueles com escore normal. Os resultados sugerem que fatores ocorridos na gestação e refletidos nas medidas de tamanho ao nascer podem ocasionar problemas de saúde mental em etapas tardias.
Evaluation of anaesthetic protocols for laboratory adult zebrafish (Danio rerio.
Directory of Open Access Journals (Sweden)
Tânia Martins
Full Text Available In the last decades, the use of zebrafish (Danio rerio in biomedical research has increased. Anaesthesia is daily used in fish during experimental procedures to avoid discomfort, stress or pain. Also, fish welfare and the reliability of results can be compromised if an unsuitable anaesthetic protocol is used. Therefore, we aimed to refine anaesthetic protocols to be used in adult zebrafish by evaluating the efficacy of different anaesthetics, used alone or in combination. For that, zebrafish were randomly assigned to 8 different groups: 100 μg/mLMS-222 (MS; 0.2 μg/mL etomidate (E; 0.2 μg/mL etomidate + 100 μg/mL lidocaine (E+L; 1.25 μg/mL propofol (P; 1.25 μg/mL propofol + 100 μg/mL lidocaine (P+L; 100 μg/mL ketamine (K; 100 μg/mL ketamine + 1.25 μg/mL medetomidine (K+M; and 100 μg/mL ketamine + 1.25 μg/mL medetomidine/3.125 μg/mL atipamezole (K+M/A. The animals were placed in an anaesthetic water bath, then, the following parameters were registered: time for equilibrium loss and anaesthesia induction, loss of sensitivity to soft and painful stimuli, respiratory rate, recovery time, and activity after recovery. The combined forms of E+L, P+L and K+M were the fastest to induce a surgical anaesthetic stage. Nevertheless, E+L induced respiratory depression, while K+M was shown to have the longer recovery time compared to MS-222, even when atipamezole was added. In conclusion, the P+L combination was shown to provide good anaesthesia with analgesia, without causing a major respiratory depression, providing as well a quick recovery, similar to MS-222.
Rawson, DM; Zhang, T; Kalicharan, D; Jongebloed, WL
The structure of the chorion and plasma membranes of gastrula-stage zebrafish Brachydanio rerio embryos were studied using field emission scanning electron microscopy (FE-SEM) and transmission electron microscopy (TEM). These studies confirm the outer chorion membrane complex to be 1.5-2.5 mu m in
Lee, Jin Wuk; Yoon, Hong-Gil; Lee, Sung Kyu
2015-05-01
Oryzias latipes, Danio rerio, Cyprinus carpio, and Zacco platypus are useful indicator species for CYP1A biomarker studies; however, comparative studies have not been performed. To compare susceptibility, dose- and time-dependent CYP1A induction at the mRNA and protein levels in response to benzo(a)pyrene (BaP) exposure was analyzed. At the mRNA level, a statistically significant difference was found among the four species; however, such was not observed at the protein level. C. carpio showed the highest CYP1A induction level and the steepest slope in the dose-response curve. To assess susceptibility, the difference in CYP1A mRNA induction among species must be considered, and C. carpio was the most sensitive species of the four evaluated in terms of CYP1A expression. Copyright © 2015 Elsevier B.V. All rights reserved.
Saka, Masahiro; Tada, Noriko; Kamata, Yoichi
2008-09-01
Vitellogenin (VTG), a yolk-precursor protein in oviparous vertebrates, is a useful biomarker for reproductive physiology and environmental estrogenic pollution. To examine interspecific applicability of an enzyme-linked immunosorbent assay (ELISA) for quantifying Chinemys reevesii VTG, we observed cross-reactivity between a polyclonal antibody against Chinemys reevesii VTG and the VTGs from other turtle species: Chelydra serpentina (Chelydridae), Macrochelys temminckii (Chelydridae), and Pelodiscus sinensis (Trionychidae), which are phylogenetically distant from Chinemys reevesii (Geoemydidae). The VTGs of the three species were induced by injecting estradiol 17beta into the turtles and purified by using the EDTA-MgCl(2) precipitation method. The purified VTG appeared as a 200-kDa protein in sodium dodecylsulfate polyacrylamide gel electrophoresis, indicating that the molecular mass of the VTGs of the three species was similar to that of Chinemys reevesii VTG. The purified VTGs were serially diluted (0.004-2 mug/ml) and applied to the ELISA. Although the VTGs of the two chelydrid turtles showed cross-reactivity in a concentration-dependent manner, the degree of cross-reactivity was only 22.8-41.2% (mean=30.0%) and 19.7-53.0% (mean=33.2%) for Chelydra serpentina VTG and Macrochelys temminckii VTG, respectively. The ELISA may therefore be theoretically applicable to measure relative levels of the VTGs of these two species, but the absolute concentration values may be inaccurate. Pelodiscus sinensis VTG showed almost no cross-reactivity (8.0-9.7%, mean=8.9%) at any concentration tested, thus indicating the inapplicability of the ELISA to quantify Pelodiscus sinensis VTG. There are thus limitations in extending the applicability of the ELISA across species, even within the order Testudines.
Adesão ao tratamento no transtorno bipolar
Santin,Aida; Ceresér,Keila; Rosa,Adriane
2005-01-01
O transtorno bipolar (TB) é uma doença crônica, recorrente, presente em 1,5% da população, estando associada a altas taxas de mortalidade e prejuízos socioeconômicos. O lítio, a carbamazepina e o ácido valpróico são os estabilizadores de humor mais usados. Em tratamentos prolongados, como é o caso do TB, a má-adesão dos pacientes é uma das maiores dificuldades. Verifica-se que fatores ligados ao paciente, aos medicamentos e aos médicos possam ser responsáveis pela baixa adesão. A psicoeducaçã...
Pharmacological analyses of learning and memory in zebrafish (Danio rerio).
Bailey, Jordan M; Oliveri, Anthony N; Levin, Edward D
2015-12-01
Over the last decade, zebrafish (Danio rerio) have become valuable as a complementary model in behavioral pharmacology, opening a new avenue for understanding the relationships between drug action and behavior. This species offers a useful intermediate approach bridging the gap between in vitro studies and traditional mammalian models. Zebrafish offer great advantages of economy compared to their rodent counterparts, their complex brains and behavioral repertoire offer great translational potential relative to in vitro models. The development and validation of a variety of tests to measure behavior, including cognition, in zebrafish have set the stage for the use of this animal for behavioral pharmacology studies. This has led to research into the basic mechanisms of cognitive function as well as screening for potential cognition-improving drug therapies, among other lines of research. As with all models, zebrafish have limitations, which span pharmacokinetic challenges to difficulties quantifying behavior. The use, efficacy and limitations associated with a zebrafish model of cognitive function are discussed in this review, within the context of behavioral pharmacology. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Borhan Mansouri
2016-06-01
Full Text Available Objective: To evaluate the combined effects of silver nanoparticles (Ag NPs and Hg2+ on the gill histopathology of zebrafish (Danio rerio under the controlled conditions. Methods: In this study, one non-lethal concentration of Ag NPs (0.1 mg/L, six concentrations of Hg2+ (0.001, 0.005, 0.01, 0.05, 0.1 and 0.2 mg/L, and six mixture concentrations of Ag NPs and Hg2+ (0.1 plus 0.001, 0.005, 0.01, 0.05, 0.1, and 0.2 mg/L were used as the control group. After 4 days of exposure, samples were prepared for gill histology. Results: The results showed that notable damages were observed in aneurism, such as vacuolation of secondary lamella, fusion, hypertrophy, mucus secretion and necrosis. Moreover, our findings indicated that the Hg2+ and Ag NPs alone led to shorter secondary lamella length and smaller lamellae’s diameter of gills compared to the mixture of Ag NPs and Hg2+. However, the extent of damages in gill tissues after exposure to mixture of Ag NPs and Hg2+ was lower than Hg2+ ions and Ag NPs. Conclusions: It appears that the presence of Ag NPs can potentially reduce the toxicity of Hg2+ ions. However, to assess the toxicity mechanisms of nanoparticles in presence of pollutants, further studies should be encouraged.
DEFF Research Database (Denmark)
Baumann, Lisa; Knörr, Susanne; Keiter, Susanne
2014-01-01
The aim of the present study was to investigate the persistence of the feminizing effects of discontinued 17α-ethinylestradiol (EE2) exposure on zebrafish (Danio rerio). An exposure scenario covering the sensitive phase of sexual differentiation, as well as final gonad maturation was chosen...... to examine the estrogenic effects on sexual development of zebrafish. Two exposure scenarioswere compared: continuous exposure to environmentally relevant concentrations (0.1–10 ng/L EE2) up to 100 days post-hatch (dph) and developmental exposure up to 60 dph, followed by 40 days of depuration in clean water....... The persistence of effects was investigated at different biological organization levels from mRNA to population-relevant endpoints to cover a broad range of important parameters. EE2 had a strong feminizing and inhibiting effect on the sexual development of zebrafish. Brain aromatase (cyp19b)mRNA expression...
Directory of Open Access Journals (Sweden)
Anastasia A. Batrakova
2015-11-01
Full Text Available Known, that some teleostei can perceive the geomagnetic field (GMF. However, the information about magnetosensitivity in Cyprinidae fish from artificial and natural habitats is obscure. We have registered preferred directions in Danio rerio (Hamilton from aquaria-cultivated line exposed to the natural GMF, 180 degrees reversal of horizontal GMF component, 180 degrees reversal of vertical GMF component, 180 degrees reversal of both vertical and horizontal GMF components and 90 degrees clockwise turn of horizontal GMF component. We also registered the preferred directions in Rutilus rutilus (L. from Rybinsk reservoir exposed to the natural GMF and 90 degrees clockwise turn of horizontal GMF component. It was found that zebrafish prefer two opposite directions towards east and west in the natural GMF. When the horizontal component of GMF was turned 90 degrees clockwise D. rerio prefer two opposite directions towards north and south. The possible reason of bimodality in zebrafish’s preferred directions distributions is discussed. The only direction towards east-north-east observed in roach under the natural GMF. This direction coincided with the way from the place of capture to the streamflow part of Rybinsk reservoir. And it was changed by south-south-east direction when turned the horizontal component of GMF 90 degrees clockwise. The possible reason of the choosing directions by fish with GMF is discussed.
International Nuclear Information System (INIS)
Magalhaes, Ilizabete; Pihan, Jean-Claude; Falla, Jairo
2004-01-01
Estrogen mimics are pollutants present in the aquatic environment. These compounds induce abnormalities in the reproductive system of male fishes, which lead to a total or partial male feminization, or to their demasculinization. Ultimately, these alterations could lead to a disappearance of the total contaminated fish population. Moreover, these toxic substances possess the capacity to mimic endogenous estrogens and to induce the abnormal production of vitellogenin (VTG) in male and immature fishes. The purpose of this research was to develop an easy, specific, cheap and fast method for diagnosing the contamination of male fishes by estrogen mimics, using VTG as biomarker. The selected method is based on a reverse latex agglutination test (rLAT), developed with monoclonal antibodies specific of this biomarker. The development of this VTG-rLAT has involved, firstly, the purification of carp VTG to produce monoclonal antibodies, specifics of this protein. One of these antibodies was selected to recover latex particles (diameter: 1 μm). Finally, the immunoreactivity of the VTG-rLAT was verified with different fish plasma samples from males treated with 17β-estradiol and non-treated males or females in vitellogenesis
Cadmium accumulation in zebrafish (Danio rerio) eggs is modulated by dissolved organic matter (DOM)
International Nuclear Information System (INIS)
Burnison, B. Kent; Meinelt, Thomas; Playle, Richard; Pietrock, Michael; Wienke, Andreas; Steinberg, Christian E.W.
2006-01-01
Experiments were conducted to investigate factors influencing the accumulation of cadmium (Cd 2+ ) into zebrafish (Danio rerio) eggs. The accumulation of 109 Cd was affected by: (1) concentration, (2) time, (3) presence of dissolved organic material (DOM), (4) different origin of DOM and (5) different parts of fish eggs. Over a 5-h exposure, zebrafish eggs showed a steady increase in Cd-accumulation. DOM-concentrations over 15 ppm carbon (C) decreased Cd-uptake significantly. Both samples of DOM, brown water marsh (LM) and a eutrophic pond (SP), at 16.9 ppm C, reduced the Cd-accumulation in the chorion, perivitelline liquid and the embryo. Cd was mainly accumulated in the egg's outer shell chorion (61%) and only small amounts passed through the chorion into the perivitelline liquid (38%) and embryo (1%). In the presence of LM-DOM, the accumulation of Cd into the egg components was decreased by 43% (chorion), 52% (perivitelline liquid) and 52% (embryo), respectively, compared with the control group. Similarly, the presence of SP-DOM reduced the Cd-accumulation by 29% (chorion), 61% (perivitelline liquid) and 60% (embryo), respectively, compared with the controls. DOM-concentration should be taken into consideration when determining ecotoxicological effects of Cd on fish populations
International Nuclear Information System (INIS)
Bucher, Guillaume
2013-01-01
The objective of this thesis is to study the cellular compartmentalization and the chelation of uranium (U) by cytosolic proteins of gill cells of the zebra fish (Danio rerio, model specie in aquatic toxicology) under different direct exposure conditions (chronic vs. acute, 20 and 250 μg.L -1 ). This study required the development of hyphenated techniques (SEC, IEF off-gel, RP-UHPLC for the separation, ICP-SFMS, ESI-FTMS/MS for the detection) with the main challenges of maintaining the non-covalent U-biomolecule interactions and enhancing sensitivity for the analysis of environmentally relevant samples. After extraction, 24% to 32% of the total U detected in the gills were present in the cytosolic fraction, in which the U distribution on the biomolecules (as a function of their MW and pI) varied depending on the exposure level. Finally, U target biomolecules mapping allowed us (i) to highlight a particular affinity of U for acidic and/or P-containing proteins and (ii) to identify 24 protein candidates for U binding. (author) [fr
Bello Marín, Carolina
2015-01-01
Esta tesis tiene como objetivo investigar los efectos del etanol y metales pesados (cadmio y mercurio) en los patrones diarios de dos especies acuáticas clave: pez cebra (Darío rerio) y anfípodo gammarus (G. aequicauda y G. chevreuxi). La investigación se realizó en dos niveles organizativos: comportamental y molecular. Con este fin, hemos establecido cuatro objetivos específicos: 1. Investigar los efectos al etanol en el pez cebra en función en su ritmo circadiano. 2. Determinar la exi...
Directory of Open Access Journals (Sweden)
Leonardo Vieira Wandelli
2015-10-01
Full Text Available O presente artigo procura traçar alguns elementos que pretendem articular como, a partir do discurso jurídico, podem ser significados os aportes sobre saúde e trabalho, especialmente aqueles trazidos pela abordagem da Psicodinâmica do Trabalho. Um caminho, assim, que vai dos estudos sobre sujeito, trabalho e saúde até o Direito Constitucional, que afirma como seu fundamento a dignidade humana, indissociável da centralidade antropológica do trabalho; um vínculo expressado pelo direito fundamental ao trabalho que, aqui, se propõe reconstruir a partir do desvelamento de um direito fundamental ao conteúdo do próprio trabalho, articulado ao conceito de meio ambiente organizacional do trabalho.
Energy Technology Data Exchange (ETDEWEB)
Zhuang, Shulin, E-mail: shulin@zju.edu.cn [Institute of Environmental Science, College of Environmental and Resource Sciences, Zhejiang University, Hangzhou 310058 (China); Zhejiang Provincial Key Laboratory of Organic Pollution Process and Control, Hangzhou 310058 (China); Zhang, Zhisheng [Institute of Environmental Science, College of Environmental and Resource Sciences, Zhejiang University, Hangzhou 310058 (China); Zhang, Wenjing; Bao, Lingling [Institute of Environmental Science, College of Environmental and Resource Sciences, Zhejiang University, Hangzhou 310058 (China); Zhejiang Provincial Key Laboratory of Organic Pollution Process and Control, Hangzhou 310058 (China); Xu, Chao, E-mail: chaoxu@zjut.edu.cn [Research Center of Environmental Science, College of Biological and Environmental Engineering, Zhejiang University of Technology, Hangzhou 310032 (China); Zhang, Hu [Institute of Quality and Standard for Agro-products, Zhejiang Academy of Agricultural Sciences, Hangzhou 210021 (China)
2015-02-15
Highlights: • Pyraclofos has significant enantioselective aquatic toxicities to zebrafish. • Pyraclofos induces time- and concentration-dependent developmental toxicity and immunotoxicity. • The mRNA level of IL-1β gene was significantly up-regulated by pyraclofos. • Pyraclofos binds potently to IL-1β, potentially affecting IL-1β-dependent proinflammatory signal transduction. • Our in vitro and in silico studies help to understand the molecular basis for aquatic toxicity of pyraclofos. - Abstract: Pyraclofos, a relatively new organophosphorus pesticide, has shown potential ecotoxicities, however, its aquatic toxicity, especially enantioselective aquatic toxicity, remains largely unknown. Using zebrafish (Danio rerio) as a preeminent vertebrate aquatic model, the enantioselective differences in the developmental toxicity and immunotoxicity of pyraclofos were evaluated. Following 96-h exposure, pyraclofos enantiomers exhibited acute toxicity and showed lethal concentration 50 of 2.23 and 3.99 mg/L for (R)-Pyraclofos and (S)-Pyraclofos, respectively. Exposure to pyraclofos caused time- and concentration-dependent malformations such as pericardial edema, yolk sac edema, crooked bodies and hatching during the embryonic development, with markedly higher percentages of malformation at higher concentrations. The concentration-dependent immunotoxicity to zebrafish embryo exposed to low level pyraclofos was induced with significant up-regulation of mRNA levels of immune-related interleukin-1β (IL-1β) gene. (R)-Pyraclofos was consistently more toxic than (S)-Pyraclofos for the acute toxicity, developmental toxicity and immunotoxicity to zebrafish. Molecular dynamics simulations revealed that at the atomic level, (R)-Pyraclofos binds more potently to IL-1β protein than (S)-Pyraclofos. This enantioselective binding is mainly contributed by the distinct binding mode of pyraclofos enantiomers and their electrostatic interactions with IL-1β, which potentially
International Nuclear Information System (INIS)
Zhuang, Shulin; Zhang, Zhisheng; Zhang, Wenjing; Bao, Lingling; Xu, Chao; Zhang, Hu
2015-01-01
Highlights: • Pyraclofos has significant enantioselective aquatic toxicities to zebrafish. • Pyraclofos induces time- and concentration-dependent developmental toxicity and immunotoxicity. • The mRNA level of IL-1β gene was significantly up-regulated by pyraclofos. • Pyraclofos binds potently to IL-1β, potentially affecting IL-1β-dependent proinflammatory signal transduction. • Our in vitro and in silico studies help to understand the molecular basis for aquatic toxicity of pyraclofos. - Abstract: Pyraclofos, a relatively new organophosphorus pesticide, has shown potential ecotoxicities, however, its aquatic toxicity, especially enantioselective aquatic toxicity, remains largely unknown. Using zebrafish (Danio rerio) as a preeminent vertebrate aquatic model, the enantioselective differences in the developmental toxicity and immunotoxicity of pyraclofos were evaluated. Following 96-h exposure, pyraclofos enantiomers exhibited acute toxicity and showed lethal concentration 50 of 2.23 and 3.99 mg/L for (R)-Pyraclofos and (S)-Pyraclofos, respectively. Exposure to pyraclofos caused time- and concentration-dependent malformations such as pericardial edema, yolk sac edema, crooked bodies and hatching during the embryonic development, with markedly higher percentages of malformation at higher concentrations. The concentration-dependent immunotoxicity to zebrafish embryo exposed to low level pyraclofos was induced with significant up-regulation of mRNA levels of immune-related interleukin-1β (IL-1β) gene. (R)-Pyraclofos was consistently more toxic than (S)-Pyraclofos for the acute toxicity, developmental toxicity and immunotoxicity to zebrafish. Molecular dynamics simulations revealed that at the atomic level, (R)-Pyraclofos binds more potently to IL-1β protein than (S)-Pyraclofos. This enantioselective binding is mainly contributed by the distinct binding mode of pyraclofos enantiomers and their electrostatic interactions with IL-1β, which potentially
Brain Transcriptomic Response to Social Eavesdropping in Zebrafish (Danio rerio.
Directory of Open Access Journals (Sweden)
João Sollari Lopes
Full Text Available Public information is widely available at low cost to animals living in social groups. For instance, bystanders may eavesdrop on signaling interactions between conspecifics and use it to adapt their subsequent behavior towards the observed individuals. This social eavesdropping ability is expected to require specialized mechanisms such as social attention, which selects social information available for learning. To begin exploring the genetic basis of social eavesdropping, we used a previously established attention paradigm in the lab to study the brain gene expression profile of male zebrafish (Danio rerio in relation to the attention they paid towards conspecifics involved or not involved in agonistic interactions. Microarray gene chips were used to characterize their brain transcriptomes based on differential expression of single genes and gene sets. These analyses were complemented by promoter region-based techniques. Using data from both approaches, we further drafted protein interaction networks. Our results suggest that attentiveness towards conspecifics, whether interacting or not, activates pathways linked to neuronal plasticity and memory formation. The network analyses suggested that fos and jun are key players on this response, and that npas4a, nr4a1 and egr4 may also play an important role. Furthermore, specifically observing fighting interactions further triggered pathways associated to a change in the alertness status (dnajb5 and to other genes related to memory formation (btg2, npas4b, which suggests that the acquisition of eavesdropped information about social relationships activates specific processes on top of those already activated just by observing conspecifics.
NCBI nr-aa BLAST: CBRC-XTRO-01-0200 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0200 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-123 72% ...
NCBI nr-aa BLAST: CBRC-TNIG-07-0005 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-07-0005 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-163 80% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-2338 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2338 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-123 64% ...
NCBI nr-aa BLAST: CBRC-OLAT-14-0010 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-14-0010 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-140 81% ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0468 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0468 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-162 80% ...
NCBI nr-aa BLAST: CBRC-GACU-07-0059 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-07-0059 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-161 80% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1115 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1115 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-144 72% ...
NCBI nr-aa BLAST: CBRC-TGUT-01-0030 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-01-0030 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-137 74% ...
NCBI nr-aa BLAST: CBRC-DRER-15-0167 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-15-0167 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-109 65% ...
agradecimento aos consultores ad hoc
Directory of Open Access Journals (Sweden)
REA Editor
2012-02-01
Full Text Available Agradecemos aos professores Nildo Viana (UFG e Flavio Sofiati (UFG, organizadores do DOSSIÊ JUVENTUDE & SOCIEDADE, e aos Consultores Ad hoc pela leitura e apreciação crítica dos artigos submetidos e publicados nesta edição.
NCBI nr-aa BLAST: CBRC-OANA-01-2123 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OANA-01-2123 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 3e-81 47% ...
NCBI nr-aa BLAST: CBRC-DRER-04-0033 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-04-0033 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 0.0 100% ...
NCBI nr-aa BLAST: CBRC-DRER-04-0031 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-04-0031 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 0.0 100% ...
Environmental estrogen(s) induced swimming behavioural alterations in adult zebrafish (Danio rerio).
Goundadkar, Basavaraj B; Katti, Pancharatna
2017-09-01
The present study is an attempt to investigate the effects of long-term (75days) exposure to environmental estrogens (EE) on the swimming behaviour of zebrafish (Danio rerio). Adult zebrafish were exposed semi-statically to media containing commonly detected estrogenic water contaminants (EE2, DES and BPA) at a concentration (5ng/L) much lower than environmentally recorded levels. Time spent in swimming, surface preference, patterns and path of swimming were recorded (6mins) for each fish using two video cameras on day 15, 30 60 and 75. Video clips were analysed using a software program. Results indicate that chronic exposure to EE leads to increased body weight and size of females, reduced (Pswimming time, delay in latency, increased (P<0.05) immobility, erratic movements and freezing episodes. We conclude that estrogenic contamination of natural aquatic systems induces alterations in locomotor behaviour and associated physiological disturbances in inhabitant fish fauna. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Martinovic-Weigelt, Dalma; Wang Ronglin; Villeneuve, Daniel L.; Bencic, David C.; Lazorchak, Jim; Ankley, Gerald T.
2011-01-01
The studies presented in this manuscript focus on characterization of transcriptomic responses to anti-androgens in zebrafish (Danio rerio). Research on the effects of anti-androgens in fish has been characterized by a heavy reliance on apical endpoints, and molecular mechanisms of action (MOA) of anti-androgens remain poorly elucidated. In the present study, we examined effects of a short term exposure (24-96 h) to the androgen receptor antagonists flutamide (FLU) and vinclozolin (VZ) on gene expression in gonads of sexually mature zebrafish, using commercially available zebrafish oligonucleotide microarrays (4 x 44 K platform). We found that VZ and FLU potentially impact reproductive processes via multiple pathways related to steroidogenesis, spermatogenesis, and fertilization. Observed changes in gene expression often were shared by VZ and FLU, as demonstrated by overlap in differentially-expressed genes and enrichment of several common key pathways including: (1) integrin and actin signaling, (2) nuclear receptor 5A1 signaling, (3) fibroblast growth factor receptor signaling, (4) polyamine synthesis, and (5) androgen synthesis. This information should prove useful to elucidating specific mechanisms of reproductive effects of anti-androgens in fish, as well as developing biomarkers for this important class of endocrine-active chemicals.
Energy Technology Data Exchange (ETDEWEB)
Martinovic-Weigelt, Dalma, E-mail: dalma@stthomas.edu [US Environmental Protection Agency, Office of Research and Development, National Health and Environmental Effects Research Laboratory, Mid-Continent Ecology Division, 6201 Congdon Blvd., Duluth, MN 55804 (United States); University of St. Thomas, 2115 Summit Ave, Saint Paul, MN 55105 (United States); Wang Ronglin [US Environmental Protection Agency, Office of Research and Development, National Exposure Research Laboratory, Ecological Exposure Research Division, 26W. Martin Luther King Dr., Cincinnati, OH 45268 (United States); Villeneuve, Daniel L. [US Environmental Protection Agency, Office of Research and Development, National Health and Environmental Effects Research Laboratory, Mid-Continent Ecology Division, 6201 Congdon Blvd., Duluth, MN 55804 (United States); Bencic, David C.; Lazorchak, Jim [US Environmental Protection Agency, Office of Research and Development, National Exposure Research Laboratory, Ecological Exposure Research Division, 26W. Martin Luther King Dr., Cincinnati, OH 45268 (United States); Ankley, Gerald T. [US Environmental Protection Agency, Office of Research and Development, National Health and Environmental Effects Research Laboratory, Mid-Continent Ecology Division, 6201 Congdon Blvd., Duluth, MN 55804 (United States)
2011-01-25
The studies presented in this manuscript focus on characterization of transcriptomic responses to anti-androgens in zebrafish (Danio rerio). Research on the effects of anti-androgens in fish has been characterized by a heavy reliance on apical endpoints, and molecular mechanisms of action (MOA) of anti-androgens remain poorly elucidated. In the present study, we examined effects of a short term exposure (24-96 h) to the androgen receptor antagonists flutamide (FLU) and vinclozolin (VZ) on gene expression in gonads of sexually mature zebrafish, using commercially available zebrafish oligonucleotide microarrays (4 x 44 K platform). We found that VZ and FLU potentially impact reproductive processes via multiple pathways related to steroidogenesis, spermatogenesis, and fertilization. Observed changes in gene expression often were shared by VZ and FLU, as demonstrated by overlap in differentially-expressed genes and enrichment of several common key pathways including: (1) integrin and actin signaling, (2) nuclear receptor 5A1 signaling, (3) fibroblast growth factor receptor signaling, (4) polyamine synthesis, and (5) androgen synthesis. This information should prove useful to elucidating specific mechanisms of reproductive effects of anti-androgens in fish, as well as developing biomarkers for this important class of endocrine-active chemicals.
Chronic bisphenol A exposure alters behaviors of zebrafish (Danio rerio)
International Nuclear Information System (INIS)
Wang, Ju; Wang, Xia; Xiong, Can; Liu, Jian; Hu, Bing; Zheng, Lei
2015-01-01
The adult zebrafish (Danio rerio) were exposed to treated-effluent concentration of bisphenol A (BPA) or 17β-estradiol (E2) for 6 months to evaluate their effects on behavioral characteristics: motor behavior, aggression, group preference, novel tank test and light/dark preference. E2 exposure evidently dampened fish locomotor activity, while BPA exposure had no marked effect. Interestingly, BPA-exposed fish reduced their aggressive behavior compared with control or E2. Both BPA and E2 exposure induced a significant decrease in group preference, as well as a weaker adaptability to new environment, exhibiting lower latency to reach the top, more entries to the top, longer time spent in the top, fewer frequent freezing, and fewer erratic movements. Furthermore, the circadian rhythmicity of light/dark preference was altered by either BPA or E2 exposure. Our results suggest that chronic exposure of treated-effluent concentration BPA or E2 induced various behavioral anomalies in adult fish and enhanced ecological risk to wildlife. - Highlights: • BPA exposure induces various adult behavioral anomalies. • BPA exposure decreases social interaction and environmental adaptation of zebrafish. • BPA exposure increases ecological risk to wildlife. - Chronic bisphenol A exposure alters zebrafish behaviors.
Combate ao niilismo e ao totalitarismo em Camus
Directory of Open Access Journals (Sweden)
Emanuel Ricardo Germano
2013-05-01
Full Text Available A partir de uma leitura da peça Calígula, elaborada entre 1941 e 1943, procurar-se-á contribuir na restituição das preocupações éticas, políticas e filosóficas em cena no teatro de Albert Camus, analisando o sentido de sua expressão teatral no contexto de dois combates,ao niilismo filosófico e ao totalitarismo político de seu tempo. Observaremos em Calígula um importante registro do amadurecimento das leituras de duas heranças filosóficas relevantes na formação intelectual de Camus, Nietzsche e Heráclito, à luz da experiência do totalitarismo, observando e ressaltando com isso a amplitude de seu intertexto filosófico e a importância do aporte ético e político de Camus como pensador multifacetado, engajado nos enfrentamentos históricos e solicitações críticas de seu tempo.
Yang, Da-Wei; Zhao, Xiu-Ying; Zhang, Geng; Li, Qiang-Guo; Wu, Si-Zhu
2016-05-01
Molecule dynamics (MD) simulation, a molecular-level method, was applied to predict the damping properties of AO-60/polyacrylate rubber (AO-60/ACM) composites before experimental measures were performed. MD simulation results revealed that two types of hydrogen bond, namely, type A (AO-60) -OH•••O=C- (ACM), type B (AO-60) - OH•••O=C- (AO-60) were formed. Then, the AO-60/ACM composites were fabricated and tested to verify the accuracy of the MD simulation through dynamic mechanical thermal analysis (DMTA). DMTA results showed that the introduction of AO-60 could remarkably improve the damping properties of the composites, including the increase of glass transition temperature (Tg) alongside with the loss factor (tan δ), also indicating the AO-60/ACM(98/100) had the best damping performance amongst the composites which verified by the experimental.
Directory of Open Access Journals (Sweden)
Ishikawa Mitsuru
2011-10-01
Full Text Available Abstract Background Eukaryotic DNA polymerase β (pol β, the polymerase thought to be responsible for DNA repair synthesis, has been extensively characterized in rats and humans. However, pol β has not been purified or enzymatically characterized from the model fish species Danio rerio (zebrafish. We used the in vitro/in vivo dual expression system plasmid, pIVEX, to express Danio rerio pol β (Danio pol β for biochemical characterization. Results Danio pol β encoded by the in vitro/in vivo-compatible pIVEX plasmid was expressed in E. coli BL21(DE3, BL21(DE3pLysS, and KRX, and in vitro as a C-terminal His-tagged protein. Danio pol β expressed in vitro was subject to proteolysis; therefore, bacterial overexpression was used to produce the protein for kinetic analyses. KRX cells were preferred because of their reduced propensity for leaky expression of pol β. The cDNA of Danio rerio pol β encodes a protein of 337 amino acids, which is 2-3 amino acids longer than other pol β proteins, and contains a P63D amino acid substitution, unlike mammalian pol βs. This substitution lies in a hairpin sequence within an 8-kDa domain, likely to be important in DNA binding. We performed extensive biochemical characterization of Danio pol β in comparison with rat pol β, which revealed its sensitivity to metal ion activators (Mn2+ and Mg2+, its optimum salt concentration (10 mM KCl and 50 mM NaCl, alkaline pH optimum (pH 9.0, and low temperature optimum (30°C. Substituting Mn2+ for Mg2+ resulted in 8.6-fold higher catalytic efficiency (kcat/Km. Conclusions Our characterization of pol β from a model fish organism contributes to the study of the function and evolution of DNA polymerases, which are emerging as important cellular targets for chemical intervention in the development of anticancer agents.
Functional behavior and reproduction in androgenic sex reversed zebrafish (Danio rerio).
Larsen, Mia G; Baatrup, Erik
2010-08-01
Endocrine-disrupting chemicals released into natural watercourses may cause biased sex ratios by sex reversal in fish populations. The present study investigated the androgenic sex reversal of zebrafish (Danio rerio) exposed to the androgenic compound 17beta-trenbolone (TB) and whether sex-changed females would revert to the female phenotype after cessation of TB exposure. 17beta-Trenbolone is a metabolite of trenbolone acetate, an anabolic steroid used as a growth promoter in beef cattle. 17beta-Trenbolone in runoff from cattle feedlots may reach concentrations that affect fish sexual development. Zebrafish were exposed to a concentration of 20 ng/L TB in a flow-through system for five months from egg until sexual maturity. This resulted in an all-male population. It was further found that all these phenotypic males displayed normal male courtship behavior and were able to reproduce successfully, implying that the sex reversal was complete and functional. None of the phenotypic males developed into females after six months in clean water, demonstrating that androgenic sex reversal of zebrafish is irreversible. Copyright 2010 SETAC
Husbandry stress exacerbates mycobacterial infections in adult zebrafish, Danio rerio (Hamilton)
Ramsay, J.M.; Watral, Virginia G.; Schreck, C.B.; Kent, M.L.
2009-01-01
Mycobacteria are significant pathogens of laboratory zebrafish, Danio rerio (Hamilton). Stress is often implicated in clinical disease and morbidity associated with mycobacterial infections but has yet to be examined with zebrafish. The aim of this study was to examine the effects of husbandry stressors on zebrafish infected with mycobacteria. Adult zebrafish were exposed to Mycobacterium marinum or Mycobacterium chelonae, two species that have been associated with disease in zebrafish. Infected fish and controls were then subjected to chronic crowding and handling stressors and examined over an 8-week period. Whole-body cortisol was significantly elevated in stressed fish compared to non-stressed fish. Fish infected with M. marinum ATCC 927 and subjected to husbandry stressors had 14% cumulative mortality while no mortality occurred among infected fish not subjected to husbandry stressors. Stressed fish, infected with M. chelonae H1E2 from zebrafish, were 15-fold more likely to be infected than non-stressed fish at week 8 post-injection. Sub-acute, diffuse infections were more common among stressed fish infected with M. marinum or M. chelonae than non-stressed fish. This is the first study to demonstrate an effect of stress and elevated cortisol on the morbidity, prevalence, clinical disease and histological presentation associated with mycobacterial infections in zebrafish. Minimizing husbandry stress may be effective at reducing the severity of outbreaks of clinical mycobacteriosis in zebrafish facilities. ?? 2009 Blackwell Publishing Ltd.
Rey, Florencia; Ramos, Jorge G; Stoker, Cora; Bussmann, Leonardo E; Luque, Enrique H; Muñoz-de-Toro, Mónica
2006-03-01
Environmental pollution with endocrine disrupting compounds (EDCs) has adverse effects on the ecosystem's health. Caiman latirostris are widely distributed in South American aquatic ecosystems. Caimans have physiological and ecological characteristics that make them particularly vulnerable to EDCs exposure and suitable candidate as a sentinel species. Vitellogenin (Vtg) is a yolk pre-cursor protein synthesized by the liver of non-mammalian vertebrates and induced in response to estrogen. Purified plasma Vtg from caimans injected with estradiol-17beta (E2) was used to generate a polyclonal anti-body. Anti-body specificity was assessed using Western blot. The antiserum was also effective in detecting turtle Vtg, exhibiting high cross-reactivity with Vtg from Phrynops hilarii and Trachemys scripta dorbigni. We developed a specific and highly sensitive ELISA for caiman Vtg. This method has a detection limit of 0.1 ng/ml of plasma. The ELISA did not detect Vtg in plasma of non-induced male caimans. Induction of Vtg in male caimans was evaluated in response to one or two (7 days apart) doses of E2. Due to its high sensitivity, ELISA allows to measure the small increases in plasma Vtg after exposure to exogenous estrogen. A priming effect was observed following the second E2 dose, with a tenfold increase in circulating Vtg. Hepatic synthesis was confirmed by immunohistochemistry. The results presented herein suggest that detection of plasma Vtg in male caimans might become a valuable tool in biomonitoring xenoestrogen exposure in a polluted environment.
Efficacy of cleaning and disinfection procedures in a zebrafish (Danio rerio) facility.
Garcia, Rachel L; Sanders, George E
2011-11-01
Appropriate cleaning and disinfection procedures in zebrafish (Danio rerio) laboratories are crucial in preventing the spread of aquatic animal pathogens and minimizing the build-up of waste products and biologic matter. The procedures selected should accomplish these goals and incorporate the individual needs of various laboratories. In this study of a single zebrafish facility, we assessed the efficacy of 2 different cleaning and disinfection procedures for nets, tanks, and lids. ATP levels were used as a surrogate biomarker for microbial burden. We measured the number of relative light units (RLU), as an expression of the amount of ATP present, on items before and after disinfection and calculated the percentage reduction. We compared daily replacement of a commercial net disinfection product in J lab with weekly replacement in H lab and found a 96.6% reduction in RLU in H lab and a 91.2% reduction in J lab. These results indicate that either replacement schedule is effective. Evaluation of tanks and lids soaked in a bleach disinfection bath for 30 or 60 min revealed a 99.7% reduction in RLU at 30 min compared with 97.1% at 60 min. Therefore a 30-min soak in a bleach bath achieved a similar level of disinfection as did a 60-min soak. The current results demonstrate that these cleaning and disinfection methods are efficacious.
Song, Jing; Nagae, Masaki; Soyano, Kiyoshi
2018-07-01
Field surveys of the impact of environmental estrogen (EE) pollution in aquatic wildlife have been conducted using vitellogenin (VTG) as a biomarker to evaluate the influence of EE. However, a standard baseline of VTG level that can be used to evaluate EE pollution has not been fully determined. To the best of our knowledge, the present study is the first to determine the standard baseline VTG level for evaluating the biological effects of EE pollution using the Japanese common goby (Acanthogobius flavimanus) as the target model fish. Plasma VTG and estradiol-17β (E 2 ) levels associated with the reproductive cycle of wild goby inhabiting an unpolluted environment were measured. Mean plasma VTG and E 2 levels exhibited similar changes, increasing in the yolk vesicle stage and peaking in the tertiary yolk stage in females. However, plasma VTG and E 2 levels showed no significant changes in males, remaining at low levels throughout the reproductive cycle. The highest VTG levels in females and males were 1.6 mg ml -1 and 124.87 ng ml -1 , respectively. These results indicate that the baseline level (normal level) in males was approximately 130 ng ml -1 at most. We concluded that the threshold between normal and abnormal levels with a 10% risk rate was 150 ng ml -1 in the wild male goby. Plasma VTG levels in males captured from Nagasaki Harbor were higher than the threshold in each reproductive developmental stage, indicating the possibility of EE pollution at this site. The biological standard baseline for VTG established in this study is useful for assessing EE pollution in natural waters. Copyright © 2018 John Wiley & Sons, Ltd.
Uranium-induced sensory alterations in the zebrafish Danio rerio
Energy Technology Data Exchange (ETDEWEB)
Faucher, K., E-mail: kfaucher@hotmail.fr [Laboratoire d' ecotoxicologie des radionucleides (LECO), Institut de Radioprotection et Surete Nucleaire, Centre de Cadarache, Batiment 186, BP3, 13115 Saint Paul lez Durance (France); Floriani, M.; Gilbin, R.; Adam-Guillermin, C. [Laboratoire d' ecotoxicologie des radionucleides (LECO), Institut de Radioprotection et Surete Nucleaire, Centre de Cadarache, Batiment 186, BP3, 13115 Saint Paul lez Durance (France)
2012-11-15
The effect of chronic exposure to uranium ions (UO{sub 2}{sup 2+}) on sensory tissues including the olfactory and lateral line systems was investigated in zebrafish (Danio rerio) using scanning electron microscopy. The aim of this study was to determine whether exposure to uranium damaged sensory tissues in fish. The fish were exposed to uranium at the concentration of 250 {mu}g l{sup -1} for 10 days followed by a depuration period of 23 days. Measurements of uranium uptake in different fish organs: olfactory rosettes and bulbs, brain, skin, and muscles, were also determined by ICP-AES and ICP-MS during the entire experimental period. The results showed that uranium displayed a strong affinity for sensory structures in direct contact with the surrounding medium, such as the olfactory and lateral line systems distributed on the skin. A decreasing gradient of uranium concentration was found: olfactory rosettes > olfactory bulbs > skin > muscles > brain. At the end of the experiment, uranium was present in non-negligible quantities in sensory tissues. In parallel, fish exposed to uranium showed severe sensory tissue alterations at the level of the olfactory and lateral line systems. In both sensory systems, the gross morphology was altered and the sensory hair cells were significantly damaged very early after the initiation of exposure (from the 3rd day). At the end of the experiment, after 23 days of depuration, the lateral line system still displayed slight tissue alterations, but approximately 80% of the neuromasts in this system had regenerated. In contrast, the olfactory system took more time to recover, as more than half of the olfactory rosettes observed remained destroyed at the end of the experiment. This study showed, for the first time, that uranium is able to damage fish sensory tissues to such an extent that tissue regeneration is delayed.
Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean
Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.
2009-01-01
We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of
Proteolytic processing of the vitellogenin precursor in the boll weevil, Anthonomus grandis.
Heilmann, L J; Trewitt, P M; Kumaran, A K
1993-01-01
The soluble proteins of the eggs of the coleopteran insect Anthonomus grandis Boheman, the cotton boll weevil, consist almost entirely of two vitellin types with M(r)s of 160,000 and 47,000. We sequenced their N-terminal ends and one internal cyanogen bromide fragment of the large vitellin and compared these sequences with the deduced amino acid sequence from the vitellogenin gene. The results suggest that both the boll weevil vitellin proteins are products of the proteolytic cleavage of a single precursor protein. The smaller 47,000 M(r) vitellin protein is derived from the N-terminal portion of the precursor adjacent to an 18 amino acid signal peptide. The cleavage site between the large and small vitellins at amino acid 362 is adjacent to a pentapeptide sequence containing two pairs of arginine residues. Comparison of the boll weevil sequences with limited known sequences from the single 180,000 M(r) honey bee protein show that the honey bee vitellin N-terminal exhibits sequence homology to the N-terminal of the 47,000 M(r) boll weevil vitellin. Treatment of the vitellins with an N-glycosidase results in a decrease in molecular weight of both proteins, from 47,000 to 39,000 and from 160,000 to 145,000, indicating that about 10-15% of the molecular weight of each vitellin consists of N-linked carbohydrate. The molecular weight of the deglycosylated large vitellin is smaller than that predicted from the gene sequence, indicating possible further proteolytic processing at the C-terminal of that protein.
Toxicological effects of graphene oxide on adult zebrafish (Danio rerio)
Energy Technology Data Exchange (ETDEWEB)
Souza, Jaqueline P., E-mail: souza.jaqueline@gmail.com; Baretta, Jéssica F.; Santos, Fabrício; Paino, Ieda M.M.; Zucolotto, Valtencir
2017-05-15
Highlights: • Graphene oxide exposure caused apoptotic and necrotic stages in zebrafish gill cells. • Graphene oxide induced reactive oxygen generation in zebrafish gill cells. • Gill and liver tissues suffered injuries after graphene oxide chronic exposure. • Zebrafish blood cells did not present DNA damages after graphene oxide exposure. - Abstract: Graphene exhibits unique physical and chemical properties that facilitate its application in many fields, including electronics and biomedical areas. However, the use of graphene and its derivatives could result in accumulation in aquatic environments, and the risks posed by these compounds for organisms are not completely understood. In this study, we investigated the effects of graphene oxide (GO) on adult zebrafish (Danio rerio). Experimental fish were exposed to 2, 10 or 20 mg L{sup −1} GO, and the cytotoxicity, genotoxicity and oxidative stress were assessed. The morphology of the gills and liver tissues was also analyzed. Graphene oxide exposure led to an increase in the number of gill cells that were in early apoptotic and necrotic stages, but genotoxicity was not observed in blood cells. We also observed the generation of Reactive Oxygen Species (ROS) in gill cells. Structural analysis revealed injuries to gill tissues, including a dilated marginal channel, lamellar fusion, clubbed tips, swollen mucocytes, epithelial lifting, aneurysms, and necrosis. Liver tissues also presented lesions such as peripherally located nuclei. Furthermore, hepatocytes exhibited a non-uniform shape, picnotic nuclei, vacuole formation, cell rupture, and necrosis. Our results showed that sub-lethal doses of graphene oxide could be harmful to fish species and thus represent risks for the aquatic food chain.
Directory of Open Access Journals (Sweden)
José Evando Aguiar Beserra Júnior
2007-10-01
Full Text Available Foram avaliadas 20 linhagens de melancia, provenientes do cruzamento da cultivar comercial suscetível Crimson Sweet e da introdução PI 595201 resistente ao Watermelon mosaic virus (WMV e Papaya ringspot virus (PRSV-W. As linhagens, e os parentais foram inoculados com o WMV ou com o PRSV-W em casa-de-vegetação distintas. Aos 35 e 49 dias após a primeira inoculação (DAI, as plantas foram avaliadas por meio de uma escala de notas, em que 1 (ausência de sintomas a 5 (intenso mosaico e deformações foliares. Pelos resultados infere-se que, aos 35 DAI, as linhagens 1, 2 e 20 apresentaram resistência tanto para o WMV como para o PRSV-W, com médias de 1,95, 1,80 e 2,25 para o WMV, e de 2,50, 2,30 e 2,50 para o PRSV-W, respectivamente. As linhagens 5, 7 e 13 foram resistentes somente ao WMV e as plantas das linhagens 3, 10 e 18 para o PRSV-W. A reação das linhagens permaneceu em geral pouco alterada aos 49 DAI. A existência de linhagens resistentes somente ao WMV e somente ao PRSV-W, ao lado de linhagens resistentes a ambos os vírus, é indicativo de que as resistências ao WMV e ao PRSV-W não são controladas pelos mesmos genes.Twenty advanced watermelon breeding lines, derived from the cross between cv. Crimson Sweet (susceptible and PI 595201 (resistant to WMV and PRSV-W, were screened for resistance to both potyviruses. The twenty lines, among with Crimson Sweet and PI 595201, were inoculated with either WMV or PRSV-W, in two different greenhouse trials. Plants were evaluated for symptoms 35 and 49 days after the first inoculation (DAI, using a scale from 1 (no symptoms to 5 (severe mosaic and foliar distortion. Evaluations at 35 DAI indicated that lines 1, 2 and 20 had good levels of resistance to both WMV and PRSV-W, with ratings of 1,95, 1,80 and 2,25 for WMV, and of 2,50, 2,30 and 2,50 for PRSV-W, respectively. Lines 5, 7 and 13 were resistant to WMV only, whereas lines 3, 10 and 18 were resistant to PRSV-W only. The reaction of
Genetic analysis of male reproductive success in relation to density in the zebrafish, Danio rerio
Directory of Open Access Journals (Sweden)
Jordan William C
2006-04-01
Full Text Available Abstract Background We used behavioural and genetic data to investigate the effects of density on male reproductive success in the zebrafish, Danio rerio. Based on previous measurements of aggression and courtship behaviour by territorial males, we predicted that they would sire more offspring than non-territorial males. Results Microsatellite analysis of paternity showed that at low densities territorial males had higher reproductive success than non-territorial males. However, at high density territorial males were no more successful than non-territorials and the sex difference in the opportunity for sexual selection, based on the parameter Imates, was low. Conclusion Male zebrafish exhibit two distinct mating tactics; territoriality and active pursuit of females. Male reproductive success is density dependent and the opportunity for sexual selection appears to be weak in this species.
Resistência de genótipos de caupi ao caruncho
Directory of Open Access Journals (Sweden)
BARRETO PAULO DIÓGENES
2000-01-01
Full Text Available A utilização de resistência genética ao ataque de Callosobruchus maculatus (Fabr. tem sido alvo de investigação científica, especialmente no que diz respeito à identificação de fontes de resistência. O presente trabalho objetivou incorporar, ao grupo de caracteres desejáveis para o cultivo de caupi (Vigna unguiculata (L. Walp., resistência genética ao caruncho (C. maculatus. Foram realizadas hibridações dos genótipos IT81D-1045 e IT81D-1064 (portadores de resistência ao inseto com CNCx 252-1E/FB, CNCx 187-22D-1 e BR 1-Poty (capazes de transferir resistência a viroses, tolerância à seca, formação de grãos com padrão comercial, elevado potencial de produção e adaptabilidade a diferentes condições ambientais. Populações segregantes obtidas destes cruzamentos foram conduzidas pelo método SPD (descendência de uma única vagem, e na geração F5 foram realizadas seleções individuais. As linhagens obtidas foram avaliadas em conjunto com materiais de origens diferentes, utilizando-se parâmetros associados à infestação da praga. Foi constatado que os genótipos avaliados apresentaram variabilidade quanto à preferência à postura, número de insetos emergidos e número de sementes danificadas; as linhas EVx 37-15E e EVx 37-2E foram as que sofreram menor dano causado pelo caruncho; as variáveis número de ovos, número de insetos emergidos e número de sementes danificadas mostraram-se positiva e significativamente correlacionadas entre si; o grupo das linhagens que descendem de genitores resistentes apresenta valores significativamente inferiores aos obtidos pelas demais, o que indica que a resistência ao inseto se transmite geneticamente.
Directory of Open Access Journals (Sweden)
Gislanne Brito Barros
2013-06-01
Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.
A importância do conhecimento quanto ao vírus da influenza A (H1N1: relato de experiência
Directory of Open Access Journals (Sweden)
Jaine Kareny da Silva
2015-10-01
Full Text Available Justificativa e Objetivos: Embora as taxas de contaminação pelo vírus influenza A H1N1, apresentem redução desde 2010 por meio da imunização, ainda é notório alguns casos e surtos da doença em território nacional. Para minimizar tais casos é importante, dentre outras medidas, a qualificação do trabalhador de saúde. Nesse sentido, o objetivo foi descrever o nível de informação dos profissionais de Enfermagem, de um hospital do interior baiano, sobre a transmissão do vírus da H1N1, sintomatologia e quais os EPIs são necessários na assistência aos pacientes com suspeita ou confirmação diagnóstica. Métodos: Trata-se de um relato de experiência vivenciado por acadêmicos de Enfermagem da Universidade do Estado da Bahia, que desenvolveram atividades do componente curricular Processo do Cuidar: Fundamentação e Prática em um hospital público na Bahia. Os dados do relato são provenientes de coleta realizada junto aos enfermeiros, abordando aspectos da sintomatologia, transmissão e equipamentos de proteção individual. Cada profissional de Enfermagem respondeu espontaneamente as perguntas e ao final foi discutido cada item visando sanar dúvidas, promovendo, desse modo, uma atividade educativa baseada nos conhecimentos dos profissionais. Resultados: Embora a maioria dos participantes reconhecesse os equipamentos de proteção individual e a sintomatologia da doença viral, alguns ainda desconhecem as vias de transmissão. A maioria não recebeu nenhuma capacitação sobre a temática. Conclusão: É necessário implantar um Núcleo de Educação Permanente para sanar dúvidas sobre esta e outras temáticas, mas que não se limitem a ações pontuais e que busquem parcerias com as instituições de ensino superior. DESCRITORES: Educação continuada. Educação em Enfermagem. Transmissão de doença infecciosa. Controle de doenças transmissíveis.
Bowley, Lucas A; Alam, Farhana; Marentette, Julie R; Balshine, Sigal; Wilson, Joanna Y
2010-12-01
A growing concern over endocrine disruption in aquatic species has prompted the development of molecular assays to monitor environmental impacts. This study describes the development of quantitative polymerase chain reaction (qPCR) assays to characterize the expression of two vitellogenin (Vtg) genes in the invasive round goby (Neogobius melanostomus). Fragments from the 18SrRNA (housekeeping gene), Vtg II, and Vtg III genes were cloned and sequenced. The qPCR assays were developed to detect hepatic Vtg expression in goby. The assays detected induction of both Vtg genes in nonreproductive males following a two-week laboratory exposure to 17β-estradiol (≥1 mg/kg i.p. injection). The assays were applied to goby from Hamilton Harbour, Lake Ontario (Canada), including those from sites where feminization and intersex of goby has been documented. Both Vtg genes had significantly higher expression in females compared to males. Male reproductive goby adopt either parental or sneaker tactics; Vtg II expression was higher in sneaker than in parental males but parental and nonreproductive males did not differ from each other. The Vtg III expression was significantly higher in sneaker males followed by parental males and nonreproductive males, respectively. The Vtg II and III expression in nonreproductive males was elevated in the contaminated site with documented intersex. This assay provides an important tool for the use of an invasive species in monitoring endocrine disruption in the Great Lakes region. Copyright © 2010 SETAC.
Gätschenberger, Heike; Gimple, Olaf; Tautz, Jürgen; Beier, Hildburg
2012-04-15
Drones are haploid male individuals whose major social function in honey bee colonies is to produce sperm and mate with a queen. In spite of their limited tasks, the vitality of drones is of utmost importance for the next generation. The immune competence of drones - as compared to worker bees - is largely unexplored. Hence, we studied humoral and cellular immune reactions of in vitro reared drone larvae and adult drones of different age upon artificial bacterial infection. Haemolymph samples were collected after aseptic and septic injury and subsequently employed for (1) the identification of immune-responsive peptides and/or proteins by qualitative proteomic analyses in combination with mass spectrometry and (2) the detection of antimicrobial activity by inhibition-zone assays. Drone larvae and adult drones responded with a strong humoral immune reaction upon bacterial challenge, as validated by the expression of small antimicrobial peptides. Young adult drones exhibited a broader spectrum of defence reactions than drone larvae. Distinct polypeptides including peptidoglycan recognition protein-S2 and lysozyme 2 were upregulated in immunized adult drones. Moreover, a pronounced nodulation reaction was observed in young drones upon bacterial challenge. Prophenoloxidase zymogen is present at an almost constant level in non-infected adult drones throughout the entire lifespan. All observed immune reactions in drones were expressed in the absence of significant amounts of vitellogenin. We conclude that drones - like worker bees - have the potential to activate multiple elements of the innate immune response.
International Nuclear Information System (INIS)
Kienle, Cornelia; Koehler, H.-R.; Filser, Juliane; Gerhardt, Almut
2008-01-01
We examined acute (2 h exposure of 5-day-old larvae) and subchronic (exposure from fertilization up to an age of 11 days) effects of NiCl 2 .6H 2 O on embryos and larvae of zebrafish (Danio rerio), both alone and in combination with oxygen depletion. The following endpoints were recorded: acute exposure: locomotory activity and survival; subchronic exposure: hatching rate, deformations, locomotory activity (at 5, 8 and 11 days) and mortality. In acute exposures nickel chloride (7.5-15 mg Ni/L) caused decreasing locomotory activity. Oxygen depletion (≤2.45 ± 0.16 mg O 2 /L) also resulted in significantly reduced locomotory activity. In the subchronic test, exposure to ≥10 mg Ni/L resulted in delayed hatching at an age of 96 h, in decreased locomotory activity at an age of 5 days, and increased mortality at an age of 11 days (LC 20 = 9.5 mg Ni/L). The observed LOEC for locomotory activity (7.5 mg Ni/L) is in the range of environmentally relevant concentrations. Since locomotory activity was already affected by acute exposure, this parameter is recommended to supplement commonly recorded endpoints of toxicity. - Increasing concentrations of nickel chloride and decreasing concentrations of oxygen lead to reduced vitality and locomotory activity in Danio rerio embryos and larvae
Martinović-Weigelt, Dalma; Wang, Rong-Lin; Villeneuve, Daniel L; Bencic, David C; Lazorchak, Jim; Ankley, Gerald T
2011-01-25
The studies presented in this manuscript focus on characterization of transcriptomic responses to anti-androgens in zebrafish (Danio rerio). Research on the effects of anti-androgens in fish has been characterized by a heavy reliance on apical endpoints, and molecular mechanisms of action (MOA) of anti-androgens remain poorly elucidated. In the present study, we examined effects of a short term exposure (24-96h) to the androgen receptor antagonists flutamide (FLU) and vinclozolin (VZ) on gene expression in gonads of sexually mature zebrafish, using commercially available zebrafish oligonucleotide microarrays (4×44K platform). We found that VZ and FLU potentially impact reproductive processes via multiple pathways related to steroidogenesis, spermatogenesis, and fertilization. Observed changes in gene expression often were shared by VZ and FLU, as demonstrated by overlap in differentially-expressed genes and enrichment of several common key pathways including: (1) integrin and actin signaling, (2) nuclear receptor 5A1 signaling, (3) fibroblast growth factor receptor signaling, (4) polyamine synthesis, and (5) androgen synthesis. This information should prove useful to elucidating specific mechanisms of reproductive effects of anti-androgens in fish, as well as developing biomarkers for this important class of endocrine-active chemicals. 2010 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Jitendra Maharana
Full Text Available Nucleotide-binding oligomerization domain-containing protein 1 (NOD1 and NOD2 are cytosolic pattern recognition receptors playing pivotal roles in innate immune signaling. NOD1 and NOD2 recognize bacterial peptidoglycan derivatives iE-DAP and MDP, respectively and undergoes conformational alternation and ATP-dependent self-oligomerization of NACHT domain followed by downstream signaling. Lack of structural adequacy of NACHT domain confines our understanding about the NOD-mediated signaling mechanism. Here, we predicted the structure of NACHT domain of both NOD1 and NOD2 from model organism zebrafish (Danio rerio using computational methods. Our study highlighted the differential ATP binding modes in NOD1 and NOD2. In NOD1, γ-phosphate of ATP faced toward the central nucleotide binding cavity like NLRC4, whereas in NOD2 the cavity was occupied by adenine moiety. The conserved 'Lysine' at Walker A formed hydrogen bonds (H-bonds and Aspartic acid (Walker B formed electrostatic interaction with ATP. At Sensor 1, Arg328 of NOD1 exhibited an H-bond with ATP, whereas corresponding Arg404 of NOD2 did not. 'Proline' of GxP motif (Pro386 of NOD1 and Pro464 of NOD2 interacted with adenine moiety and His511 at Sensor 2 of NOD1 interacted with γ-phosphate group of ATP. In contrast, His579 of NOD2 interacted with the adenine moiety having a relatively inverted orientation. Our findings are well supplemented with the molecular interaction of ATP with NLRC4, and consistent with mutagenesis data reported for human, which indicates evolutionary shared NOD signaling mechanism. Together, this study provides novel insights into ATP binding mechanism, and highlights the differential ATP binding modes in zebrafish NOD1 and NOD2.
Food and conspecific chemical cues modify visual behavior of zebrafish, Danio rerio.
Stephenson, Jessica F; Partridge, Julian C; Whitlock, Kathleen E
2012-06-01
Animals use the different qualities of olfactory and visual sensory information to make decisions. Ethological and electrophysiological evidence suggests that there is cross-modal priming between these sensory systems in fish. We present the first experimental study showing that ecologically relevant chemical mixtures alter visual behavior, using adult male and female zebrafish, Danio rerio. Neutral-density filters were used to attenuate the light reaching the tank to an initial light intensity of 2.3×10(16) photons/s/m2. Fish were exposed to food cue and to alarm cue. The light intensity was then increased by the removal of one layer of filter (nominal absorbance 0.3) every minute until, after 10 minutes, the light level was 15.5×10(16) photons/s/m2. Adult male and female zebrafish responded to a moving visual stimulus at lower light levels if they had been first exposed to food cue, or to conspecific alarm cue. These results suggest the need for more integrative studies of sensory biology.
From schooling to shoaling: patterns of collective motion in zebrafish (Danio rerio.
Directory of Open Access Journals (Sweden)
Noam Miller
Full Text Available Animal groups on the move can take different configurations. For example, groups of fish can either be 'shoals' or 'schools': shoals are simply aggregations of individuals; schools are shoals exhibiting polarized, synchronized motion. Here we demonstrate that polarization distributions of groups of zebrafish (Danio rerio are bimodal, showing two distinct modes of collective motion corresponding to the definitions of shoaling and schooling. Other features of the group's motion also vary consistently between the two modes: zebrafish schools are faster and less dense than zebrafish shoals. Habituation to an environment can also alter the proportion of time zebrafish groups spend schooling or shoaling. Models of collective motion suggest that the degree and stability of group polarization increases with the group's density. Examining zebrafish groups of different sizes from 5 to 50, we show that larger groups are less polarized than smaller groups. Decreased fearfulness in larger groups may function similarly to habituation, causing them to spend more time shoaling than schooling, contrary to most models' predictions.
International Nuclear Information System (INIS)
Merrifield, Daniel L.; Shaw, Benjamin J.; Harper, Glenn M.; Saoud, Imad P.; Davies, Simon J.; Handy, Richard D.; Henry, Theodore B.
2013-01-01
Nanoparticles (NPs) can be ingested by organisms, and NPs with antimicrobial properties may disrupt beneficial endogenous microbial communities and affect organism health. Zebrafish were fed diets containing Cu-NPs or Ag-NPs (500 mg kg −1 food), or an appropriate control for 14 d. Intestinal epithelium integrity was examined by transmission electron microscopy, and microbial community structure within the intestine was assessed by denaturing gradient gel electrophoresis (DGGE) of partial 16S rRNA. No lesions were observed in intestinal epithelia; however, presence of NPs in diets changed intestinal microbial community structure. In particular, some beneficial bacterial strains (e.g., Cetobacterium somerae) were suppressed to non-detectable levels by Cu-NP exposure, and two unidentified bacterial clones from the Firmicutes phylum were sensitive (not detected) to Cu, but were present in Ag and control fish. Unique changes in zebrafish microbiome caused by exposure to Ag-NP and Cu-NP indicate that NP ingestion could affect digestive system function and organism health. -- Highlights: ► Zebrafish ingest Cu- and Ag-nanoparticles (NPs) in diet. ► No effect of Cu-NPs or Ag-NPs on intestinal epithelial integrity. ► Cu-NPs and Ag-NPs alter endogenous microbiota of zebrafish. -- Dietary exposure to manufactured Cu- and Ag-nanoparticles caused unique changes in endogenous gut microbiota in zebrafish Danio rerio
Energy Technology Data Exchange (ETDEWEB)
Merrifield, Daniel L.; Shaw, Benjamin J.; Harper, Glenn M. [School of Biomedical and Biological Sciences, Plymouth University, 401 Davy Building, Drake Circus, Plymouth PL4 8AA, Devon (United Kingdom); Saoud, Imad P. [American University of Beirut, Beirut (Lebanon); Davies, Simon J.; Handy, Richard D. [School of Biomedical and Biological Sciences, Plymouth University, 401 Davy Building, Drake Circus, Plymouth PL4 8AA, Devon (United Kingdom); Henry, Theodore B., E-mail: ted.henry@plymouth.ac.uk [School of Biomedical and Biological Sciences, Plymouth University, 401 Davy Building, Drake Circus, Plymouth PL4 8AA, Devon (United Kingdom); Center for Environmental Biotechnology, University of Tennessee, Knoxville, TN (United States); Department of Forestry, Wildlife and Fisheries, University of Tennessee, Knoxville, TN (United States)
2013-03-15
Nanoparticles (NPs) can be ingested by organisms, and NPs with antimicrobial properties may disrupt beneficial endogenous microbial communities and affect organism health. Zebrafish were fed diets containing Cu-NPs or Ag-NPs (500 mg kg{sup −1} food), or an appropriate control for 14 d. Intestinal epithelium integrity was examined by transmission electron microscopy, and microbial community structure within the intestine was assessed by denaturing gradient gel electrophoresis (DGGE) of partial 16S rRNA. No lesions were observed in intestinal epithelia; however, presence of NPs in diets changed intestinal microbial community structure. In particular, some beneficial bacterial strains (e.g., Cetobacterium somerae) were suppressed to non-detectable levels by Cu-NP exposure, and two unidentified bacterial clones from the Firmicutes phylum were sensitive (not detected) to Cu, but were present in Ag and control fish. Unique changes in zebrafish microbiome caused by exposure to Ag-NP and Cu-NP indicate that NP ingestion could affect digestive system function and organism health. -- Highlights: ► Zebrafish ingest Cu- and Ag-nanoparticles (NPs) in diet. ► No effect of Cu-NPs or Ag-NPs on intestinal epithelial integrity. ► Cu-NPs and Ag-NPs alter endogenous microbiota of zebrafish. -- Dietary exposure to manufactured Cu- and Ag-nanoparticles caused unique changes in endogenous gut microbiota in zebrafish Danio rerio.
Dicty_cDB: Contig-U13351-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available BC046045_1( BC046045 |pid:none) Danio rerio splicing factor, argin... 36 3.1 AJ000546_1( AJ000546 |pid:none) Megaselia scala..._1( X98769 |pid:none) Megaselia scalaris mRNA for Sex-lethal... 35 4.1 AY814302_1( AY814302 |pid:none) Schis
NCBI nr-aa BLAST: CBRC-DRER-19-0035 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-19-0035 ref|NP_775386.1| melanocortin 5a receptor [Danio rerio] gb|AAL85495.1| mela...nocortin 5a receptor [Danio rerio] gb|AAO24747.1| melanocortin 5b receptor [Danio rerio] NP_775386.1 1e-180 100% ...
Energy Technology Data Exchange (ETDEWEB)
Bugiak, B.; Weber, L. [Saskatchewan Univ., Saskatoon, SK (Canada)
2009-07-01
Exposure to aryl hydrocarbon receptor (AhR) agonists in fish causes lethal disturbances in fish development, but the effects of acute AhR agonist exposure on the cardiovascular system and deformities remain unclear. This study addressed this issue by performing a series of experiments on zebrafish (Danio rerio). The authors hypothesized that genes needed for cardiovascular regulation (PTGS) would exhibit a stronger link to deformities than detoxification enzymes (CYPs). Zebrafish eggs were exposed aqueously until 4 days post-fertilization (dpf) to the AhR agonists benzo(a)pyrene (BaP) or 2,3,7,8-tetrachlorodibenzop-dioxin (TCDD) alone and in combination with the putative AhR antagonists resveratrol or alpha-naphthoflavone (ANF). Gene expression was measured using real-time, reverse transcriptase PCR in zebrafish at 5 and 10 dpf. Although the mortalities did not differ considerably among groups at 10 dpf, the deformities increased significantly after BaP-ANF at 5 dpf and after BaP at 10 dpf, but not after TCDD treatment. CYP and PTGS isozymes exhibited small, but statistically significant changes at 5 dpf. By 10 dpf, the expression returned to control values. In general, CYP1A and PTGS-1 expression at 5 dpf were positively correlated with deformities, while all other genes were negatively correlated with deformities. It was concluded that changes in CYP1A, CYP1C2, and PTGS-1 gene expression at 5 dpf are associated with developmental deformities, but additional work is needed to determine which has the most important mechanistic link.
Effects of Environmental Enrichment on the Fertility and Fecundity of Zebrafish (Danio rerio).
Wafer, Lemnique N; Jensen, V Behrana; Whitney, Jesse C; Gomez, Thomas H; Flores, Rene; Goodwin, Bradford S
2016-01-01
Zebrafish (Danio rerio) are a popular vertebrate model in biomedical research, but information describing the effects of environmental enrichment on fertility and fecundity of zebrafish is sparse. In the current study, 18 breeding pairs were placed in divided 1.5-L breeding tanks containing 1 of 3 enrichment conditions: plastic grass (n = 6), plastic leaves (n = 6), or no enrichment (n = 6, control). The pairs were allowed to spawn for 3 h the next day, after which eggs were counted and breeding pairs were returned to holding tanks for use in subsequent sessions. Spawning sessions were repeated at 7-d intervals until the completion of 9 trials, with pairs rotating to a different condition at each interval. Total egg count (mean ± SEM) after 3 h was greater for zebrafish spawning in the grass environment (48.0 ± 7.7 eggs) than in the leaf or control environments (29.4 ± 5.3 and 20.4 ± 3.7 eggs, respectively). An interaction emerged between enrichment type and the age of the spawning pair on the number of fry at 6 d postfertilization (dpf). Initially, more fry were obtained from 110- and 160-dpf pairs with the grass enrichment, but from 173- and 180-dpf pairs there were more obtained with leaf enrichment than grass. A separate experiment showed that enrichment type did not have an effect on fry survivability. Overall, our data indicates that, under certain conditions, zebrafish fertility and fecundity are greater in a breeding tank containing environmental enrichment than in a bare tank.
Lee, David; Lee, Joshua; Lee, Imshik
2015-01-01
The locomotor behavior of small fish was characterized under a cell phone-generated radio frequency electromagnetic field (RF EMF). The trajectory of movement of 10 pairs of guppy (Poecilia reticulate) and 15 pairs of Zebrafish (Danio rerio) in a fish tank was recorded and tracked under the presence of a cell phone-generated RF EMF. The measures were based on spatial and temporal distributions. A time-series trajectory was utilized to emphasize the dynamic nature of locomotor behavior. Fish movement was recorded in real-time. Their spatial, velocity, turning angle and sinuosity distribution were analyzed in terms of F(v,x), P[n(x,t)], P(v), F (θ) and F(s), respectively. In addition, potential temperature elevation caused by a cellular phone was also examined. We demonstrated that a cellular phone-induced temperature elevation was not relevant, and that our measurements reflected RF EMF-induced effects on the locomotor behavior of Poecilia reticulata and Danio rerio. Fish locomotion was observed under normal conditions, in the visual presence of a cell phone, after feeding, and under starvation. Fish locomotor behavior was random both in normal conditions and in the presence of an off-signaled cell phone. However, there were significant changes in the locomotion of the fish after feeding under the RF EMF. The locomotion of the fed fish was affected in terms of changes in population and velocity distributions under the presence of the RF EMF emitted by the cell phone. There was, however, no significant difference in angular distribution.
International Nuclear Information System (INIS)
Cáceres-Vélez, Paolin Rocio; Fascineli, Maria Luiza; Koppe Grisolia, Cesar; Oliveira Lima, Emília Celma de; Sousa, Marcelo Henrique; Morais, Paulo César de; Bentes de Azevedo, Ricardo
2016-01-01
Magnetic exfoliated vermiculite is a synthetic nanocomposite that quickly and efficiently absorbs organic compounds such as oil from water bodies. It was developed primarily to mitigate pollution, but the possible adverse impacts of its application have not yet been evaluated. In this context, the acute toxicity of magnetic exfoliated vermiculite and exfoliated vermiculite was herein assessed by genotoxic and histopathological biomarkers in zebrafish (Danio rerio). DNA fragmentation was statistically significant for all groups exposed to the magnetic exfoliated vermiculite and for fish exposed to the highest concentration (200 mg/L) of exfoliated vermiculite, whereas the micronucleus frequency, nuclear abnormalities and histopathological alterations were not statistically significant for the fish exposed to these materials. In the intestinal lumen, epithelial cells and goblet cells, we found the presence of magnetic exfoliated vermiculite and exfoliated vermiculite, but no alterations or presence of the materials-test in the gills or liver were observed. Our findings suggest that the use of magnetic exfoliated vermiculite and exfoliated vermiculite during standard ecotoxicological assays caused DNA damage in D. rerio, whose alterations may be likely to be repaired, indicating that the magnetic nanoparticles have the ability to promote genotoxic damage, such as DNA fragmentation, but not mutagenic effects. - Highlights: • MEV is a synthetic nanocomposite that quickly and efficiently absorbs organic compounds such as oil from water bodies. • The use of MEV and EV during standard ecotoxicological assays caused DNA fragmentation in zebrafish. • The magnetic nanoparticles showed ability to promote genotoxic damage, but did not induce micronucleus in peripheral erythrocytes at 96 h of exposure. • The tested concentrations of MEV and EV do not cause significant histopathological alterations in the gills, liver and intestine of zebrafish.
Energy Technology Data Exchange (ETDEWEB)
Cáceres-Vélez, Paolin Rocio; Fascineli, Maria Luiza; Koppe Grisolia, Cesar [Department of Genetics and Morphology, Institute of Biological Sciences, Brasília University, Brasília (Brazil); Oliveira Lima, Emília Celma de [Chemistry Institute, Federal University of Goiás, Goiânia (Brazil); Sousa, Marcelo Henrique [Green Nanotechnology Group, Faculty of Ceilândia, Brasília University, Brasília (Brazil); Morais, Paulo César de [Physics Institute, Brasília University, Brasília (Brazil); Huazhong University of Science and Technology, School of Automation, Wuhan 430074 (China); Bentes de Azevedo, Ricardo, E-mail: razevedo@unb.br [Department of Genetics and Morphology, Institute of Biological Sciences, Brasília University, Brasília (Brazil)
2016-05-01
Magnetic exfoliated vermiculite is a synthetic nanocomposite that quickly and efficiently absorbs organic compounds such as oil from water bodies. It was developed primarily to mitigate pollution, but the possible adverse impacts of its application have not yet been evaluated. In this context, the acute toxicity of magnetic exfoliated vermiculite and exfoliated vermiculite was herein assessed by genotoxic and histopathological biomarkers in zebrafish (Danio rerio). DNA fragmentation was statistically significant for all groups exposed to the magnetic exfoliated vermiculite and for fish exposed to the highest concentration (200 mg/L) of exfoliated vermiculite, whereas the micronucleus frequency, nuclear abnormalities and histopathological alterations were not statistically significant for the fish exposed to these materials. In the intestinal lumen, epithelial cells and goblet cells, we found the presence of magnetic exfoliated vermiculite and exfoliated vermiculite, but no alterations or presence of the materials-test in the gills or liver were observed. Our findings suggest that the use of magnetic exfoliated vermiculite and exfoliated vermiculite during standard ecotoxicological assays caused DNA damage in D. rerio, whose alterations may be likely to be repaired, indicating that the magnetic nanoparticles have the ability to promote genotoxic damage, such as DNA fragmentation, but not mutagenic effects. - Highlights: • MEV is a synthetic nanocomposite that quickly and efficiently absorbs organic compounds such as oil from water bodies. • The use of MEV and EV during standard ecotoxicological assays caused DNA fragmentation in zebrafish. • The magnetic nanoparticles showed ability to promote genotoxic damage, but did not induce micronucleus in peripheral erythrocytes at 96 h of exposure. • The tested concentrations of MEV and EV do not cause significant histopathological alterations in the gills, liver and intestine of zebrafish.
Chronic effects of clofibric acid in zebrafish (Danio rerio): a multigenerational study.
Coimbra, Ana M; Peixoto, Maria João; Coelho, Inês; Lacerda, Ricardo; Carvalho, António Paulo; Gesto, Manuel; Lyssimachou, Angeliki; Lima, Daniela; Soares, Joana; André, Ana; Capitão, Ana; Castro, Luís Filipe C; Santos, Miguel M
2015-03-01
Clofibric acid (CA) is an active metabolite of the blood lipid lowering agent clofibrate, a pharmaceutical designed to work as agonist of peroxisome proliferator-activated receptor alpha (PPARa). It is the most commonly reported fibrate in aquatic environments with low degradation rate and potential environmental persistence. Previous fish exposures showed that CA may impact spermatogenesis, growth and the expression of fat binding protein genes. However, there are limited data on the effects of chronic multigenerational CA exposures. Here, we assessed chronic multigenerational effects of CA exposure using zebrafish (Danio rerio) as a teleost model. Zebrafish were exposed through the diet to CA (1 and 10mg/g) during their whole lifetime. Growth, reproduction-related parameters and embryonic development were assessed in the exposed fish (F1 generation) and their offspring (F2 generation), together with muscle triglyceride content and gonad histology. In order to study the potential underlying mechanisms, the transcription levels of genes coding for enzymes involved in lipid metabolism pathways were determined. The results show that chronic life-cycle exposure to CA induced a significant reduction in growth of F1 generation and lowered triglyceride muscle content (10mg/g group). Also, an impact in male gonad development was observed together with a decrease in the fecundity (10mg/g group) and higher frequency of embryo abnormalities in the offspring of fish exposed to the lowest CA dose. The profile of the target genes was sex- and tissue-dependent. In F1 an up-regulation of male hepatic pparaa, pparb and acox transcript levels was observed, suggesting an activation of the fatty acid metabolism (provided that transcript level change indicates also a protein level change). Interestingly, the F2 generation, raised with control diet, displayed a response pattern different from that observed in F1, showing an increase in weight in the descendants of CA exposed fish, in
Directory of Open Access Journals (Sweden)
Yingxue Ren
2014-06-01
Full Text Available One of the most striking patterns in comparative biology is the negative correlation between lifespan and fecundity observed in comparisons among species. This pattern is consistent with the idea that organisms need to allocate a fixed energy budget among competing demands of growth, development, reproduction and somatic maintenance. However, exceptions to this pattern have been observed in many social insects, including ants, bees, and termites. In honey bees (Apis mellifera, Vitellogenin (Vg, a yolk protein precursor, has been implicated in mediating the long lifespan and high fecundity of queen bees. To determine if Vg-like proteins can regulate lifespan in insects generally, we examined the effects of expression of Apis Vg and Drosophila CG31150 (a Vg-like gene recently identified as cv-d on Drosophila melanogaster lifespan and fecundity using the RU486-inducible GeneSwitch system. For all genotypes tested, overexpression of Vg and CG31150 decreased Drosophila lifespan and did not affect total or age-specific fecundity. We also detected an apparent effect of the GeneSwitch system itself, wherein RU486 exposure (or the GAL4 expression it induces led to a significant increase in longevity and decrease in fecundity in our fly strains. This result is consistent with the pattern reported in a recent meta-analysis of Drosophila aging studies, where transgenic constructs of the UAS/GAL4 expression system that should have no effect (e.g. an uninduced GeneSwitch significantly extended lifespan in some genetic backgrounds. Our results suggest that Vg-family genes are not major regulators of Drosophila life history traits, and highlight the importance of using appropriate controls in aging studies.
NCBI nr-aa BLAST: CBRC-FRUB-02-0423 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0423 ref|NP_899187.1| progestin and adipoQ receptor family member VIII... [Danio rerio] gb|AAN78114.1| membrane progestin receptor beta [Danio rerio] emb|CAI12035.1| membrane progestin receptor beta [Danio rerio] NP_899187.1 1e-119 59% ...
NCBI nr-aa BLAST: CBRC-OLAT-24-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-24-0038 ref|NP_899187.1| progestin and adipoQ receptor family member VIII... [Danio rerio] gb|AAN78114.1| membrane progestin receptor beta [Danio rerio] emb|CAI12035.1| membrane progestin receptor beta [Danio rerio] NP_899187.1 1e-124 61% ...
NCBI nr-aa BLAST: CBRC-DRER-20-0043 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-20-0043 ref|NP_899187.1| progestin and adipoQ receptor family member VIII... [Danio rerio] gb|AAN78114.1| membrane progestin receptor beta [Danio rerio] emb|CAI12035.1| membrane progestin receptor beta [Danio rerio] NP_899187.1 0.0 100% ...
Dicty_cDB: Contig-U12286-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ummi 220 kDa silk protein... 42 0.064 Y10353_1( Y10353 |pid:none) D.rerio notch5 mRNA. 42 0.064 T28674( T28674 ) alpha-51D-immobiliza...tion antigen - Paramecium tet... 42 0.064 DQ234084_1( DQ
Long-term (30 days toxicity of NiO nanoparticles for adult zebrafish Danio rerio
Directory of Open Access Journals (Sweden)
Kovrižnych Jevgenij A.
2014-03-01
Full Text Available Nickel oxide in the form of nanoparticles (NiO NPs is extensively used in different industrial branches. In a test on adult zebrafish, the acute toxicity of NiO NPs was shown to be low, however longlasting contact with this compound can lead to its accumulation in the tissues and to increased toxicity. In this work we determined the 30-day toxicity of NiO NPs using a static test for zebrafish Danio rerio. We found the 30-day LC50 value to be 45.0 mg/L, LC100 (minimum concentration causing 100% mortality was 100.0 mg/L, and LC0 (maximum concentration causing no mortality was 6.25 mg/L for adult individuals of zebrafish. Considering a broad use of Ni in the industry, NiO NPs chronic toxicity may have a negative impact on the population of aquatic organisms and on food web dynamics in aquatic systems.
Chronic exposure of μg/L range Bisphenol A to adult zebrafish (Danio rerio) leading to adipogenesis
Ngo, Mai Thi; Doan, Thao Thi-Phuong; Nguyen, Cong Thanh; Vo, Diem Thi-Ngoc; Do, Chi Hong-Lan; Le, Nga Phi
2017-09-01
Bisphenol A (BPA) is known as an endocrine disruptor compound and commonly found in food-packaging plastics and in aquatic environment. It is scientifically concerned that BPA may causes significant health risks to human and aquatic animals. In fact, most of scientific studies have been conducted with BPA-acute toxicity in early stages of animal development, while far lesser researches have been focused on BPA-chronic toxicity in adults. This study was to investigate the chronic effects of environmental 1, 10 and 100 µg/L BPA to four-week-old zebrafishes (Danio rerio) after 60 days of exposure in terms of changing of body morphology, hepatocyte morphology and the transcriptional expression of biomarker gene for lipid metabolism. As a result, significant effects were found in: 1/ the increase of body weight, but not body length; 2/ the increase in the number of vacuolated hepatocytes corresponding to relatively higher glycogen and lipid content; 3/ shifting hepatocyte morphology to basophilic cytoplasm and cytoplasmic and/or nuclear enlargement, but not inflammation signs (macrophages, granuloma, fibrosis/cirrhosis); 4/ the decrease of mRNA level of PPARγ and C/EBPα genes in liver. Our study here indicates that the exposure to μg/L range concentration of BPA leads to adipogensis in adult zebrafishes.
Robo-AO M Dwarf Multiplicity Survey
Lamman, Claire; Baranec, Christoph; Berta-Thompson, Zachory K.; Law, Nicholas M.; Ziegler, Carl; Schonhut-Stasik, Jessica
2018-06-01
We analyzed close to 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the total multiplicity fraction and multiplicity functions of M dwarfs, which are crucial steps towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. After a conservative initial cut for quality, over 350 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. Further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.
Heger, Sebastian; Du, Miaomiao; Bauer, Kevin; Schäffer, Andreas; Hollert, Henner
2018-08-01
The ecotoxicity of two biofuel candidates (1‑octanol and 2‑butanone) was investigated by an integrative test strategy using three bioassays: the acute immobilisation test with water flea (D. magna), the fish embryo acute toxicity test with zebrafish (Danio rerio) and the in vitro micronucleus assay with Chinese hamster (Cricetulus griseus) V79 cells. The median effective concentration (EC 50 ) values were 14.9±0.66mgL -1 for 1‑octanol, and 2152.1±44.6mgL -1 for 2‑butanone in the D. magna test. Both 1‑octanol and 2‑butanone caused teratogenic and lethal effects on zebrafish embryos, while exposure to 1‑octanol significantly induced these effects at concentrations ≥2.0mgL -1 . These results indicate that 1‑octanol exert much higher ecotoxicity than 2‑butanone to D. magna and zebrafish embryos. Moreover, both 1‑octanol and 2‑butanone did not cause significant genotoxic effects, while their metabolites significantly induced micronuclei in V79 cells. The present study proposed an integrative test approach to evaluate the potential ecotoxicity of biofuels using simple, quick and inexpensive bioassays. Copyright © 2018 Elsevier B.V. All rights reserved.
Wang, Ying; Brent, Colin S; Fennern, Erin; Amdam, Gro V
2012-06-01
Honey bees (Apis mellifera) provide a system for studying social and food-related behavior. A caste of workers performs age-related tasks: young bees (nurses) usually feed the brood and other adult bees inside the nest, while older bees (foragers) forage outside for pollen, a protein/lipid source, or nectar, a carbohydrate source. The workers' transition from nursing to foraging and their foraging preferences correlate with differences in gustatory perception, metabolic gene expression, and endocrine physiology including the endocrine factors vitellogenin (Vg) and juvenile hormone (JH). However, the understanding of connections among social behavior, energy metabolism, and endocrine factors is incomplete. We used RNA interference (RNAi) to perturb the gene network of Vg and JH to learn more about these connections through effects on gustation, gene transcripts, and physiology. The RNAi perturbation was achieved by single and double knockdown of the genes ultraspiracle (usp) and vg, which encode a putative JH receptor and Vg, respectively. The double knockdown enhanced gustatory perception and elevated hemolymph glucose, trehalose, and JH. We also observed transcriptional responses in insulin like peptide 1 (ilp1), the adipokinetic hormone receptor (AKHR), and cGMP-dependent protein kinase (PKG, or "foraging gene" Amfor). Our study demonstrates that the Vg-JH regulatory module controls changes in carbohydrate metabolism, but not lipid metabolism, when worker bees shift from nursing to foraging. The module is also placed upstream of ilp1, AKHR, and PKG for the first time. As insulin, adipokinetic hormone (AKH), and PKG pathways influence metabolism and gustation in many animals, we propose that honey bees have conserved pathways in carbohydrate metabolism and conserved connections between energy metabolism and gustatory perception. Thus, perhaps the bee can make general contributions to the understanding of food-related behavior and metabolic disorders.
Directory of Open Access Journals (Sweden)
Ying Wang
2012-06-01
Full Text Available Honey bees (Apis mellifera provide a system for studying social and food-related behavior. A caste of workers performs age-related tasks: young bees (nurses usually feed the brood and other adult bees inside the nest, while older bees (foragers forage outside for pollen, a protein/lipid source, or nectar, a carbohydrate source. The workers' transition from nursing to foraging and their foraging preferences correlate with differences in gustatory perception, metabolic gene expression, and endocrine physiology including the endocrine factors vitellogenin (Vg and juvenile hormone (JH. However, the understanding of connections among social behavior, energy metabolism, and endocrine factors is incomplete. We used RNA interference (RNAi to perturb the gene network of Vg and JH to learn more about these connections through effects on gustation, gene transcripts, and physiology. The RNAi perturbation was achieved by single and double knockdown of the genes ultraspiracle (usp and vg, which encode a putative JH receptor and Vg, respectively. The double knockdown enhanced gustatory perception and elevated hemolymph glucose, trehalose, and JH. We also observed transcriptional responses in insulin like peptide 1 (ilp1, the adipokinetic hormone receptor (AKHR, and cGMP-dependent protein kinase (PKG, or "foraging gene" Amfor. Our study demonstrates that the Vg-JH regulatory module controls changes in carbohydrate metabolism, but not lipid metabolism, when worker bees shift from nursing to foraging. The module is also placed upstream of ilp1, AKHR, and PKG for the first time. As insulin, adipokinetic hormone (AKH, and PKG pathways influence metabolism and gustation in many animals, we propose that honey bees have conserved pathways in carbohydrate metabolism and conserved connections between energy metabolism and gustatory perception. Thus, perhaps the bee can make general contributions to the understanding of food-related behavior and metabolic disorders.
Directory of Open Access Journals (Sweden)
Young Jae Choi
2014-04-01
Full Text Available Leptin plays an important role in energy homeostasis and reproductive function in fish, especially in reproduction. Migrating fish, such as salmonoids, are affected by external environmental factors, and salinity changes are a particularly important influence on spawning migrations. The aim of this study was to test whether changes in salinity affect the expression of leptin, estrogen receptors (ERs, and vitellogenin (VTG in chum salmon (Oncorhynchus keta. The expression and activity of leptin, the expression of ERs and VTG, and the levels of estradiol-17β and cortisol increased after the fish were transferred to FW, demonstrating that changes in salinity stimulate the HPG axis in migrating female chum salmon. These findings reveal details about the role of elevated leptin levels and sex steroid hormones in stimulating sexual maturation and reproduction in response to salinity changes in chum salmon.
Thyroid hormone regulates muscle function during cold acclimation in zebrafish (Danio rerio).
Little, Alexander G; Seebacher, Frank
2013-09-15
Thyroid hormone (TH) is a universal regulator of growth, development and metabolism during cold exposure in mammals. In zebrafish (Danio rerio), TH regulates locomotor performance and metabolism during cold acclimation. The influence of TH on locomotor performance may be via its effect on metabolism or, as has been shown in mammals, by modulating muscle phenotypes. Our aim was to determine whether TH influences muscle phenotypes in zebrafish, and whether this could explain changes in swimming capacity in response to thermal acclimation. We used propylthiouracil and iopanoic acid to induce hypothyroidism in zebrafish over a 3-week acclimation period to either 18 or 28°C. To verify that physiological changes following hypothyroid treatment were in fact due to the action of TH, we supplemented hypothyroid fish with 3,5-diiodothryronine (T2) or 3,5,3'-triiodothyronine (T3). Cold-acclimated fish had significantly greater sustained swimming performance (Ucrit) but not burst speed. Greater Ucrit was accompanied by increased tail beat frequency, but there was no change in tail beat amplitude. Hypothyroidism significantly decreased Ucrit and burst performance, as well as tail beat frequency and SERCA activity in cold-acclimated fish. However, myofibrillar ATPase activity increased in cold-acclimated hypothyroid fish. Hypothyroid treatment also decreased mRNA concentrations of myosin heavy chain fast isoforms and SERCA 1 isoform in cold-acclimated fish. SERCA 1 mRNA increased in warm-acclimated hypothyroid fish, and SERCA 3 mRNA decreased in both cold- and warm-acclimated hypothyroid fish. Supplementation with either T2 or T3 restored Ucrit, burst speed, tail beat frequency, SERCA activity and myosin heavy chain and SERCA 1 and 3 mRNA levels of hypothyroid fish back to control levels. We show that in addition to regulating development and metabolism in vertebrates, TH also regulates muscle physiology in ways that affect locomotor performance in fish. We suggest that the
Sleep deprivation effects on object discrimination task in zebrafish (Danio rerio).
Pinheiro-da-Silva, Jaquelinne; Silva, Priscila Fernandes; Nogueira, Marcelo Borges; Luchiari, Ana Carolina
2017-03-01
The zebrafish is an ideal vertebrate model for neurobehavioral studies with translational relevance to humans. Many aspects of sleep have been studied, but we still do not understand how and why sleep deprivation alters behavioral and physiological processes. A number of hypotheses suggest its role in memory consolidation. In this respect, the aim of this study was to analyze the effects of sleep deprivation on memory in zebrafish (Danio rerio), using an object discrimination paradigm. Four treatments were tested: control, partial sleep deprivation, total sleep deprivation by light pulses, and total sleep deprivation by extended light. The control group explored the new object more than the known object, indicating clear discrimination. The partially sleep-deprived group explored the new object more than the other object in the discrimination phase, suggesting a certain degree of discriminative performance. By contrast, both total sleep deprivation groups equally explored all objects, regardless of their novelty. It seems that only one night of sleep deprivation is enough to affect discriminative response in zebrafish, indicating its negative impact on cognitive processes. We suggest that this study could be a useful screening tool for cognitive dysfunction and a better understanding of the effect of sleep-wake cycles on cognition.
Diekmann, Markus; Hultsch, Veit; Nagel, Roland
2004-05-28
Genotoxicity may be detected in surface waters by means of various genotoxicity assays. In order to enable an ecotoxicological assessment of the consequences of such genotoxic potential for fish populations, a complete life-cycle test with zebrafish (Danio rerio) and the model genotoxicant 4-nitroquinoline-1-oxide (NQO) was conducted. Zebrafish (f1) were continuously exposed to NQO (i.e. 0.1, 0.3, 1.1, 2.9, and 14.6 microg/l, respectively) from fertilised eggs until sexual maturity. In addition to reproduction studies in the f1-generation, f2-fish were exposed to NQO during the first 6 weeks of development. Up to 2.9 microg/l NQO, fish did not display differences in survival and growth (P < 0.05). A NQO concentration of 14.6 microg/l, however, was lethal. Female fish exposed to all NQO concentrations up to 2.9 microg/l displayed a significant reduction in egg production (P < 0.05). A mathematical simulation revealed that exposure to weak concentrations of NQO is leading to an elevated extinction risk. Copyright 2004 Elsevier B.V.
Intrinsic Xenobiotic Metabolizing Enzyme Activities in Early Life Stages of Zebrafish (Danio rerio).
Otte, Jens C; Schultz, Bernadette; Fruth, Daniela; Fabian, Eric; van Ravenzwaay, Bennard; Hidding, Björn; Salinas, Edward R
2017-09-01
Early life stages of zebrafish (Danio rerio, zf) are gaining attention as an alternative invivo test system for drug discovery, early developmental toxicity screenings and chemical testing in ecotoxicological and toxicological testing strategies. Previous studies have demonstrated transcriptional evidence for xenobiotic metabolizing enzymes (XME) during early zf development. However, elaborate experiments on XME activities during development are incomplete. In this work, the intrinsic activities of representative phase I and II XME were monitored by transformation of putative zf model substrates analyzed using photometry and high pressure liquid chromatography techniques. Six different defined stages of zf development (between 2.5 h postfertilization (hpf) to 120 hpf) were investigated by preparing a subcellular fraction from whole organism homogenates. We demonstrated that zf embryos as early as 2.5 hpf possess intrinsic metabolic activities for esterase, Aldh, Gst, and Cyp1a above the methodological detection limit. The activities of the enzymes Cyp3a and Nat were measurable during later stages in development. Activities represent dynamic patterns during development. The role of XME activities revealed in this work is relevant for the assessing toxicity in this test system and therefore contributes to a valuable characterization of zf embryos as an alternative testing organism in toxicology. © The Author 2017. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Modeling Data Containing Outliers using ARIMA Additive Outlier (ARIMA-AO)
Saleh Ahmar, Ansari; Guritno, Suryo; Abdurakhman; Rahman, Abdul; Awi; Alimuddin; Minggi, Ilham; Arif Tiro, M.; Kasim Aidid, M.; Annas, Suwardi; Utami Sutiksno, Dian; Ahmar, Dewi S.; Ahmar, Kurniawan H.; Abqary Ahmar, A.; Zaki, Ahmad; Abdullah, Dahlan; Rahim, Robbi; Nurdiyanto, Heri; Hidayat, Rahmat; Napitupulu, Darmawan; Simarmata, Janner; Kurniasih, Nuning; Andretti Abdillah, Leon; Pranolo, Andri; Haviluddin; Albra, Wahyudin; Arifin, A. Nurani M.
2018-01-01
The aim this study is discussed on the detection and correction of data containing the additive outlier (AO) on the model ARIMA (p, d, q). The process of detection and correction of data using an iterative procedure popularized by Box, Jenkins, and Reinsel (1994). By using this method we obtained an ARIMA models were fit to the data containing AO, this model is added to the original model of ARIMA coefficients obtained from the iteration process using regression methods. In the simulation data is obtained that the data contained AO initial models are ARIMA (2,0,0) with MSE = 36,780, after the detection and correction of data obtained by the iteration of the model ARIMA (2,0,0) with the coefficients obtained from the regression Zt = 0,106+0,204Z t-1+0,401Z t-2-329X 1(t)+115X 2(t)+35,9X 3(t) and MSE = 19,365. This shows that there is an improvement of forecasting error rate data.
Dicty_cDB: Contig-U02731-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 28481_1( EU128481 |pid:none) Tanichthys albonubes beta-actin mR... 59 1e-07 ATRTC( A38571 ;A02999)actin beta...98305 |pid:none) Danio rerio clone RK113A4D08 actin... 57 4e-07 EU128482_1( EU128482 |pid:none) Tanichthys albonube
Fatores associados a baixa adesao ao tratamento medicamentoso em idosos
Directory of Open Access Journals (Sweden)
Noemia Urruth Leao Tavares
2013-12-01
Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.
Combinatorial effects of zinc deficiency and arsenic exposure on zebrafish (Danio rerio development.
Directory of Open Access Journals (Sweden)
Laura M Beaver
Full Text Available Zinc deficiency and chronic low level exposures to inorganic arsenic in drinking water are both significant public health concerns that affect millions of people including pregnant women. These two conditions can co-exist in the human population but little is known about their interaction, and in particular, whether zinc deficiency sensitizes individuals to arsenic exposure and toxicity, especially during critical windows of development. To address this, we utilized the Danio rerio (zebrafish model to test the hypothesis that parental zinc deficiency sensitizes the developing embryo to low-concentration arsenic toxicity, leading to altered developmental outcomes. Adult zebrafish were fed defined zinc deficient and zinc adequate diets and were spawned resulting in zinc adequate and zinc deficient embryos. The embryos were treated with environmentally relevant concentrations of 0, 50, and 500 ppb arsenic. Arsenic exposure significantly reduced the amount of zinc in the developing embryo by ~7%. The combination of zinc deficiency and low-level arsenic exposures did not sensitize the developing embryo to increased developmental malformations or mortality. The combination did cause a 40% decline in physical activity of the embryos, and this decline was significantly greater than what was observed with zinc deficiency or arsenic exposure alone. Significant changes in RNA expression of genes that regulate zinc homeostasis, response to oxidative stress and insulin production (including zip1, znt7, nrf2, ogg1, pax4, and insa were found in zinc deficient, or zinc deficiency and arsenic exposed embryos. Overall, the data suggests that the combination of zinc deficiency and arsenic exposure has harmful effects on the developing embryo and may increase the risk for developing chronic diseases like diabetes.
DEFF Research Database (Denmark)
Skjolding, Lars Michael; Ašmonaitė, G; Jølck, Rasmus Irming
2017-01-01
A major challenge in nanoecotoxicology is finding suitable methods to determine the uptake and localisation of nanoparticles on a whole-organism level. Some uptake methods have been associated with artefacts induced by sample preparation, including staining for electron microscopy. This study used...... light sheet microscopy (LSM) to define the uptake and localisation of fluorescently labelled nanoparticles in living organisms with minimal sample preparation. Zebrafish (Danio rerio) were exposed to fluorescent gold nanoparticles (Au NPs) and fluorescent polystyrene NPs via aqueous or dietary exposure...
Directory of Open Access Journals (Sweden)
Gabi Dumitrescu
2010-05-01
Full Text Available This paper is part of a complex study of our research collective that studies the toxic effect of the ethinylestradiolum, and some of the polyethoxylated alkylphenols on the growth and reproduction of the Zebra fish (Danio rerio and of the common Carp (Cyprinus carpio. Our study aim was to evaluate the effect of octylphenol on growth and survival of zebra fish, from 21-115 days, and within 21-75 days of life. For this purpose, for each period under study, fishes were divided into three groups of 30 individuals, named: Lot 1 - Control, respectively lots 2 and 3, at which the administrated octylphenol concentrations were of 60 μg L-1, respectively 100 μg L-1. Fishes of the six groups were raised in 30-liters aquariums (30 fish / aquarium. The growth was measured by weighing and biometric measurements (total length, standard length, the length of the head, maximal height, minimal height and the mass of the body, while the surviving rate was established at the end of every period and at the end of the experiment, when we were able to calculate the total number of dead fish. Biometric study of the analysis performed in 75 days, 115 days respectively shows that octylphenol has negative influence on body development, and survival both, the highest percentage of mortality (46,66% was registered at 100 μgL-1 concentration, between 21 -75 days.
Adesão ao tratamento da ambliopia
Directory of Open Access Journals (Sweden)
Arakaki Mara Regina
2004-01-01
Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.
Energy Technology Data Exchange (ETDEWEB)
Scott, Philip D. [Australian Rivers Institute, Griffith School of Environment, Griffith University, Southport, Queensland, 4222 (Australia); Coleman, Heather M. [School of Pharmacy and Pharmaceutical Science, Ulster University, Coleraine, BT52 1SA, Northern Ireland (United Kingdom); Colville, Anne; Lim, Richard [School of Life Sciences, University of Technology Sydney, PO Box 123, Broadway, New South Wales, 2007 (Australia); Matthews, Benjamin [Australian Rivers Institute, Griffith School of Environment, Griffith University, Southport, Queensland, 4222 (Australia); McDonald, James A. [School of Civil & Environmental Engineering, University of New South Wales, New South Wales, 2052 (Australia); Miranda, Ana [School of Applied Sciences, Royal Melbourne Institute of Technology, PO Box 71, Bundoora, Victoria, 3083 (Australia); Neale, Peta A. [Australian Rivers Institute, Griffith School of Environment, Griffith University, Southport, Queensland, 4222 (Australia); Nugegoda, Dayanthi [School of Applied Sciences, Royal Melbourne Institute of Technology, PO Box 71, Bundoora, Victoria, 3083 (Australia); Tremblay, Louis A. [Cawthron Institute, 98 Halifax St. East, Nelson 7042 (New Zealand); School of Biological Sciences, University of Auckland, PO Box 92019, Auckland, 1142 (New Zealand); Leusch, Frederic D.L., E-mail: f.leusch@griffith.edu.au [Australian Rivers Institute, Griffith School of Environment, Griffith University, Southport, Queensland, 4222 (Australia)
2017-04-15
Highlights: • Mosquitofish and rainbowfish exposed in the lab to trace organic compounds. • Vitellogenin protein and mRNA monitored as biomarker of estrogenicity. • Minimal response in both species to environmentally relevant concentrations. • Native rainbowfish was slightly more sensitive than the invasive mosquitofish. • Results suggest that risk of estrogenic disruption in Australian rivers is low. - Abstract: In Australia, trace organic contaminants (TrOCs) and endocrine active compounds (EACs) have been detected in rivers impacted by sewage effluent, urban stormwater, agricultural and industrial inputs. It is unclear whether these chemicals are at concentrations that can elicit endocrine disruption in Australian fish species. In this study, native rainbowfish (Melanotaenia fluviatilis) and introduced invasive (but prevalent) mosquitofish (Gambusia holbrooki) were exposed to the individual compounds atrazine, estrone, bisphenol A, propylparaben and pyrimethanil, and mixtures of compounds including hormones and personal care products, industrial compounds, and pesticides at environmentally relevant concentrations. Vitellogenin (Vtg) protein and liver Vtg mRNA induction were used to assess the estrogenic potential of these compounds. Vtg expression was significantly affected in both species exposed to estrone at concentrations that leave little margin for safety (p < 0.001). Propylparaben caused a small but statistically significant 3× increase in Vtg protein levels (p = 0.035) in rainbowfish but at a concentration 40× higher than that measured in the environment, therefore propylparaben poses a low risk of inducing endocrine disruption in fish. Mixtures of pesticides and a mixture of hormones, pharmaceuticals, industrial compounds and pesticides induced a small but statistically significant increase in plasma Vtg in rainbowfish, but did not affect mosquitofish Vtg protein or mRNA expression. These results suggest that estrogenic activity represents a
DEFF Research Database (Denmark)
Bjerregaard, Poul; Andersen, Dorthe N; Pedersen, Knud L
2003-01-01
l(-1) for 12 days. Plasma vitellogenin was measured before and during the exposures and the concentrations of propylparaben in liver and muscle were determined at the end of experiments. Increases in average plasma vitellogenin levels were seen at oral exposure to 33 mg propylparabenkg(-1) 2 d(-1......); the most sensitive fish responded to 7 mg kg(-1). The ED(50) values for increase in vitellogenin synthesis were 35, 31 and 22 mg kg(-1) 2 d(-1) at day 3, 6 and 11, respectively. Exposure to 225 microg propylparabenl(-1) increased vitellogenin synthesis, but exposure to 50 microg l(-1) did not....... Propylparaben showed little tendency to bioaccumulation in rainbow trout; less than 1 per thousand of the total amount of propylparaben administered orally at 1830 mg kg(-1) 2 d(-1) over the 10-d experimental period was retained in muscle and liver 24 h after the end of the experiment. Exposure to 225 microg...
Hundt, Matthias; Schreiber, Benjamin; Eckmann, Reiner; Lunestad, Bjørn Tore; Wünneman, Hannah; Schulz, Ralf
2016-02-01
Marking of fish otoliths with oxytetracycline and tetracycline is a widely used method to evaluate the effectiveness of stocking operations. Available protocols for the labeling of fish specify a number of factors influencing mark quality and potential risk for fish during marking. This study investigates the influence of water hardness on mortality of freshwater fish during marking with OTC. In order to pursue this question complexation of OTC with Mg(2+) and Ca(2+) cations was measured spectrophotometrically. Furthermore, zebrafish (Danio rerio) were immersed in OTC solutions (1200 mg/L; 48 h immersion) combined with varying levels of water hardness (5.5, 15.5, 25.5, 32.5°dH). The amount of OTC-Mg-Ca-complexes was positively correlated to water hardness. Moreover, it could be demonstrated that mortality of zebrafish during marking varied as a factor of water hardness. Highest mortalities occurred at the lowest (5.5°dH) and the highest (32.5°dH) tested levels during marking with OTC.
Seal, S N; Davis, D L; Burch, J B
1991-05-01
The endogenous chicken vitellogenin II (VTGII) gene is transcribed exclusively in hepatocytes in response to estrogen. We previously identified two estrogen response elements (EREs) upstream of this gene. We now present an analysis of the VTGII promoter activated by these EREs in response to estrogen. Chimeric VTGII-CAT genes were cotransfected into LMH chicken hepatoma cells along with an estrogen receptor expression vector, and transient CAT expression was assayed after culturing the cells in the absence or presence of estrogen. An analysis of constructs bearing deletions downstream of the more proximal ERE indicated that promoter elements relevant to transcription in LMH cells extend to between -113 and -96. The relative importance of sequences within the VTGII promoter was examined by using 10 contiguous linker scanner mutations spanning the region from -117 to -24. Although most of these mutations compromised VTGII promoter function, one dramatically increased expression in LMH cells and also rendered the VTGII promoter capable of being activated by cis-linked EREs in fibroblasts cotransfected with an estrogen receptor expression vector. Gel retardation and DNase I footprinting assays revealed four factor-binding sites within this promoter. We demonstrate that three of these sites bind C/EBP, SP1, and USF (or related factors), respectively; the fourth site binds a factor that we denote TF-V beta. The biological relevance of these findings is suggested by the fact that three of these binding sites map to sites previously shown to be occupied in vivo in response to estrogen.
Directory of Open Access Journals (Sweden)
Mara Fernandes Moura
2008-01-01
Full Text Available O trabalho objetivou verificar o comportamento de Linhagens Endogâmicas Recombinantes (RIL's - Recombinant Imbred Lines, obtidas do cruzamento entre Hartwig (genitor resistente e EMGOPA-316 (genitor suscetível em relação à resistência ao nematóide de cisto da soja - NCS (raça 1 e a estimação de parâmetros genéticos e de progressos de seleção como implicação no melhoramento de plantas. Os parâmetros envolveram o índice de fêmeas (IF obtido na avaliação de 176 linhagens F6 de soja quanto à resistência ao NCS. Avaliaram-se os genótipos quanto à resposta ao NCS em casa de vegetação e calcularam-se as médias dos IF dos genótipos avaliados. Posteriormente, foram realizadas a distribuição de freqüência e a análise de variância e, então, estimado o número de locos segregantes envolvidos na resistência das linhagens ao NCS (raça 1. Estimou-se o progresso de seleção (i = -2,154 entre as linhagens avaliadas (com diferentes números de repetições, bem como a herdabilidade em nível de média (h². Assim conclui-se que: a A distribuição de normalidade das médias dos IF, bem como a estimativa da herdabilidade e a estimativa do número de locos segregantes indicam que a resposta das linhagens ao NCS (raça 1 tem caráter de herança poligênica; b Foram encontradas linhagens promissoras para resistência ao NCS, porém, como este é de difícil avaliação recomenda-se utilizar maior número de linhagens F6 na avaliação fenotípica e maior número de repetições para avaliação da reação ao NCS; c A necessidade de se fazer correção para efeitos macroambientais aumentou o erro das estimativas.This study aimed at verify the behavior of Recombinant Inbreed Lines, resulting of a cross between Hartwig (resistant parental and EMGOPA-316 (susceptible parental to NCS soybean nematode (race 1 and to estimate genetic parameters and those of selection progress. Estimated parameters used the mean female index (IF
International Nuclear Information System (INIS)
Christen, Verena; Zucchi, Sara; Fent, Karl
2011-01-01
UV-filters are increasingly used in cosmetics and in the protection of materials against UV-irradiation, and ultimately they reach aquatic systems. The lipophilic UV-filter 2-ethyl-hexyl-4-trimethoxycinnamate (EHMC) belongs to one of the most frequently used UV-filters and accumulates in aquatic animals. Despite its ubiquitous presence in water and biota, very little is known about its potential hormonal effects on aquatic organisms. In our study, we evaluated the effects of measured water concentration of 5.4, 37.5, 244.5 and 394 μg/L EHMC on the expression of genes involved in hormonal pathways in the liver, testis and brain of male and female fathead minnows (Pimephales promelas). We compare the transcription profile with the plasma vitellogenin (VTG) content, secondary sex characteristics, and gonad histology. Transcripts of the androgen receptor (ar) were significantly down-regulated in the liver of females at 37.5, 244.5 μg/L and 394 μg/L EHMC. Additionally, the 3β-hydroxysteroid dehydrogenase (3β-HSD) transcript was significantly decreased in the liver of males at 37.5, 244.5 and 394 μg/L EHMC, and at 244.5 and 394 μg/L EHMC in females. The expressional changes were tissue-specific in most cases, being most significant in the liver. Vitellogenin plasma concentration was significantly increased at 244.5 μg/L EHMC in males. EHMC induced significant histological changes in testes and ovaries at 394 μg/L. Testes displayed a decrease in spermatocytes, and ovaries a decrease in previtellogenic oocytes. The induction of VTG plasma concentration and the histological changes in gonads suggest an estrogenic and/or antiandrogenic activity of EHMC. On the other hand, the gene expression profile shows an antiestrogenic (e.g.: down-regulation of esr1) activity of EHMC. In conclusion, our data demonstrate that EHMC displays low but multiple hormonal activities in fish.
Energy Technology Data Exchange (ETDEWEB)
Christen, Verena; Zucchi, Sara [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gruendenstrasse 40, CH-4132 Muttenz (Switzerland); Fent, Karl, E-mail: karl.fent@fhnw.ch [University of Applied Sciences Northwestern Switzerland, School of Life Sciences, Gruendenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology Zuerich (ETH Zuerich), Department of Environmental Sciences, 8092 Zuerich (Switzerland)
2011-04-15
UV-filters are increasingly used in cosmetics and in the protection of materials against UV-irradiation, and ultimately they reach aquatic systems. The lipophilic UV-filter 2-ethyl-hexyl-4-trimethoxycinnamate (EHMC) belongs to one of the most frequently used UV-filters and accumulates in aquatic animals. Despite its ubiquitous presence in water and biota, very little is known about its potential hormonal effects on aquatic organisms. In our study, we evaluated the effects of measured water concentration of 5.4, 37.5, 244.5 and 394 {mu}g/L EHMC on the expression of genes involved in hormonal pathways in the liver, testis and brain of male and female fathead minnows (Pimephales promelas). We compare the transcription profile with the plasma vitellogenin (VTG) content, secondary sex characteristics, and gonad histology. Transcripts of the androgen receptor (ar) were significantly down-regulated in the liver of females at 37.5, 244.5 {mu}g/L and 394 {mu}g/L EHMC. Additionally, the 3{beta}-hydroxysteroid dehydrogenase (3{beta}-HSD) transcript was significantly decreased in the liver of males at 37.5, 244.5 and 394 {mu}g/L EHMC, and at 244.5 and 394 {mu}g/L EHMC in females. The expressional changes were tissue-specific in most cases, being most significant in the liver. Vitellogenin plasma concentration was significantly increased at 244.5 {mu}g/L EHMC in males. EHMC induced significant histological changes in testes and ovaries at 394 {mu}g/L. Testes displayed a decrease in spermatocytes, and ovaries a decrease in previtellogenic oocytes. The induction of VTG plasma concentration and the histological changes in gonads suggest an estrogenic and/or antiandrogenic activity of EHMC. On the other hand, the gene expression profile shows an antiestrogenic (e.g.: down-regulation of esr1) activity of EHMC. In conclusion, our data demonstrate that EHMC displays low but multiple hormonal activities in fish.
Christen, Verena; Zucchi, Sara; Fent, Karl
2011-04-01
UV-filters are increasingly used in cosmetics and in the protection of materials against UV-irradiation, and ultimately they reach aquatic systems. The lipophilic UV-filter 2-ethyl-hexyl-4-trimethoxycinnamate (EHMC) belongs to one of the most frequently used UV-filters and accumulates in aquatic animals. Despite its ubiquitous presence in water and biota, very little is known about its potential hormonal effects on aquatic organisms. In our study, we evaluated the effects of measured water concentration of 5.4, 37.5, 244.5 and 394 μg/L EHMC on the expression of genes involved in hormonal pathways in the liver, testis and brain of male and female fathead minnows (Pimephales promelas). We compare the transcription profile with the plasma vitellogenin (VTG) content, secondary sex characteristics, and gonad histology. Transcripts of the androgen receptor (ar) were significantly down-regulated in the liver of females at 37.5, 244.5 μg/L and 394 μg/L EHMC. Additionally, the 3β-hydroxysteroid dehydrogenase (3β-HSD) transcript was significantly decreased in the liver of males at 37.5, 244.5 and 394 μg/L EHMC, and at 244.5 and 394 μg/L EHMC in females. The expressional changes were tissue-specific in most cases, being most significant in the liver. Vitellogenin plasma concentration was significantly increased at 244.5 μg/L EHMC in males. EHMC induced significant histological changes in testes and ovaries at 394 μg/L. Testes displayed a decrease in spermatocytes, and ovaries a decrease in previtellogenic oocytes. The induction of VTG plasma concentration and the histological changes in gonads suggest an estrogenic and/or antiandrogenic activity of EHMC. On the other hand, the gene expression profile shows an antiestrogenic (e.g.: down-regulation of esr1) activity of EHMC. In conclusion, our data demonstrate that EHMC displays low but multiple hormonal activities in fish. Copyright © 2011 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Afshan, A.; Jafri, S.R.A.; Maecke, H.
2004-01-01
Full text: A bifunctional ligand of PnAO-biotin has recently been synthesized, with a better percentage yield of 63% in the presence of newly developed coupling agent 0-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexaflorophos phate (HATU). Then lyophilized kit with 150μg of PnAObiotin has been developed and labeled with high specific activity of technetium-99m (2500-3000MBq) to get maximum radiochemical purity of 99mTc-PnAO-biotin complex i.e. > 97%. The association of avidin and streptavidin is among the strongest known non-covalent protein ligand interaction Ka 1015 M-1 and 1013 M-1 respectively. We measured the dissociation rate constant of PnAO-biotin from avidin and streptavidin challenged with excess of cold biotin. For the separation of bound and free-labeled biotin we employed ultrafilteration technique. The results of these experiments demonstrated that the non-covalent binding between 99mTc-PnAO-biotin with avidin and 99mTc-PnAO-biotin with streptavidin is more than 99%. Both biotin-binding proteins exhibited a faster initial phase and the rate of dissociation of 99mTc-PnAO-biotin with avidin is found to be 8.2x10-8 at 250C and 2.6x10-7 at 370C while the rate of dissociation 99mTc-PnAO-biotin from streptavidin is found to be 6x10-7 at 250C and 1.06x10-6 at 370C. The in-vitro study of the kinetics of dissociation exhibits the strong interaction of 99mTc-PnAO-biotin complex with both proteins, which suggests that this bifunctional PnAO-biotin ligand can be used for tumor localization with monoclonal antibodies to achieve high tumor to non-tumor ratio. (author)
Alexandre Ferreira Campos
2009-01-01
Objetivo: Conhecer o desempenho cognitivo, aos sete anos de idade, de crianças nascidas prematuras no Hospital das Clínicas da Universidade Federal de Minas Gerais (HC/UFMG), com idade gestacional até 34 semanas e peso ao nascimento inferior a 1500 gramas, adequado à idade gestacional. Essas crianças tiveram seguimento longitudinal interdisciplinar no Ambulatório da Criança de Risco (ACRIAR), e apresentavam inteligência e exame neurológico normais aos sete anos. Métodos: Participaram do estud...
In silico and in situ characterization of the zebrafish (Danio rerio gnrh3 (sGnRH gene
Directory of Open Access Journals (Sweden)
Husebye Harald
2002-08-01
Full Text Available Abstract Background Gonadotropin releasing hormone (GnRH is responsible for stimulation of gonadotropic hormone (GtH in the hypothalamus-pituitary-gonadal axis (HPG. The regulatory mechanisms responsible for brain specificity make the promoter attractive for in silico analysis and reporter gene studies in zebrafish (Danio rerio. Results We have characterized a zebrafish [Trp7, Leu8] or salmon (s GnRH variant, gnrh3. The gene includes a 1.6 Kb upstream regulatory region and displays the conserved structure of 4 exons and 3 introns, as seen in other species. An in silico defined enhancer at -976 in the zebrafish promoter, containing adjacent binding sites for Oct-1, CREB and Sp1, was predicted in 2 mammalian and 5 teleost GnRH promoters. Reporter gene studies confirmed the importance of this enhancer for cell specific expression in zebrafish. Interestingly the promoter of human GnRH-I, known as mammalian GnRH (mGnRH, was shown capable of driving cell specific reporter gene expression in transgenic zebrafish. Conclusions The characterized zebrafish Gnrh3 decapeptide exhibits complete homology to the Atlantic salmon (Salmo salar GnRH-III variant. In silico analysis of mammalian and teleost GnRH promoters revealed a conserved enhancer possessing binding sites for Oct-1, CREB and Sp1. Transgenic and transient reporter gene expression in zebrafish larvae, confirmed the importance of the in silico defined zebrafish enhancer at -976. The capability of the human GnRH-I promoter of directing cell specific reporter gene expression in zebrafish supports orthology between GnRH-I and GnRH-III.
Directory of Open Access Journals (Sweden)
Kerstin Bluhm
Full Text Available PURPOSE: Recently, a proof-of-concept study revealed the suitability of transcriptome analyses to obtain and assess changes in the abundance of transcripts in zebrafish (Danio rerio embryos after exposure to organic sediment extracts. The present study investigated changes in the transcript abundance in zebrafish embryos exposed to whole sediment samples and corresponding organic extracts in order to identify the impact of different exposure pathways on sediment toxicity. MATERIALS AND METHODS: Danio rerio embryos were exposed to sublethal concentrations of three sediment samples from the Danube River, Germany. The sediment samples were investigated both as freeze-dried samples and as organic extracts. Silica dust and a process control of the extraction procedure were used as references. After exposure, mRNA was isolated and changes in profiles of gene expression levels were examined by an oligonucleotide microarray. The microarray results were compared with bioassays, chemical analysis of the sediments and profiles of gene expression levels induced by several single substances. RESULTS AND DISCUSSION: The microarray approach elucidated significant changes in the abundance of transcripts in exposed zebrafish embryos compared to the references. Generally, results could be related to Ah-receptor-mediated effects as confirmed by bioassays and chemical analysis of dioxin-like contaminants, as well as to exposure to stress-inducing compounds. Furthermore, the results indicated that mixtures of chemicals, as present in sediment and extract samples, result in complex changes of gene expression level profiles difficult to compare with profiles induced by single chemical substances. Specifically, patterns of transcript abundances were less influenced by the chemical composition at the sampling site compared t the method of exposure (sediment/extract. This effect might be related to different bioavailability of chemicals. CONCLUSIONS: The apparent
ROBO-AO M DWARF MULTIPLICITY SURVEY
Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica
2018-01-01
We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.
Research on AO/FO batch management technology in aircraft production
Directory of Open Access Journals (Sweden)
Yin Haijun
2018-01-01
Full Text Available Based on the analysis of the characteristics and significance of AO/FO in the process of aircraft production, this paper analyzes the format rules of AO/FO batch management from the perspective of technology realization, and details the AO/FO The change of the query and the change status tracking, introduces the AO/FO single-stand status display in the batch management, increases the structure definition of the attribute table in the batch management, and designs the relevant algorithm to store and calculate the batch information. Finally, based on the above theory support AO/FO batch management system successfully used in the production of a machine.
Wang, Xiao H; Souders, Christopher L; Zhao, Yuan H; Martyniuk, Christopher J
2018-01-01
The dipyridyl herbicide paraquat induces oxidative stress in cells and is implicated in adult neurodegenerative diseases. However, less is known about paraquat toxicity in early stages of vertebrate development. To address this gap, zebrafish (Danio rerio) embryos were exposed to 1, 10 and 100 μM paraquat for 96 h. Paraquat did not induce significant mortality nor deformity in embryos and larvae, but it did accelerate time to hatch. To evaluate whether mitochondrial respiration was related to earlier hatch times, oxygen consumption rate was measured in whole embryos. Maximal respiration of embryos exposed to 100 μM paraquat for 24 h was reduced by more than 70%, suggesting that paraquat negatively impacts mitochondrial bioenergetics in early development. Based upon this evidence for mitochondrial dysfunction, transcriptional responses of oxidative stress- and apoptosis-related genes were measured. Fish exposed to 1 μM paraquat showed higher expression levels of superoxide dismutase 2, heat shock protein 70, Bcl-2-associated X protein, and B-cell CLL/lymphoma 2a compared to control fish. No differences among groups were detected in larvae exposed to 10 and 100 μM paraquat, suggesting a non-monotonic response. We also measured endpoints related to larval behavior and dopaminergic signaling as paraquat is associated with degeneration of dopamine neurons. Locomotor activity was stimulated with 100 μM paraquat and dopamine transporter and dopamine receptor 3 mRNA levels were increased in larvae exposed to 1 μM paraquat, interpreted to be a compensatory response at lower concentrations. This study improves mechanistic understanding into the toxic actions of paraquat on early developmental stages. Copyright © 2017 Elsevier Ltd. All rights reserved.
Zhang, Jiliang; Sun, Ping; Kong, Tao; Yang, Fan; Guan, Wenchao
2016-01-01
Endocrine disruptor effects of tributyltin (TBT) are well established in fish. However, the adverse effects on lipid metabolism are less well understood. Since the liver is the predominant site of de novo synthesis of lipids, the present study uses zebrafish (Danio rerio) to examine lipid accumulation in the livers and hepatic gene expression associated with lipid metabolism pathways. After exposure for 90 days, we found that the livers in fish exposed to TBT were yellowish in appearance and with accumulation of lipid droplet, which is consistent with the specific pathological features of steatosis. Molecular analysis revealed that TBT induced hepatic steatosis by increasing the gene expression associated with lipid transport, lipid storage, lipiogenic enzymes and lipiogenic factors in the livers. Moreover, TBT enhanced hepatic caspase-3 activity and up-regulated genes related to apoptosis and cell-death, which indicated steatotic livers of fish exposed to TBT and the subsequent liver damage were likely due to accelerated hepatocyte apoptosis or cell stress. In short, TBT can produce multiple and complex alterations in transcriptional activity of lipid metabolism and cell damage, which provides potential molecular evidence of TBT on hepatic steatosis. Copyright © 2015 Elsevier B.V. All rights reserved.
Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses
Directory of Open Access Journals (Sweden)
Restle João
2001-01-01
Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.
Noguchi, Yuji; Sano, Motoaki; Kanamaru, Kyoko; Ko, Taro; Takeuchi, Michio; Kato, Masashi; Kobayashi, Tetsuo
2009-11-01
XlnR is a Zn(II)2Cys6 transcriptional activator of xylanolytic and cellulolytic genes in Aspergillus. Overexpression of the aoxlnR gene in Aspergillus oryzae (A. oryzae xlnR gene) resulted in elevated xylanolytic and cellulolytic activities in the culture supernatant, in which nearly 40 secreted proteins were detected by two-dimensional electrophoresis. DNA microarray analysis to identify the transcriptional targets of AoXlnR led to the identification of 75 genes that showed more than fivefold increase in their expression in the AoXlnR overproducer than in the disruptant. Of these, 32 genes were predicted to encode a glycoside hydrolase, highlighting the biotechnological importance of AoXlnR in biomass degradation. The 75 genes included the genes previously identified as AoXlnR targets (xynF1, xynF3, xynG2, xylA, celA, celB, celC, and celD). Thirty-six genes were predicted to be extracellular, which was consistent with the number of proteins secreted, and 61 genes possessed putative XlnR-binding sites (5'-GGCTAA-3', 5'-GGCTAG-3', and 5'-GGCTGA-3') in their promoter regions. Functional annotation of the genes revealed that AoXlnR regulated the expression of hydrolytic genes for degradation of beta-1,4-xylan, arabinoxylan, cellulose, and xyloglucan and of catabolic genes for the conversion of D-xylose to xylulose-5-phosphate. In addition, genes encoding glucose-6-phosphate 1-dehydrogenase and L-arabinitol-4- dehydrogenase involved in D-glucose and L-arabinose catabolism also appeared to be targets of AoXlnR.
Como responder ao momento presente?
Directory of Open Access Journals (Sweden)
Maria Filomena Molder
2013-12-01
Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funcionários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Humanas, de outras Faculdades da Universidade Nova de Lisboa, de outras Universidades e todos os interessados em considerar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de Dezembro de 2012 se descrevia como um “processo de desmantelamento social, económico e cultural sem precedentes — pese embora tantas comparações, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publicada no blogue Responder ao Momento Presente, entretanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as participações de pessoas que corresponderam ao nosso apelo e ainda com contribuições que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agradecemos à autora por permitir a republicação neste número do Boletim. [N.E.
Pomerantz, Aaron F; Hoy, Marjorie A
2015-01-01
Characterization and expression analyses are essential to gain insight into sex-determination pathways in members of the Acari. Little is known about sex determination at the molecular level in the western orchard predatory mite Metaseiulus occidentalis (Arthropoda: Chelicerata: Arachnida: Acari: Phytoseiidae), a parahaploid species. In this study, eight genes previously identified as putative homologs to genes involved in the sex-determination pathway in Drosophila melanogaster were evaluated for sex-specific alternative splicing and sex-biased expression using reverse-transcriptase PCR and quantitative real-time PCR techniques, respectively. The homologs evaluated in M. occidentalis included two doublesex-like genes (Moccdsx1 and Moccdsx2), transformer-2 (Mocctra-2), intersex (Moccix), two fruitless-like genes (MoccBTB1 and MoccBTB2), as well as two vitellogenin-like genes (Moccvg1 and Moccvg2). Single transcripts of equal size were detected in males and females for Moccdsx1, Moccdsx2, Mocctra-2, Moccix, and MoccBTB2, suggesting that their pre-mRNAs do not undergo alternative splicing in a sex-specific manner. Three genes, Moccdsx1, Moccdsx2 and MoccBTB2, displayed male-biased expression relative to females. One gene, Moccix, displayed female-biased expression relative to males. Two genes, Mocctra-2 and MoccBTB1, did not display detectable differences in transcript abundance in males and females. Expression of Moccvg1 and Moccvg2 were detected in females only, and transcript levels were up-regulated in mated females relative to unmated females. To our knowledge, this represents the first attempt to elucidate expression patterns of putative sex-determination genes in an acarine. This study is an initial step towards understanding the sex-determination pathway in the parahaploid M. occidentalis.
OPERA, an automatic PSF reconstruction software for Shack-Hartmann AO systems: application to Altair
Jolissaint, Laurent; Veran, Jean-Pierre; Marino, Jose
2004-10-01
When doing high angular resolution imaging with adaptive optics (AO), it is of crucial importance to have an accurate knowledge of the point spread function associated with each observation. Applications are numerous: image contrast enhancement by deconvolution, improved photometry and astrometry, as well as real time AO performance evaluation. In this paper, we present our work on automatic PSF reconstruction based on control loop data, acquired simultaneously with the observation. This problem has already been solved for curvature AO systems. To adapt this method to another type of WFS, a specific analytical noise propagation model must be established. For the Shack-Hartmann WFS, we are able to derive a very accurate estimate of the noise on each slope measurement, based on the covariances of the WFS CCD pixel values in the corresponding sub-aperture. These covariances can be either derived off-line from telemetry data, or calculated by the AO computer during the acquisition. We present improved methods to determine 1) r0 from the DM drive commands, which includes an estimation of the outer scale L0 2) the contribution of the high spatial frequency component of the turbulent phase, which is not corrected by the AO system and is scaled by r0. This new method has been implemented in an IDL-based software called OPERA (Performance of Adaptive Optics). We have tested OPERA on Altair, the recently commissioned Gemini-North AO system, and present our preliminary results. We also summarize the AO data required to run OPERA on any other AO system.
NCBI nr-aa BLAST: CBRC-GACU-20-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-20-0000 emb|CAK04591.2| novel protein similar to vertebrate gamma-aminobu...tyric acid (GABA) B receptor, 2 (GABBR2) [Danio rerio] emb|CAN88500.1| novel protein similar to vertebrate g...amma-aminobutyric acid (GABA) B receptor, 2 (GABBR2) [Danio rerio] emb|CAN88045.1| novel protein similar to vertebrate...b|CAN88602.1| novel protein similar to vertebrate gamma-aminobutyric acid (GABA) B receptor, 2 (GABBR2) [Dan...io rerio] emb|CAK05338.2| novel protein similar to vertebrate gamma-aminobutyric acid (GABA) B receptor, 2 (GABBR2) [Danio rerio] CAK04591.2 1e-142 35% ...
Energy Technology Data Exchange (ETDEWEB)
Martyniuk, Christopher J. [Centre for Advanced Research in Environmental Genomics, 30 Marie Curie, Department of Biology, University of Ottawa, Ottawa, Ontario, K1N 6N5 (Canada); Gerrie, Emily R. [Centre for Advanced Research in Environmental Genomics, 30 Marie Curie, Department of Biology, University of Ottawa, Ottawa, Ontario, K1N 6N5 (Canada); Popesku, Jason T. [Centre for Advanced Research in Environmental Genomics, 30 Marie Curie, Department of Biology, University of Ottawa, Ottawa, Ontario, K1N 6N5 (Canada); Ekker, Marc [Centre for Advanced Research in Environmental Genomics, 30 Marie Curie, Department of Biology, University of Ottawa, Ottawa, Ontario, K1N 6N5 (Canada); Trudeau, Vance L. [Centre for Advanced Research in Environmental Genomics, 30 Marie Curie, Department of Biology, University of Ottawa, Ottawa, Ontario, K1N 6N5 (Canada)]. E-mail: trudeauv@uottawa.ca
2007-08-15
17alpha-ethinylestradiol (EE2) is detected in sewage effluent at concentrations that can disrupt normal reproductive function in fish. The objectives of this study were to identify novel genomic responses to EE2 exposure using microarray and real-time RT-PCR analysis in the liver and telencephalon of male zebrafish. Zebrafish were exposed to an environmentally relevant nominal concentration of 10 ng/L EE2 for a 21-day period. In the liver, common biomarkers for estrogenic exposure such as vitellogenin 1 and 3 (vtg1; vtg3), estrogen receptor alpha (esr1), and apolipoprotein A1 (apoA1) mRNA were identified by microarray analysis as being differentially regulated. Real-time RT-PCR confirmed that vtg1 was induced {approx}700-fold, vtg3 was induced {approx}100-fold and esr1 was induced {approx}20-fold. As determined by microarray analysis, ATPase Na+/K+ alpha 1a.4 (atp1a1a.4) and ATPase Na+/K+ beta 1a (atp1b1a) mRNA were down-regulated in the liver. Gene ontology (GO) analysis revealed that there were common biological processes and molecular functions regulated by EE2 in both tissues (e.g. electron transport and cell communication) but there were tissue specific changes in gene categories. For example, genes involved in protein metabolism, carbohydrate metabolism were down-regulated in the liver but were induced in the telencephalon. This study demonstrates that (1) tissues exhibit different gene responses to low EE2 exposure; (2) there are pronounced genomic effects in the liver and (3) multi-tissue gene profiling is needed to improve understanding of the effects of human pharmaceuticals on aquatic organisms.
SCExAO: First Results and On-Sky Performance
Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki
2013-01-01
We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.
Directory of Open Access Journals (Sweden)
Warren W Burggren
2012-02-01
Full Text Available Swimming stamina in adult fish is heritable, it is unknown if inherited traits that support enhanced swimming stamina in offspring appear only in juveniles and/or adults, or if these traits actually appear earlier in the morphologically quite different larvae. To answer this question, mature adult zebrafish (Danio rerio were subjected to a swimming performance test that allowed separation into low swimming stamina or high swimming stamina groups. Adults were then bred within their own performance groups. Larval offspring from each of the two groups, designated high (LHSD and low stamina-derived larvae (LLSD, were then reared at 27°C in aerated water (21% O2. Routine (fH,r and active (fH,a heart rate, and routine (M.O2,r and active (M.O2,a mass-specific oxygen consumption were recorded from 5 days post fertilization (dpf through 21 dpf, and gross cost of transport and factorial aerobic metabolic scope were derived from M.O2 measurements. Heart rate generally ranged between 150 and 225 b•min-1 in both LHSD and LLSD populations. However, significant (P<0.05 differences existed between the LLSD and LHSD populations at 5 and 14 dpf in fH,r and at days 10 and 15 dpf in fH,a. M.O2,r was 0.04 to 0.32 μmol•mg-1•hr-1, while M.O2,a was 0.2 to 1.2 μmol•mg-1•hr-1. Significant (P<0.05 differences between the LLSD and LHSD populations in M.O2,r occurred at 7, 10 and 21 dpf and in M.O2,a at 7 dpf. Gross cost of transport was ~6-10 µmol O2 . µg-1 . m-1 at 5 dpf, peaking at 14-19 µmol O2 . µg-1 . m-1 at 7-10 dpf, before falling again to 5-6 µmol O2 . µg-1 . m-1 at 21 dpf, with gross cost of transport significantly higher in the LLSD population at 7 dpf. Collectively, these data indicate that inherited physiological differences contributing to enhanced stamina in adult parents appear in their larval offspring well before attainment of juvenile or adult features.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
Using the vitellogenin levels in male fishes as a parameter of pollution caused by internal secretion disturbing substances would allow collective measurement of compounding action of pollutants, acquisition of time averaged values, and large reduction in analysis cost. The present research and development works are intended to put such technological seeds into practical use, and promote its proliferation. The following subjects were implemented: (1) fabrication of effective anti-bodies, (2) their application to fresh water fishes, salmon, and trout, (3) their application to sea water fishes, (4) effects on mummichog and medaka, (5) correlation between spawning actions and vitellogenin manifestation in male fish, (6) discussions on chemical analysis methods and the correlativity therewith, and (7) establishment of methods for field investigation and evaluation. In Item (1), an ELISA system using vitellogenin anti-bodies of different fishes was established. A universal anti-body reacting commonly to all of fish vitellogenins was developed. In Items (2), (3) and (4), an evaluation system was established on actions of internal secretion disturbing substances on sea water fish and fresh water fish by using fish vitellogenins. In Item (5), effects on spawning of medaka, and effects on procreation activities (sterility) were evaluated by using vitellogenin. (NEDO)
Hanisch, Karen; Küster, Eberhard; Altenburger, Rolf; Gündel, Ulrike
2010-01-01
Studies using embryos of the zebrafish Danio rerio (DarT) instead of adult fish for characterising the (eco-) toxic potential of chemicals have been proposed as animal replacing methods. Effect analysis at the molecular level might enhance sensitivity, specificity, and predictive value of the embryonal studies. The present paper aimed to test the potential of toxicoproteomics with zebrafish eleutheroembryos for sensitive and specific toxicity assessment. 2-DE-based toxicoproteomics was performed applying low-dose (EC(10)) exposure for 48 h with three-model substances Rotenone, 4,6-dinitro-o-cresol (DNOC) and Diclofenac. By multivariate "pattern-only" PCA and univariate statistical analyses, alterations in the embryonal proteome were detectable in nonetheless visibly intact organisms and treatment with the three substances was distinguishable at the molecular level. Toxicoproteomics enabled the enhancement of sensitivity and specificity of the embryonal toxicity assay and bear the potency to identify protein markers serving as general stress markers and early diagnosis of toxic stress.
Assessing the toxicity of Pb- and Sn-based perovskite solar cells in model organism Danio rerio
Babayigit, Aslihan; Duy Thanh, Dinh; Ethirajan, Anitha; Manca, Jean; Muller, Marc; Boyen, Hans-Gerd; Conings, Bert
2016-01-01
Intensive development of organometal halide perovskite solar cells has lead to a dramatic surge in power conversion efficiency up to 20%. Unfortunately, the most efficient perovskite solar cells all contain lead (Pb), which is an unsettling flaw that leads to severe environmental concerns and is therefore a stumbling block envisioning their large-scale application. Aiming for the retention of favorable electro-optical properties, tin (Sn) has been considered the most likely substitute. Preliminary studies have however shown that Sn-based perovskites are highly unstable and, moreover, Sn is also enlisted as a harmful chemical, with similar concerns regarding environment and health. To bring more clarity into the appropriateness of both metals in perovskite solar cells, we provide a case study with systematic comparison regarding the environmental impact of Pb- and Sn-based perovskites, using zebrafish (Danio Rerio) as model organism. Uncovering an unexpected route of intoxication in the form of acidification, it is shown that Sn based perovskite may not be the ideal Pb surrogate.
Assessing the toxicity of Pb- and Sn-based perovskite solar cells in model organism Danio rerio
Babayigit, Aslihan; Duy Thanh, Dinh; Ethirajan, Anitha; Manca, Jean; Muller, Marc; Boyen, Hans-Gerd; Conings, Bert
2016-01-01
Intensive development of organometal halide perovskite solar cells has lead to a dramatic surge in power conversion efficiency up to 20%. Unfortunately, the most efficient perovskite solar cells all contain lead (Pb), which is an unsettling flaw that leads to severe environmental concerns and is therefore a stumbling block envisioning their large-scale application. Aiming for the retention of favorable electro-optical properties, tin (Sn) has been considered the most likely substitute. Preliminary studies have however shown that Sn-based perovskites are highly unstable and, moreover, Sn is also enlisted as a harmful chemical, with similar concerns regarding environment and health. To bring more clarity into the appropriateness of both metals in perovskite solar cells, we provide a case study with systematic comparison regarding the environmental impact of Pb- and Sn-based perovskites, using zebrafish (Danio Rerio) as model organism. Uncovering an unexpected route of intoxication in the form of acidification, it is shown that Sn based perovskite may not be the ideal Pb surrogate. PMID:26759068
NCBI nr-aa BLAST: CBRC-GACU-10-0020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-10-0020 ref|NP_899188.1| progestin and adipoQ receptor family member VII ...[Danio rerio] ref|XP_001340911.1| PREDICTED: similar to membrane progestin receptor alpha [Danio rerio] sp|Q...801G2|MPRA_BRARE Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ receptor family member ...VII) gb|AAN78115.1| membrane progestin receptor alpha [Danio rerio] NP_899188.1 1e-106 55% ...
NCBI nr-aa BLAST: CBRC-GACU-20-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-20-0015 ref|NP_899188.1| progestin and adipoQ receptor family member VII ...[Danio rerio] ref|XP_001340911.1| PREDICTED: similar to membrane progestin receptor alpha [Danio rerio] sp|Q...801G2|MPRA_BRARE Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ receptor family member ...VII) gb|AAN78115.1| membrane progestin receptor alpha [Danio rerio] NP_899188.1 1e-164 76% ...
NCBI nr-aa BLAST: CBRC-DRER-19-0033 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-19-0033 ref|NP_899188.1| progestin and adipoQ receptor family member VII ...[Danio rerio] ref|XP_001340911.1| PREDICTED: similar to membrane progestin receptor alpha [Danio rerio] sp|Q...801G2|MPRA_BRARE Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ receptor family member ...VII) gb|AAN78115.1| membrane progestin receptor alpha [Danio rerio] NP_899188.1 1e-100 51% ...
NCBI nr-aa BLAST: CBRC-OLAT-26-0024 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-26-0024 ref|NP_899188.1| progestin and adipoQ receptor family member VII ...[Danio rerio] ref|XP_001340911.1| PREDICTED: similar to membrane progestin receptor alpha [Danio rerio] sp|Q...801G2|MPRA_BRARE Membrane progestin receptor alpha (mPR alpha) (Progestin and adipoQ receptor family member ...VII) gb|AAN78115.1| membrane progestin receptor alpha [Danio rerio] NP_899188.1 1e-167 79% ...
Functional analysis of AoAtg11 in selective autophagy in the filamentous fungus Aspergillus oryzae.
Tadokoro, Takayuki; Kikuma, Takashi; Kitamoto, Katsuhiko
2015-07-01
Autophagy is a highly conserved cellular degradation process in eukaryotes and consists of both non-selective and selective types. Selective autophagic processes include pexophagy, mitophagy, and the cytoplasm-to-vacuole targeting (Cvt) pathway of yeast, in which particular vacuolar proteins, such as aminopeptidase I (Ape1), are selectively transported to vacuoles. Although selective autophagy has been mainly studied in the yeasts Saccharomyces cerevisiae and Pichia pastoris, there is evidence for selective autophagy in filamentous fungi; however, the details are poorly understood. In S. cerevisiae, Atg11 is a selective autophagy-specific protein that recognizes and transports substrates to the pre-autophagosomal structure (PAS). Here, we first identified an ATG11 homologue in the filamentous fungus Aspergillus oryzae and analyzed the localization of the corresponding protein, designated AoAtg11, fused to enhanced green fluorescent protein (EGFP). Imaging analysis revealed that AoAtg11-EGFP was localized to PAS-like structures. We next constructed an Aoatg11 disruptant of A. oryzae and showed that AoAtg11 is involved in pexophagy and mitophagy. In addition, AoAtg11 was found to be dispensable for non-selective autophagy and for transporting AoApe1 to vacuoles. Taken together, these results suggest that AoAtg11 is a selective autophagy-specific protein in A. oryzae, and has distinct molecular functions from that of S. cerevisiae Atg11. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.
Nefrocalcinose associada ao uso de esteroide anabolizante
Directory of Open Access Journals (Sweden)
Weverton Machado Luchi
2015-03-01
Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.
Chu-Koo, F; Dugué, R; Alván Aguilar, M; Casanova Daza, A; Alcántara Bocanegra, F; Chávez Veintemilla, C; Duponchelle, F; Renno, J-F; Tello, Salvador; Nuñez, J
2009-03-01
Arapaima gigas is an air-breathing giant fish of Amazonian rivers. Given its great economic and cultural importance, the aquaculture development of this species represents an evident solution to face the decline of wild populations. In captivity, reproduction occurs generally in large earthen ponds where stocks of a few tens of brooders are maintained together at the beginning of the rainy season (December-March in the Peruvian Amazon). Fry production relies on the spontaneous formation of male and female pairs, which build a nest, delimit a territory and guard the offspring for at least 20 days from other congeners and predators. However, as sex determination of A. gigas is not possible by morphological criteria, it is very difficult to optimize reproduction conditions and fry production in each pond, which seriously hampers the culture of this species. This situation prompted us to develop sexing methodologies based on (1) the detection of female specific plasma Vitellogenin (Vtg) using an enzyme immuno assay (EIA), and (2) the determination of plasma 17beta-estradiol and 11-ketotestosterone levels for immature specimens. The Vtg purification was performed by electro-elution after polyacrilamide gel electrophoresis (PAGE) from plasma of 17beta-estradiol treated A. gigas juveniles. Two different Vtg molecules were isolated, (Vtg(1) and Vtg(2)) with 184 and 112 kDa apparent molecular masses, respectively, and two antibodies were raised in rabbits for each Vtg molecule. Adult fish were 100% accurately sexed by Vtg EIA, while 100% of immature fish and 95% of adults were accurately sexed by 17beta-Estradiol and 11-Ketestosterone ratios. We also observed different color pattern development in male and female adult fish (6-year-olds) around the reproductive period.
Park, Kiyun; Kwak, Inn-Sil
2012-12-01
The objective of this study was conducted to identify the possibility of using Chironomus metallothionein (MT) and vitellogenin (VTG) as biomarkers of stress caused by endocrinedisrupting chemicals (EDCs), heavy metals, herbicides and veterinary antibiotics. We characterized the MT and VTG cDNA in Chironomus riparius and evaluated their mRNA expression profiles following exposure to different environmental pollutants. The gene expression analysis showed that the MT mRNA levels increased significantly after long-term exposure to cadmium (Cd), copper (Cu), Lead (Pb), di(2-ethylhexyl) phthalate (DEHP), and 2,4-dichlorophenoxyacetic acid (2,4-D). Moreover, the VTG mRNA expression increased significantly in C. riparius larvae exposed to BPA, NP, DEHP, Cd, 2,4-D and fenbendazole. Evaluation of the long-term effects of environmental pollutants revealed up regulation of Chironomus MT mRNA in response to DEHP exposure among EDCs, and the level of the VTG mRNA was increased significantly following treatment with Cd and herbicide 2,4-D at all concentrations in a dose-dependent manner. These results indicate that VTG could be used as a potential biomarker of herbicide and Cd as well as EDCs, while MT was a potential biomarker of heavy metals such as Cd, Cu, and Pb in aquatic environments.
DEFF Research Database (Denmark)
Kristensen, T.; Edwards, T. M.; Kohno, S.
2007-01-01
Previous studies of Eastern mosquitofish in contaminated Lake Apopka, Florida, have documented reduced sperm count and sexual behaviour in males but increased fecundity and liver weight in females, compared to nearby reference lakes. Liver weight can be an indicator of vitellogenin (Vtg) synthesis...... in fish, such as the mosquitofish. It was therefore hypothesized that estrogenic organochlorine pesticides, present at elevated concentrations in animals from Lake Apopka, could cause the reproductive disorders in males, as well as increase female fecundity. We initiated a test of this hypothesis...... by examining the relationship between 17β-estradiol (E2) tissue concentrations, hepatic estrogen receptor α (ERα) and Vtg A, B and C gene expression and fecundity in sexually mature female Eastern mosquitofish from Lake Apopka and two reference lakes, Lake Woodruff and Lake Orange. We observed that female...
Directory of Open Access Journals (Sweden)
Maria Eugênia Farias Almeida Motta
2005-10-01
Full Text Available OBJETIVO: Analisar a associação entre o baixo peso ao nascer e o estado nutricional ao final do primeiro ano de vida. MÉTODOS: Foi realizado estudo caso-controle aninhado a uma coorte em quatro municípios da Zona da Mata Meridional de Pernambuco. Os recém-nascidos foram recrutados para a coorte nas primeiras 24 horas de vida, sendo o peso aferido ao nascimento e ao final do primeiro ano de vida. Durante o primeiro ano de vida, foram realizadas duas visitas domiciliares semanais para confirmar aleitamento materno predominante e ocorrência de episódios diarréicos. Considerou-se caso (risco nutricional a criança com índice peso/idade abaixo do percentil 10 (n = 117; e controle aquela com percentil igual ou maior que 10 (n = 411. Realizou-se análise de regressão logística hierarquizada para detectar os fatores determinantes do estado nutricional no primeiro ano de vida. RESULTADOS: Os fatores que explicaram o risco nutricional ao final do primeiro ano de vida foram peso ao nascer e ausência de sanitário no domicílio. As crianças que nasceram com peso entre 1.500 g e 2.499 g tiveram uma chance 29 vezes maior (IC 95% = 9,77-87,49 de apresentar risco nutricional aos 12 meses de idade em relação àquelas com peso de nascimento maior que 3.500 g. Nas que residiam em domicílio sem sanitário, a chance foi três vezes maior (IC 95% = 1,54-6,22 em relação àquelas com sanitário com descarga no domicílio. CONCLUSÃO: O baixo peso ao nascer é um dos principais fatores responsáveis pelo risco nutricional ao final do primeiro ano de vida, sendo imprescindível adotar estratégias para sua redução e prevenção.OBJECTIVE: To evaluate the association between low birth weight and nutritional status at the end of the first year of life. METHODS: This was a nested case-control study within a cohort. The study was carried out at maternity hospitals in four cities in the Zona da Mata Meridional in Pernambuco state, Brazil. Newborn infants
Hipometilação do LINE-1 está Associada ao Risco de Doença Cardíaca Coronariana na População Chinesa
Directory of Open Access Journals (Sweden)
Li Wei
2014-06-01
Full Text Available Fundamentos: O nível de metilação global do ADN de leucócitos no sangue tem sido associado ao risco de doença arterial coronariana (DAC, com resultados inconsistentes em diferentes populações. Faltam dados semelhantes da população chinesa, onde diferentes fatores genéticos, de estilo de vida e ambientais podem afetar a metilação do ADN e sua relação com o risco de DCC. Objetivos: Analisar se a metilação global está associada ao risco de doença coronariana na população chinesa. Métodos: Foram incluídos um total de 334 casos de DCC e 788 controles saudáveis. A metilação global do ADN de leucócitos de sangue foi estimada por meio da análise das repetições do LINE-1 usando pirosequenciamento de bissulfito. Resultados: Em uma análise inicial restrita aos controles o nível do LINE-1 diminui significativamente com a idade avançada, colesterol total elevado, e diagnóstico de diabetes. Na análise de caso-controle, a redução da metilação do LINE-1 foi associada ao aumento do risco de DCC, tendo a análise por quartil revelado uma odds ratio (IC 95% de 0,9 (0,6-1,4, 1,9 (1,3-2,9 e 2,3 (1,6 3.5 para o terceiro, segundo e primeiro (o mais baixo quartil (P da tendência < 0,001, respectivamente, em comparação com o quarto (o mais alto quartil. A metilação inferior (< mediana do LINE-1 esteve associada a 2,2 vezes (IC 95% = 1,7-3,0 o aumento de risco de doença coronariana. As estimativas de risco de DCC menores relacionadas com o LINE-1 tenderam a ser mais fortes entre os indivíduos com maior tercil de homocisteína (P interação = 0,042 e naqueles com diagnóstico de hipertensão arterial (P interação = 0,012. Conclusão: A hipometilação do LINE-1 está associada ao risco de doença coronariana na população chinesa. Fatores de risco de DCC potenciais tais como a idade avançada, colesterol total elevado, e diagnóstico de diabetes podem ter impacto na metilação global do ADN, exercendo, portanto, o seu
Li, Qian; Chen, Ling; Liu, Li; Wu, Lingling
2016-03-01
Sediments function both as a sink and a source of pollutants in aquatic ecosystems and may impose serious effects on benthic organisms and human health. As one of the largest estuaries in the world, the Yangtze River estuary suffers from abundant wastewater from the coastal cities. In this study, the zebrafish (Danio rerio) embryos were employed in the fish embryo test and a comet assay to evaluate the embryotoxicity and genotoxicity of the sediments from the Yangtze River estuary, respectively. Results showed that the sediments from the Yangtze River estuary significantly increased mortality, induced development abnormalities, and reduced hatching rate and heart rate of zebrafish embryos after 96 h of exposure. Significant genotoxicity was observed in the samples relative to the controls. Relatively low-level embryotoxicity and genotoxicity of sediments were found in the Yangtze River compared with other river systems. Toxic responses were also discussed in relation to the analyzed organic contaminants in sediments. More attention should be paid to non-priority pollutant monitoring in the Yangtze River estuary.
NCBI nr-aa BLAST: CBRC-TNIG-21-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-21-0000 emb|CAK04591.2| novel protein similar to vertebrate gamma-aminobu...tyric acid (GABA) B receptor, 2 (GABBR2) [Danio rerio] emb|CAN88500.1| novel protein similar to vertebrate g...amma-aminobutyric acid (GABA) B receptor, 2 (GABBR2) [Danio rerio] emb|CAN88045.1| novel protein similar to vertebrate...b|CAN88602.1| novel protein similar to vertebrate gamma-aminobutyric acid (GABA) B receptor, 2 (GABBR2) [Dan...io rerio] emb|CAK05338.2| novel protein similar to vertebrate gamma-aminobutyric acid (GABA) B receptor, 2 (GABBR2) [Danio rerio] CAK04591.2 0.0 92% ...
Directory of Open Access Journals (Sweden)
Carlos Scotto
2013-09-01
Full Text Available In this paper the transgenic fluorescent red, orange and pink zebra fish (Danio rerio, found in local aquariums in Peru, were identified using the PCR technique to amplify the transgene RFP sea anemone belonging to Discosoma spp. The gene expression of the red fluorescent protein (RFP transgene was found to determine different gradients-of-bioluminescence (shades in color in each GMO fish analyzed. We performed sequence analysis of the two variants of the RFP along with six variants of the existing fluorescent protein GFP from the Genbank, this could help identify quickly if they are new genes or variants thereof as these novel fluorescent proteins may be introduced in aquatic GMO in the future. Thus, developing and improving biosecurity measures through its timely detection at the molecular genetic level.
El pez cebra (Danio Rerio como modelo animal de sueño: Nadando en una nueva dirección
Directory of Open Access Journals (Sweden)
Carlos del Río-Bermúdez
2013-01-01
Full Text Available A pesar de los esfuerzos por comprender los mecanismos fisiológicos y funciones del sueño, el por qué pasamos más de un tercio de nuestra vida durmiendo sigue siendo uno de los grandes misterios de la neurociencia actual. Sin embargo, el uso de nuevos modelos animales simples está generando novedosos e importantes resultados sobre aspectos genéticos, fisiológicos y conductuales del sueño. El pez cebra (Danio rerio constituye un modelo idóneo para el análisis del sueño a nivel sistémico y molecular, y sus características fisiológicas permiten la extrapolación de estos hallazgos a especies filogenéticamente superiores, como el ser humano.
Yang, Congwen; Lin, Ying; Shen, Guanwang; Chen, Enxiang; Wang, Yanxia; Luo, Juan; Zhang, Haiyan; Xing, Runmiao; Xia, Qingyou
2014-10-10
Female qualities in males are common in vertebrates but have not been extensively reported in insects. Vitellogenin (Vg) is highly expressed in the female fat body and is generally required for the formation of yolk proteins in the insect egg. Vg upregulation is generally regarded as a female quality in female oviparous animals. In this study, we found that Bombyx mori Vg (BmVg) is especially highly expressed in the female pupa. Downregulation of the BmVg gene in the female pupa by RNA interference (RNAi) interfered with egg formation and embryonic development, showing the importance of BmVg in these processes. So, we used BmVg as a biomarker for female qualities in the silkworm. Hematoxylin-eosin staining and immunofluorescence histochemistry showed that ovary transplants induced BmVg synthesis in the male pupa fat body. Ovaries transplanted into male silkworms produced only a few eggs with deformed yolk granules. These results suggested that the amount of BmVg in the male silkworm was insufficient for eggs to undergo complete embryonic development. After 17-beta-estradiol was used to treat male pupae and male pupal fat bodies, BmVg was upregulated in vivo and in vitro. These findings indicated that the male silkworm has innate female qualities that were induced by a transplanted ovary and 17β-estradiol. However, in silkworms, female qualities in males are not as complete as in females. Copyright © 2014 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Simone Seixas da Cruz
2005-10-01
Full Text Available OBJETIVO: Estudos recentes têm apresentado evidências de que a doença periodontal em gestantes pode ser um dos determinantes do baixo peso ao nascer. Realizou-se estudo para verificar a existência de associação entre doença periodontal materna e baixo peso ao nascer. MÉTODOS: Estudo do tipo caso-controle com 302 mulheres, sendo 102 mães de nascidos vivos de baixo peso (grupo caso e 200 mães de nascidos vivos com peso normal (grupo controle. A existência de associação entre doença periodontal e baixo peso ao nascer foi avaliada mediante modelo multivariado de regressão logística, considerando outros fatores de risco para o baixo peso. RESULTADOS: Ambos os grupos de mães eram comparáveis no que se refere a idade, altura, peso pré-gestacional, tabagismo, alcoolismo, doenças prévias, estado civil, situação socioeconômica, número de escovações e uso de fio dental, número de refeições diárias, e visitas ao dentista. A doença periodontal foi diagnosticada em 57,8% das mães do grupo caso e 39,0% do grupo controle. A análise de regressão logística indicou associação positiva entre doença periodontal e baixo peso ao nascer (ORbruto=2,15; IC 95%: 1,32-3,48, especialmente entre as mães com escolaridade menor ou igual a quatro anos (ORajustada=3,98; IC 95%: 1,58-10,10. CONCLUSÕES: A doença periodontal é um possível fator de risco para o baixo peso ao nascer.OBJECTIVE: Recent studies have presented evidence that periodontal disease in pregnant women may be a determining factor for low birth weight. The present investigation was carried out to verify whether or not there is an association between maternal periodontal disease and low birth weight. METHODS: This was a case-control study on 302 women, of whom 102 were the mothers of live newborns of low weight (case group and 200 were the mothers of live newborns of normal birth weight (control group. The existence of an association between periodontal disease and low
Directory of Open Access Journals (Sweden)
Leonardo Vieira Wandelli
2016-12-01
Full Text Available Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas como necessidade radical, tendente à transformação da institucionalidade vigente, mas também como direito positivado em um amplo leque de normas internacionais e nacionais, que contempla diversas dimensões normativas atualmente exigíveis. Propõe-se que, no centro desse direito, está um direito fundamental ao conteúdo do próprio trabalho, que determina juridicamente as condições da atividade e da organização do trabalho. Recente estudo adotado pelo Alto Comissariado em Direitos Humanos da Organização das Nações Unidas (ONU sobre o direito ao trabalho reforça essa compreensão. Palavras-chave: Direitos humanos. Direitos fundamentais. Direito ao trabalho. Psicodinâmica do trabalho. Direito do trabalho.
Busquet, François; Nagel, Roland; von Landenberg, Friedrich; Mueller, Stefan O; Huebler, Nicole; Broschard, Thomas H
2008-07-01
The assessment of teratogenic effects of chemicals is generally performed using in vivo teratogenicity assays, for example, in rats or rabbits. We have developed an in vitro teratogenicity assay using the zebrafish Danio rerio embryo combined with an exogenous mammalian metabolic activation system (MAS), able to biotransform proteratogenic compounds. Cyclophosphamide (CPA) and ethanol were used as proteratogens to test the efficiency of this assay. Briefly, the zebrafish embryos were cocultured at 2 hpf (hours postfertilization) with the test material at varying concentrations, induced male rat liver microsomes and nicotinamide adenine dinucleotide phosphate (reduced) for 60 min at 32 degrees C under moderate agitation in Tris-buffer. The negative control (test material alone) and the MAS control (MAS alone) were incubated in parallel. For each test group, 20 eggs were used for statistical robustness. Afterward fish embryos were transferred individually into 24-well plates filled with fish medium for 48 h at 26 degrees C with a 12-h light cycle. Teratogenicity was scored after 24 and 48 hpf using morphological endpoints. No teratogenic effects were observed in fish embryos exposed to the proteratogens alone, that is, without metabolic activation. In contrast, CPA and ethanol induced abnormalities in fish embryos when coincubated with microsomes. The severity of malformations increased with increasing concentrations of the proteratogens. We conclude that the application of microsomes will improve and refine the D. rerio teratogenicity assay as a predictive and valuable alternative method to screen teratogenic substances.
Directory of Open Access Journals (Sweden)
Juan Manuel Yañez Arauz
2015-05-01
Full Text Available Introducción Las fracturas distales de tibia son un desafío para el tratamiento debido a la escasa cobertura y particular vascularización. Los objetivos del presente estudio son analizar los resultados clínicos y funcionales de los pacientes con fractura de tibia distal; tratados con técnica MIPO (minimally invasive plate osteosynthesis con placas bloqueadas; comparar los resultados del grupo de fracturas tipo AO 43A con las tipo AO 43C1-C2; y comparar los resultados MIPO con el tratamiento abierto convencional. Material y métodos Entre 2004 y 2012, se evaluaron 32 fracturas de tibia distal tratadas con técnica MIPO. 20 varones y 12 mujeres. Edad promedio: 40,1 años. El 59,4% presentó fracturas tipo AO 43A; y el 40,6% AO 43C. Tiempo trauma/cirugía: 6,8 días promedio. 24 casos presentaron fractura de peroné. Estadía hospitalaria: 1,5 días promedio. Seguimiento promedio: 39,6 meses, mediante score AOFAS y radiología. Se consignaron complicaciones. Se compararon resultados de grupos tipo AO A y los tipo AO C. Resultados Incremento del score AOFAS entre pre y post-operatorio: 73,3 puntos promedio. El grupo AO tipo A: media de 95,89 puntos AOFAS PO. El grupo AO tipo C1-2: media de 92,15 puntos PO. Carga del peso corporal: a las 8,7 semanas promedio. Comparando A= 43A y AO 43C: p: 0,46 (no significativa. Retorno a actividad previa a la lesión:9.3 meses promedio. Comparando tipo A y tipo C: p=0,16 (no significativa. Hubo 18,75% de complicaciones y retiro de osteosíntesis en 14 casos. Conclusiones La osteosíntesis mínimamente invasiva con placa y tornillos, es una buena opción para las fracturas de tibia distal; con buena evolución clínico-funcional, y escasas complicaciones comparadas a la cirugía abierta. Las fracturas 43A presentan menos complicaciones mayores que las 43C, tratadas con técnica MIPO.
Expression of RPRM/rprm in the Olfactory System of Embryonic Zebrafish (Danio rerio)
Stanic, Karen; Quiroz, Alonso; Lemus, Carmen G.; Wichmann, Ignacio A.; Corvalán, Alejandro H.; Owen, Gareth I.; Opazo, Juan C.; Concha, Miguel L.; Amigo, Julio D.
2018-01-01
The Reprimo (RPRM) family is composed of highly conserved single-exon genes. The expression pattern of this gene family has been recently described during zebrafish (Danio rerio) embryogenesis, and primarily locates in the nervous system. Its most characterized member, RPRM, which duplicated to give rise rprma and rprmb in the fish lineage, is known to act as a tumor-suppressor gene in mammalian models. Here, we describe in detail the spatiotemporal expression of three rprm genes (rprma, rprmb, and rprml) within distinct anatomical structures in the developing peripheral and central nervous system. In the zebrafish, rprma mRNA is expressed in the olfactory placodes (OP) and olfactory epithelium (OE), rprmb is observed in the tectum opticum (TeO) and trigeminal ganglion (Tg), whereas rprml is found primarily in the telencephalon (Tel). At protein level, RPRM is present in a subset of cells in the OP, and neurons in the OE, TeO, hindbrain and sensory peripheral structures. Most importantly, the expression of RPRM has been conserved between teleosts and mammals. Thus, we provide a reference dataset describing the expression patterns of RPRM gene products during zebrafish and mouse development as a first step to approach the physiological role of the RPRM gene family. PMID:29636669
Expression of RPRM/rprm in the Olfactory System of Embryonic Zebrafish (Danio rerio
Directory of Open Access Journals (Sweden)
Karen Stanic
2018-03-01
Full Text Available The Reprimo (RPRM family is composed of highly conserved single-exon genes. The expression pattern of this gene family has been recently described during zebrafish (Danio rerio embryogenesis, and primarily locates in the nervous system. Its most characterized member, RPRM, which duplicated to give rise rprma and rprmb in the fish lineage, is known to act as a tumor-suppressor gene in mammalian models. Here, we describe in detail the spatiotemporal expression of three rprm genes (rprma, rprmb, and rprml within distinct anatomical structures in the developing peripheral and central nervous system. In the zebrafish, rprma mRNA is expressed in the olfactory placodes (OP and olfactory epithelium (OE, rprmb is observed in the tectum opticum (TeO and trigeminal ganglion (Tg, whereas rprml is found primarily in the telencephalon (Tel. At protein level, RPRM is present in a subset of cells in the OP, and neurons in the OE, TeO, hindbrain and sensory peripheral structures. Most importantly, the expression of RPRM has been conserved between teleosts and mammals. Thus, we provide a reference dataset describing the expression patterns of RPRM gene products during zebrafish and mouse development as a first step to approach the physiological role of the RPRM gene family.
Control rod drop accident analysis for the mixed core project in Ling Ao NPS
International Nuclear Information System (INIS)
Zhang Shishun; Zhou Zhou; Xiao Min
2004-01-01
AFA-2G assemblies in Ling Ao NPS (LNPS) have been replaced gradually by AFA-3G assemblies from cycle 2 and subsequent cycles. the enrichment of the fuels will be increased from 3.2% to 3.7% from cycle 3 in Ling Ao. Therefore, the study of ling Ao mixed core and increased enrichment have been performed since 2001. Lots of accidents need to be re-analyzed in Ling Ao NPS in order to verify its safety requirements for the new fuel management. Control rod drop accident for LNPS was re-analyzed in 2001 in frame of FRAMATOME ANP analytical methodology. The analytical codes used in the accident analysis include SCIENCE, ESPADON, CINEMA, CANTAL and FLICA III. The control rod drop accident analysis is performed with respect to the 10 reference cycles of the generic fuel management design for Ling Ao mixed core and increased enrichment study. The pre-drop FδH for the first transition cycles and other cycles are 1.52 and 1.55, respectively. For detected dropped rod configurations, the negative flux rate protection system actuates a reactor trip. For the non-detected dropped rod configurations, the minimum DNBR values have been evaluated with conservative analysis methodology and assumptions and the DNBR fuel design limit is respected the analytical results shows that, for all the non-detected dropped rod configurations, the minimum DNB margin is about 2% which occurs in AFA-2G fuel assembly in the first transition cycle. (author)
McAllister, Brian G; Kime, David E
2003-11-19
To determine whether early life exposure to tributyltin (TBT), an aromatase inhibitor, impaired reproductive function in fish, Danio rerio were exposed to environmentally realistic levels (0.01-100 ng l(-1)) of TBT from 0 to 30, 30 to 60, and 0 to 70 days post-hatch, and the sex ratio and sperm motility of the adults examined 3-5 months after cessation of exposure. Fish exposed for 70 days to 0.1 ng l(-1) of TBT, a concentration presently below the detection limit in water, showed a male biased population which produced a high incidence of sperm lacking flagella. At 1 ng l(-1), the motility of sperm was significantly lower than that of control fish, while at 10 ng l(-1), all sperm lacked flagella and, at 100 ng l(-1), milt volume had increased. The effect of exposure on sex ratio was similar after exposure from 0 to 70 and 0 to 30 days, but even 100 ng l(-1) gave only 65% males after exposure from 30 to 60 days. Effects on sperm motility and morphology and on milt volume were less pronounced after 30 day than 70 day exposure. Our data suggest that screening for aromatase inhibiting activity and assessment of its risks in early life to human and wildlife fertility needs to be urgently addressed, and that the reproductive toxicity of TBT may presently be underestimated.
Singh, Rashmi; Khatri, Preeti; Srivastava, Nidhi; Jain, Shruti; Brahmachari, Vani; Mukhopadhyay, Asish; Mazumder, Shibnath
2017-04-01
The present study describes the immunotoxic effect of chronic fluoride exposure on adult zebrafish (Danio rerio). Zebrafish were exposed to fluoride (71.12 mg/L; 1/10 LC 50 ) for 30 d and the expression of selected genes studied. We observed significant elevation in the detoxification pathway gene cyp1a suggesting chronic exposure to non-lethal concentration of fluoride is indeed toxic to fish. Fluoride mediated pro-oxidative stress is implicated with the downregulation in superoxide dismutase 1 and 2 (sod1/2) genes. Fluoride affected DNA repair machinery by abrogating the expression of the DNA repair gene rad51 and growth arrest and DNA damage inducible beta a gene gadd45ba. The upregulated expression of casp3a coupled with altered Bcl-2 associated X protein/B-cell lymphoma 2 ratio (baxa/bcl2a) clearly suggested chronic fluoride exposure induced the apoptotic cascade in zebrafish. Fluoride-exposed zebrafish when challenged with non-lethal dose of fish pathogen A. hydrophila revealed gross histopathology in spleen, bacterial persistence and significant mortality. We report that fluoride interferes with system-level output of pro-inflammatory cytokines tumour necrosis factor-α, interleukin-1β and interferon-γ, as a consequence, bacteria replicate efficiently causing significant fish mortality. We conclude, chronic fluoride exposure impairs the redox balance, affects DNA repair machinery with pro-apoptotic implications and suppresses pro-inflammatory cytokines expression abrogating host immunity to bacterial infections. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Marcos José Trevisan
2013-06-01
Full Text Available O objetivo deste trabalho foi estudar a fisiologia e a conservação pós-colheita de mamões 'Golden', submetidos à aplicação simultânea de 1-metilciclopropeno e etileno. Os frutos foram provenientes de cultivo comercial no Espírito Santo, no estádio de maturação 1. Os tratamentos foram compostos pelas seguintes combinações de 1-MCP (nL. L-1 + etileno (µL. L-1: 0+0; 100+0; 100+2,5; 100+5 e 100+10. Os tratamentos com 1-MCP e 1-MCP mais 2,5 µL. L-1 de etileno foram os que mais retardaram a perda da firmeza e a mudança da cor. Foi observada diferença na atividade respiratória entre o controle e os demais tratamentos. Inicialmente, a produção de etileno foi maior nos frutos do controle e menor naqueles com 1-MCP, a qual aumentou a partir do 10º dia. Não houve diferença no teor de sólidos solúveis entre os tratamentos. Quanto ao teor de ácido ascórbico, tratamentos com 1-MCP e 1-MCP mais 2,5 µL. L-1 de etileno apresentaram os teores mais elevados. Os tratamentos apresentaram notas de aparência acima de quatro ao final do armazenamento, ou seja, com boa aparência. Com estes resultados, é possível afirmar que existe potencial de uso do 1-MPC associado ao etileno, nos estádios iniciais de maturação do mamão 'Golden', para aumentar sua vida pós-colheita.
Resistência ao fogo de vigas parcialmente embebidas com betão
Piloto, P.A.G.; Gavilan, Ana; Mesquita, L.M.R.
2011-01-01
Neste artigo serão apresentados resultados dos ensaios de resistência ao fogo de elementos de viga parcialmente embebidos com betão. Os elementos de viga foram ensaiados à flexão, com aplicação de uma carga constante localizada a meio vão, submetida a uma curva de incêndio nominal ISO 834, [1-2]. Foram determinados os tempos de resistência ao fogo, as temperaturas críticas e os modos de colapso para cada grau de utilização.
Liu, Lihua; Li, Yifan; Coelhan, Mehmet; Chan, Hing Man; Ma, Wanli; Liu, Liyan
2016-12-01
Short-chain chlorinated paraffins (SCCPs) are ubiquitous in the environment and might cause adverse environmental and human health effects. Little is known about the relative toxicity of different SCCP compounds especially during development. The objective of this study was to characterize and compare effects of seven SCCP groups at environmentally relevant levels, using a zebrafish (Danio rerio) model. Observations on malformation, survival rates at 96 h post fertilization (hpf), and hatching rates at 72 hpf indicated that the C 10- groups (C 10 H 18 Cl 4 , 1,2,5,6,9,10-C 10 H 16 Cl 6 and C 10 H 15 Cl 7 ) were more toxic than the C 12- groups (C 12 H 22 Cl 4 , C 12 H 19 Cl 7 and 1,1,1,3,10,12,12,12-C 12 H 18 Cl 8 ) and Cereclor 63L. The C 10- groups were also more potent than C 12- groups and Cereclor 63L in decreasing thyroid hormone levels. Among the three compounds within the C 10- group, the compounds with less chlorine content had stronger effects on sub-lethal malformations but less effects on triiodothyronine (T3) and tetraiodothyronine (T4). Only C 10 H 18 Cl 4 significantly decreased the mRNA expression of tyr, ttr, dio2 and dio3 at a dose-dependent manner suggesting that the specific mode of actions differ with different congeners. The mechanisms of disruption of thyroid status by different SCCPs could be different. C 10 H 18 Cl 4 might inhibit T3 production through the inhibition effect on dio2. These results indicate that SCCP exposure could alter gene expression in the hypothalamic-pituitary-thyroid (HPT) axis and thyroid hormone levels. The mechanisms of disruption of thyroid status by different SCCPs could be different. Our results on the relative developmental toxicities of SCCPs will be useful to reach a better understanding of SCCP toxicity supporting environmental risk evaluation and regulation and used as a guidance for environmental monitoring of SCCPs in the future. Copyright © 2016 Elsevier Ltd. All rights reserved.
Dicty_cDB: Contig-U11284-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e-16 (Q55FK2) RecName: Full=Ras-related protein Rab-6; 89 2e-16 AB241242_1( AB241242 |pid:none) Symbiotic pr... pro... 94 7e-18 BC086715_1( BC086715 |pid:none) Danio rerio RAB25, member RAS onco... 94 9e-18 AB241241_1( AB241241 |pid:none) Symbi...otic protist of Reticuliterme... 94 9e-18 BC124978_1( BC
Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem
Directory of Open Access Journals (Sweden)
Edilene Aparecida Araújo da Silveira
2011-06-01
Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.
Alves, Romulo Nepomuceno; Mariz, Célio Freire; Paulo, Driele Ventura de; Carvalho, Paulo S M
2017-07-01
Used petroleum hydrocarbons and gasoline stations runoff are significant sources of polycyclic aromatic hydrocarbons (PAHs) to aquatic ecosystems. Samples of the final effluent of oil-water-separators were collected at gasoline stations in the metropolitan region of Recife, Brazil, before release to sewage or rainwater systems. Effluent soluble fractions (ESF) were prepared and bioassays were performed according to the Fish Embryo Toxicity Test. The test involved exposing zebrafish Danio rerio embryos to dilutions of the ESFs for 96 h, with daily examination of lethality and sublethal morphological effects integrated through the General Morphology Score (GMS), based on the achievement of developmental hallmarks. Frequencies of abnormalities were recorded after exposures. ESF LC50-96h (lethal concentration to 50% of exposed embryos) in the most toxic effluent achieved 8.9% (v/v), equivalent to 11 μg phenanthrene equivalents L -1 . GMS scores indicated significantly delayed embryo-larval development at ESF dilutions of 10% and 20% from effluents of all gas stations. Major abnormalities detected after the 96 h exposure included the presence of a yolk sac not fully absorbed coupled with the lack of an inflated swim bladder, lack of both pectoral fins, and the failure to develop a protruding mouth. Effective equivalent PAH concentrations that induce a 50% frequency of larvae without an inflated swim bladder (EC50) were 4.9 μg phenanthrene L -1 , 21.8 μg naphthalene L -1 , and 34.1 μg chrysene L -1 . This study shows that PAHs in ESFs from gas stations oil water separators are toxic to zebrafish, contributing to the toxicity of urban storm waters. Copyright © 2017 Elsevier Ltd. All rights reserved.
Yan, Xinmei; Zhu, Chunyan; Huang, Bin; Yan, Qun; Zhang, Guangsheng
2018-01-01
Consisted of anaerobic (ANA), anoxic-1 (AN1), aerobic-1 (AE1), anoxic-2 (AN2), aerobic-2 (AE2) reactors and sediment tank, the two-staged A/O process was applied for depth treatment of electroplating tail wastewater with high electrical conductivity and large amounts of ammonia nitrogen. It was found that the NH 4 + -N and COD removal efficiencies reached 97.11% and 83.00%, respectively. Besides, the short-term salinity shock of the control, AE1 and AE2 indicated that AE1 and AE2 have better resistance to high salinity when the concentration of NaCl ranged from 1 to 10g/L. Meanwhile, it was found through high-throughput sequencing that bacteria genus Nitrosomonas, Nitrospira and Thauera, which are capable of nitrogen removal, were enriched in the two-staged A/O process. Moreover, both salt-tolerant bacteria and halophili bacteria were also found in the combined process. Therefore, microbial community within the two-staged A/O process could be acclimated to high electrical conductivity, and adapted for electroplating tail wastewater treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.
Da esclerodermia ao síndrome de poems
Ana Sofia Montez; Elsa Rocha
2015-01-01
Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1) e distensão abdominal com ascite
Stabili, Loredana; Gravili, Cinzia; Boero, Ferdinando; Tredici, Salvatore M; Alifano, Pietro
2010-04-01
Vibrio harveyi is the major causal organism of vibriosis, causing potential devastation to diverse ranges of marine invertebrates over a wide geographical area. These microorganisms, however, are phenotypically diverse, and many of the isolates are also resistant to multiple antibiotics. In a previous study, we described a previously unknown association between Vibrio sp. AO1, a luminous bacterium related to the species V. harveyi, and the benthic hydrozoan Aglaophenia octodonta. In this study, we analyzed the susceptibility to antibiotics (ampicillin, streptomycin, tetracycline, or co-trimoxazole = mix of sulfamethoxazole and trimetoprim) of Vibrio sp. AO1 growing in pure culture or in association with its hydroid host by using microcosm experiments. The results of minimum inhibitory concentration (MIC) experiments demonstrated that Vibrio sp. AO1 was highly resistant to ampicillin and streptomycin in pure culture. Nevertheless, these antibiotics, when used at sub-MIC values, significantly reduced the hydroid fluorescence. Co-trimoxazole showed the highest inhibitory effect on fluorescence of A. octodonta. However, in all treatments, the fluorescence was reduced after 48 h, but never disappeared completely around the folds along the hydrocaulus and at the base of the hydrothecae of A. octodonta when the antibiotic was used at concentration completely inhibiting growth in vitro. The apparent discrepancy between the MIC data and the fluorescence patterns may be due to either heterogeneity of the bacterial population in terms of antibiotic susceptibility or specific chemical-physical conditions of the hydroid microenvironment that may decrease the antibiotic susceptibility of the whole population. The latter hypothesis is supported by scanning electron microscope evidence for development of bacterial biofilm on the hydroid surface. On the basis of the results obtained, we infer that A. octodonta might behave as a reservoir of antibiotic multiresistant bacteria
Hallare, Arnold V; Ruiz, Paulo Lorenzo S; Cariño, J C Earl D
2014-05-01
Consequent to the growing demand for alternative sources of energy, the seeds from Jatropha curcas remain to be the favorite for biodiesel production. However, a significant volume of the residual organic mass (seed cake) is produced during the extraction process, which raises concerns on safe waste disposal. In the present study, we assessed the toxicity of J. curcas seed cake using the zebrafish (Danio rerio) embryotoxicity test. Within 1-h post-fertilization (hpf), the fertilized eggs were exposed to five mass concentrations of J. curcas seed cake and were followed through 24, 48, and 72 hpf. Toxicity was evaluated based on lethal endpoints induced on zebrafish embryos namely egg coagulation, non-formation of somites, and non-detachment of tail. The lowest concentration tested, 1 g/L, was not able to elicit toxicity on embryos whereas 100 % mortality (based also on lethal endpoints) was recorded at the highest concentration at 2.15 g/L. The computed LC50 for the J. curcas seed cake was 1.61 g/L. No further increase in mortality was observed in the succeeding time points (48 and 72 hpf) indicating that J. curcas seed cake exerted acute toxicity on zebrafish embryos. Sublethal endpoints (yolk sac and pericardial edema) were noted at 72 hpf in zebrafish embryos exposed to higher concentrations. The observed lethal endpoints induced on zebrafish embryos were discussed in relation to the active principles, notably, phorbol esters that have remained in the seed cake even after extraction.
Directory of Open Access Journals (Sweden)
Berenice Rheinreimer
2015-11-01
Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.
Directory of Open Access Journals (Sweden)
Hsiang-Ting Huang
Full Text Available Stress granules are a type of cytoplasmic messenger ribonucleoprotein (mRNP granule formed in response to the inhibition of translation initiation, which typically occurs when cells are exposed to stress. Stress granules are conserved in eukaryotes; however, in filamentous fungi, including Aspergillus oryzae, stress granules have not yet been defined. For this reason, here we investigated the formation and localization of stress granules in A. oryzae cells exposed to various stresses using an EGFP fusion protein of AoPab1, a homolog of Saccharomyces cerevisiae Pab1p, as a stress granule marker. Localization analysis showed that AoPab1 was evenly distributed throughout the cytoplasm under normal growth conditions, and accumulated as cytoplasmic foci mainly at the hyphal tip in response to stress. AoSO, a homolog of Neurospora crassa SO, which is necessary for hyphal fusion, colocalized with stress granules in cells exposed to heat stress. The formation of cytoplasmic foci of AoSO was blocked by treatment with cycloheximide, a known inhibitor of stress granule formation. Deletion of the Aoso gene had effects on the formation and localization of stress granules in response to heat stress. Our results suggest that AoSO is a novel component of stress granules specific to filamentous fungi. The authors would specially like to thank Hiroyuki Nakano and Kei Saeki for generously providing experimental and insightful opinions.
NCBI nr-aa BLAST: CBRC-TNIG-14-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-14-0021 ref|NP_997779.1| neuroblastoma myc-related oncogene 1 [Danio reri...o] gb|AAH67586.1| V-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) [Danio rerio] NP_997779.1 4e-54 53% ...
Dettmam, Deborah; Matos, Nelson Juliano Cardoso
2017-01-01
Este artigo discute se o recurso ao povo ou ao legislador, como instrumento de resolução dos conflitos entre os poderes, viola a separação de poderes e a independência do poder judiciário ou se, antes disso, dá fiel execução à separação de poderes. Para alcançar esse objetivo, esse artigo investiga se existe relação entre o recurso ao legislador e os regimes autoritários; se a Constituição Federal de 1988 proíbe outro guardião constitucional, que não o Supremo Tribunal Federal, e quais as con...
Imunidade celular em caninos neonatos - do nascimento ao 45° dia de idade
Directory of Open Access Journals (Sweden)
R.P. Klein
2014-06-01
Full Text Available O objetivo do presente trabalho foi acompanhar o desenvolvimento imunológico dos neonatos caninos, a fim de avaliar a imunidade celular pela análise dos leucócitos e linfócitos totais e das subpopulações de linfócitos T (CD4+ e CD8+ pela técnica de citometria de fluxo. Foram utilizados 30 cães neonatos de ambos os sexos, sem raça definida, aos três, 10, 17, 24, 31, 38 e 45 dias de idade. A contagem de leucócitos totais aos 45 dias (11.639±3.574 foi significativamente maior que no terceiro dia de idade (8.740±1.812 (P<0,05; não houve diferença entre a contagem total de linfócitos aos 45 dias em relação ao terceiro dia de idade. Quanto às subpopulações de LT CD4+ e LT CD8+, os percentuais de LT CD4+, aos três dias de idade (24,9±16,8%, foram inferiores quando comparados à média entre o 10°, o 24° e o 31°dia (35,5%, e os de CD8+, ao terceiro dia, menores em relação às médias do 10° e do 31° dia de idade. Pode-se concluir que as subpopulações de LT CD4+ e CD8+ sofrem oscilações durante o desenvolvimento pós-natal, sendo estas crescentes em relação aos níveis obtidos aos três dias de idade. A relação CD4+:CD8+ mostrou superioridade para o primeiro tipo celular, sendo que a maior relação entre CD4+ e CD8+ ocorreu no terceiro dia de idade. Com base nos resultados obtidos neste estudo, notaram-se as diferenças semanais nas populações linfocitárias, o que demonstra a dinâmica dessas células durante o período neonatal.
Effectiveness of Rapid Cooling as a Method of Euthanasia for Young Zebrafish (Danio rerio).
Wallace, Chelsea K; Bright, Lauren A; Marx, James O; Andersen, Robert P; Mullins, Mary C; Carty, Anthony J
2018-01-01
Despite increased use of zebrafish (Danio rerio) in biomedical research, consistent information regarding appropriate euthanasia methods, particularly for embryos, is sparse. Current literature indicates that rapid cooling is an effective method of euthanasia for adult zebrafish, yet consistent guidelines regarding zebrafish younger than 6 mo are unavailable. This study was performed to distinguish the age at which rapid cooling is an effective method of euthanasia for zebrafish and the exposure times necessary to reliably euthanize zebrafish using this method. Zebrafish at 3, 4, 7, 14, 16, 19, 21, 28, 60, and 90 d postfertilization (dpf) were placed into an ice water bath for 5, 10, 30, 45, or 60 min (n = 12 to 40 per group). In addition, zebrafish were placed in ice water for 12 h (age ≤14 dpf) or 30 s (age ≥14 dpf). After rapid cooling, fish were transferred to a recovery tank and the number of fish alive at 1, 4, and 12-24 h after removal from ice water was documented. Euthanasia was defined as a failure when evidence of recovery was observed at any point after removal from ice water. Results showed that younger fish required prolonged exposure to rapid cooling for effective euthanasia, with the required exposure time decreasing as fish age. Although younger fish required long exposure times, animals became immobilized immediately upon exposure to the cold water, and behavioral indicators of pain or distress rarely occurred. We conclude that zebrafish 14 dpf and younger require as long as 12 h, those 16 to 28 dpf of age require 5 min, and those older than 28 dpf require 30 s minimal exposure to rapid cooling for reliable euthanasia.
Ab urbe condita. Desde a fundaçao da cidade de Bracara Augusta
Directory of Open Access Journals (Sweden)
Rui Morais
2005-01-01
Full Text Available Neste estudo aborda-se a problemática da fundaçao da antiga cidade de Bracara Augusta, levando em consideraçao o registro arqueológico e sua problemática e significado. A parte da fundaçao ex novo da cidade ou da preexistência de populaçoes autóctones no local, apresentam-se fortes vestígios indicadores da importância do culto imperial e dinástico que pensamos fortemente associados ao acto simbólico da sua fundaçao ou "refundaçao" segundo uma cerimónia à da "Roma Quadrada" augústea.
NCBI nr-aa BLAST: CBRC-FRUB-02-0213 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0213 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-136 68% ...
NCBI nr-aa BLAST: CBRC-DRER-06-0069 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-06-0069 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-125 83% ...
NCBI nr-aa BLAST: CBRC-GACU-12-0038 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-12-0038 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-119 79% ...
NCBI nr-aa BLAST: CBRC-DRER-08-0031 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-08-0031 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-143 99% ...
NCBI nr-aa BLAST: CBRC-TNIG-11-0022 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-11-0022 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-117 79% ...
NCBI nr-aa BLAST: CBRC-OLAT-05-0018 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-05-0018 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-117 82% ...
NCBI nr-aa BLAST: CBRC-GACU-17-0013 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-17-0013 ref|NP_956379.1| solute carrier family 16 (monocarboxylic acid transporters...), member 1 [Danio rerio] gb|AAH48883.1| Solute carrier family 16 (monocarboxylic acid transporters), member 1 [Danio rerio] NP_956379.1 1e-115 79% ...
Personalidade, resiliência e atitudes face ao envelhecimento em idosos do meio urbano e meio rural
Pinto, Ana Sofia Rodrigues
2015-01-01
Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde, Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2015 A presente investigação refere-se ao estudo da personalidade, resiliência e atitudes face ao envelhecimento, numa amostra de indivíduos idosos. Os objetivos são: (1) analisar a influência do meio ecológico na resiliência e nas atitudes face ao envelhecimento; (2) analisar a relação da personalidade com a resiliência e ...
Exposure of juvenile Danio rerio to aged TiO₂ nanomaterial from sunscreen.
Fouqueray, Manuela; Noury, Patrice; Dherret, Lysiane; Chaurand, Perrine; Abbaci, Khedidja; Labille, Jerome; Rose, Jerome; Garric, Jeanne
2013-05-01
The toxicity of dietary exposure to artificially aged TiO₂ nanomaterial (T-Lite) used in sunscreen cream was studied on Danio rerio. Embryolarval assays were conducted to assess the effects of TiO₂ residues of nanomaterial (RNM) on fish early life stages. Juvenile fishes were exposed by the trophic route in two experiments. During the first experiment, juvenile fishes were exposed to TiO₂ RNM for 14 days by adding RNM to commercial fish food. The second one consisted in producing a trophic food chain. Pseudokirchneriella subcapitata algae, previously contaminated with TiO₂ RNM in growth medium, was used to feed Daphnia magna neonates over a 48-h period. Daphnia were used next to feed juvenile fishes for 7 days. Accumulation of Ti, life traits (survival and growth) and biochemical parameters such as energy reserves, digestive (trypsin, esterase, cellulose and amylase) and antioxidant (superoxide dismutase and catalase) enzyme activity were measured at the end of exposures. As expected in the receiving aquatic system, TiO2 RNM at low concentrations caused a low impact on juvenile zebrafish. A slight impact on the early life stage of zebrafish with premature hatching was observed, and this effect appeared mainly indirect, due to possible embryo hypoxia. When juvenile fish are exposed to contaminated food, digestive enzyme activity indicated a negative effect of TiO₂ RNM. Digestive physiology was altered after 14 days of exposure and seemed to be an indirect target of TiO₂ RNM when provided by food.
Da esclerodermia ao síndrome de poems
Directory of Open Access Journals (Sweden)
Ana Sofia Montez
2015-12-01
Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite
Resposta ao estresse: II. Resiliência e vulnerabilidade
Directory of Open Access Journals (Sweden)
Nicole Leite Galvão-Coelho
2015-06-01
Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.
Li, Xue-Qing; Wu, Qin; Hu, Die; Wang, Rui; Liu, Yan; Wu, Min-Chen; Li, Jian-Fang
2017-12-01
To improve the temperature characteristics and catalytic efficiency of a glycoside hydrolase family (GHF) 11 xylanase from Aspergillus oryzae (AoXyn11A), its variants were predicted based on in silico design. Firstly, Gly 21 with the maximum B-factor value, which was confirmed by molecular dynamics (MD) simulation on the three-dimensional structure of AoXyn11A, was subjected to site-saturation mutagenesis. Thus, one variant with the highest thermostability, AoXyn11A G21I , was selected from the mutagenesis library, E. coli/Aoxyn11A G21X (X: any one of 20 amino acids). Secondly, based on the primary structure multiple alignment of AoXyn11A with seven thermophilic GHF11 xylanases, AoXyn11A Y13F or AoXyn11A G21I-Y13F , was designed by replacing Tyr 13 in AoXyn11A or AoXyn11A G21I with Phe. Finally, three variant-encoding genes, Aoxyn11A G21I , Aoxyn11A Y13F and Aoxyn11A G21I-Y13F , were constructed by two-stage whole-plasmid PCR method, and expressed in Pichia pastoris GS115, respectively. The temperature optimum (T opt ) of recombinant (re) AoXyn11A G21I-Y13F was 60 °C, being 5 °C higher than that of reAoXyn11A G21I or reAoXyn11A Y13F , and 10 °C higher than that of reAoXyn11A. The thermal inactivation half-life (t 1/2 ) of reAoXyn11A G21I-Y13F at 50 °C was 240 min, being 40-, 3.4- and 2.5-fold longer than those of reAoXyn11A, reAoXyn11A G21I and reAoXyn11A Y13F . The melting temperature (T m ) values of reAoXyn11A, reAoXyn11A G21I , reAoXyn11A Y13F and reAoXyn11A G21I-Y13F were 52.3, 56.5, 58.6 and 61.3 °C, respectively. These findings indicated that the iterative mutagenesis of both Gly21Ile and Tyr13Phe improved the temperature characteristics of AoXyn11A in a synergistic mode. Besides those, the catalytic efficiency (k cat /K m ) of reAoXyn11A G21I-Y13F was 473.1 mL mg -1 s -1 , which was 1.65-fold higher than that of reAoXyn11A.
Produção do Superprecoce a Partir de Bezerros Desmamados aos 72 ou 210 Dias de Idade
Directory of Open Access Journals (Sweden)
Restle João
2002-01-01
Full Text Available O experimento foi conduzido com o objetivo de avaliar o desempenho em confinamento, dos 210 aos 408 dias de idade, de bezerros previamente desmamados aos 72 (T72 ou 210 (T210 dias. Foram utilizados 36 machos não castrados da raça Braford (5/8 Hereford 3/8 Nelore. O peso médio no início do experimento foi de 209 kg (T72 e 192 kg (T210. O confinamento compreendeu 30 dias de adaptação dos animais e 168 dias de avaliação, sendo dividido em quatro períodos de 42 dias. A relação volumoso:concentrado foi de 60:40 para o 1º e 2º períodos, 50:50 para o 3º período e 45:55 para o 4º período. Não houve interação entre idade de desmame e período de avaliação em confinamento para os parâmetros relativos aos consumos médios por animal de matéria seca (CMS e de energia digestível (CED, expressos em kg/dia e Mcal/dia (CMSD e CEDD, por 100 kg de peso vivo (CMSP e CEDP e por unidade de tamanho metabólico (CMSM e CEDM, ao ganho de peso médio diário (GMD, à conversão alimentar (CA e eficiência energética (EE. Animais desmamados aos 210 dias apresentaram maiores CMSP (2,25 contra 2,07% PV e CEDP (7,05 contra 6,48% PV em relação aos animais desmamados ao 72 dias de idade. Não houve diferença no CMSD (6,75 contra 6,98 kg/dia, no GMD (1,066 contra 1,074 kg/dia, na eficiência de conversão da matéria seca (6,42 contra 6,72 kg de MS/kg ganho de PV e da energia digestível consumida (20,18 contra 21,13 Mcal/kg ganho de PV em ganho de peso vivo para os animais desmamados aos 72 ou 210 dias de idade, respectivamente. Os pesos de abate e de carcaça quente foram similares entre as duas idades, sendo, respectivamente, de 424 e 232 kg para os animais do T72 e de 406 e 221 kg para dos T210. Os resultados mostram que animais desmamados aos 72 dias de idade apresentaram desempenho durante a terminação, pesos de abate e de carcaça similares aos desmamados aos 210 dias.
Fatores associados aos sintomas depressivos em idosos: estudo EpiFloripa
Directory of Open Access Journals (Sweden)
Lucelia Justino Borges
2013-08-01
Full Text Available OBJETIVO Analisar a prevalência e fatores associados a sintomas depressivos em idosos. MÉTODOS Estudo epidemiológico transversal e de base domiciliar (inquérito EpiFloripa Idoso com 1.656 idosos, realizado por conglomerados em dois estágios, setores censitários e domicílios, em Florianópolis, SC. A prevalência de sintomas depressivos (desfecho foi obtida por meio da Geriatric Depression Scale (GDS-15, e testadas associações segundo variáveis sociodemográficas, de saúde, comportamentais e sociais. Foram calculadas razões de prevalências brutas e ajustadas com intervalo de 95% de confiança por regressão de Poisson. RESULTADOS A prevalência de sintomas depressivos foi de 23,9% (IC95% 21,84;26,01. Os fatores de risco associados no modelo final foram: escolaridade de cinco a oito anos (RP = 1,50; IC95% 1,08; 2,08, um a quatro anos (RP = 1,62; IC95% 1,18; 2,23 e nenhum ano de estudo (RP = 2,11; IC95% 1,46;3,05; situação econômica pior quando comparada com a que tinha aos 50 anos (RP = 1,33; IC95% 1,02;1,74; déficit cognitivo (RP = 1,45; IC95% 1,21;1,75; percepção de saúde regular (RP = 1,95; IC95% 1,47;2,60 e ruim (RP = 2,64; IC95% 1,82;3,83; dependência funcional (RP = 1,83; IC95% 1,43; 2,33; e dor crônica (RP = 1,35; IC95% 1,10;1,67. Grupo etário de 70 a 79 anos (RP = 0,77; IC95% 0,64;0,93; atividade física de lazer (RP = 0,75; IC95% 0,59;0,94; participação em grupos de convivência ou religiosos (RP = 0,80; IC95% 0,64;0,99; e ter relação sexual (RP = 0,70; IC95% 0,53;0,94 mostraram-se fatores protetores ao aparecimento dos sintomas depressivos. CONCLUSÕES Situação clínica adversa, desvantagem socioeconômica e pouca atividade social e sexual mostraram-se associadas aos sintomas depressivos em idosos.
Tufi, Sara; Leonards, Pim; Lamoree, Marja; de Boer, Jacob; Legler, Juliette; Legradi, Jessica
2016-03-15
During early development, neurotransmitters are important stimulants for the development of the central nervous system. Although the development of different neuronal cell types during early zebrafish (Danio rerio) development is well-studied, little is known of the levels of neurotransmitters, their precursors and metabolites during development, and how these levels are affected by exposure to environmental contaminants. A method based on hydrophilic interaction liquid chromatography coupled to tandem mass spectrometry has been applied for the first time to zebrafish embryos and larvae to study five neurotransmitter systems in parallel, including the dopaminergic-andrenergic, glutaminergic-GABAnergic, serotoninergic, histaminergic, and cholinergic systems. Our method enables the quantification of neurotransmitters and their precursors and metabolites in whole zebrafish from the period of zygote to free-swimming larvae 6 days postfertilization (dpf). We observed a developmental stage-dependent pattern with clear differences between the first 2 days of development and the following days. Whereas the neurotransmitter levels steadily increased, the precursors showed a peak at 3 dpf. After exposure to several pesticides, significant differences in concentrations of neurotransmitters and precursors were observed. Our study revealed new insights about neurotransmitter systems during early zebrafish development and showed the usefulness of our approach for environmental neurotoxicity studies.
Gore, Matthew; Burggren, Warren W
2012-01-01
Swimming stamina in adult fish is heritable, it is unknown if inherited traits that support enhanced swimming stamina in offspring appear only in juveniles and/or adults, or if these traits actually appear earlier in the morphologically quite different larvae. To answer this question, mature adult zebrafish (Danio rerio) were subjected to a swimming performance test that allowed separation into low swimming stamina or high swimming stamina groups. Adults were then bred within their own performance groups. Larval offspring from each of the two groups, designated high (L(HSD)) and low stamina-derived larvae (L(LSD)), were then reared at 27°C in aerated water (21% O(2)). Routine (f(H),r) and active (f(H),a) heart rate, and routine [Formula: see text] and active [Formula: see text] mass-specific oxygen consumption were recorded from 5 days post fertilization (dpf) through 21 dpf, and gross cost of transport and factorial aerobic metabolic scope were derived from [Formula: see text] measurements. Heart rate generally ranged between 150 and 225 bpm in both L(HSD) and L(LSD) populations. However, significant (P stamina in adult parents also appear in their larval offspring well before attainment of juvenile or adult features.
International Nuclear Information System (INIS)
Barillet, Sabrina; Larno, Valerie; Floriani, Magali; Devaux, Alain; Adam-Guillermin, Christelle
2010-01-01
Experiments on adult zebrafish (Danio rerio) were conducted to assess histopathological effects induced on gill, muscle, and gonadal tissues after waterborne uranium exposure. Although histopathology is often employed as a tool for the detection and assessment of xenobiotic-mediated effects in aquatic organisms, few studies have been dedicated to the investigation of histopathological consequences of uranium exposure in fish. Results showed that gill tissue architecture was markedly disrupted. Major symptoms were alterations of the secondary lamellae epithelium (from extensive oedema to desquamation), hyperplasia of chloride cells, and breakdown of the pillar cell system. Muscle histology was also affected. Degeneration and disorganization of myofibrillar sarcomeric pattern as well as abnormal localization of mitochondria within muscle and altered endomysial sheaths were observed. Morphological alterations of spermatozoa within the gonadal tissue were also noticed. This study demonstrated that uranium exposure induced a variety of histological impairments in fish, supporting environmental concerns when uranium contaminates aquatic systems.
Energy Technology Data Exchange (ETDEWEB)
Barillet, Sabrina, E-mail: sabrina.barillet@free.fr [Laboratory of Radioecology and Ecotoxicology, IRSN (Institute for Radiological Protection and Nuclear Safety), DEI/SECRE/LRE, Cadarache, Bat 186, BP 3, 13115 St-Paul-Lez-Durance cedex (France); Larno, Valerie, E-mail: valerie.larno@irsn.fr [Laboratory of Radioecology and Ecotoxicology, IRSN (Institute for Radiological Protection and Nuclear Safety), DEI/SECRE/LRE, Cadarache, Bat 186, BP 3, 13115 St-Paul-Lez-Durance cedex (France); Floriani, Magali, E-mail: magali.floriani@irsn.fr [Laboratory of Radioecology and Ecotoxicology, IRSN (Institute for Radiological Protection and Nuclear Safety), DEI/SECRE/LRE, Cadarache, Bat 186, BP 3, 13115 St-Paul-Lez-Durance cedex (France); Devaux, Alain, E-mail: alain.devaux@entpe.fr [INRA, EFPA Department, 54280, Champenoux and Environmental Science Laboratory, ENTPE, 69518 Vaulx en Velin cedex (France); Adam-Guillermin, Christelle, E-mail: christelle.adam-guillermin@irsn.fr [Laboratory of Radioecology and Ecotoxicology, IRSN (Institute for Radiological Protection and Nuclear Safety), DEI/SECRE/LRE, Cadarache, Bat 186, BP 3, 13115 St-Paul-Lez-Durance cedex (France)
2010-11-01
Experiments on adult zebrafish (Danio rerio) were conducted to assess histopathological effects induced on gill, muscle, and gonadal tissues after waterborne uranium exposure. Although histopathology is often employed as a tool for the detection and assessment of xenobiotic-mediated effects in aquatic organisms, few studies have been dedicated to the investigation of histopathological consequences of uranium exposure in fish. Results showed that gill tissue architecture was markedly disrupted. Major symptoms were alterations of the secondary lamellae epithelium (from extensive oedema to desquamation), hyperplasia of chloride cells, and breakdown of the pillar cell system. Muscle histology was also affected. Degeneration and disorganization of myofibrillar sarcomeric pattern as well as abnormal localization of mitochondria within muscle and altered endomysial sheaths were observed. Morphological alterations of spermatozoa within the gonadal tissue were also noticed. This study demonstrated that uranium exposure induced a variety of histological impairments in fish, supporting environmental concerns when uranium contaminates aquatic systems.
Adesão ao tratamento da ambliopia
Arakaki,Mara Regina; Schellini,Silvana Artioli; Heimbeck,Felipe Jorge; Furuya,Margareth Tiemi; Padovani,Carlos Roberto
2004-01-01
OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0208 [SEVENS
Lifescience Database Archive (English)
Full Text Available y and hepatic disease 1 (autosomal recessive)-like 1 (PKHD1L1) [Danio rerio] emb|CAP09460.1| novel gene simi...lar to vertebrate polycystic kidney and hepatic disease 1 (autosomal recessive)-like 1 (PKHD1L1) [Danio rerio] CAP09515.1 1e-111 42% ...
NCBI nr-aa BLAST: CBRC-DDIS-03-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-03-0067 emb|CAI21049.1| novel protein similar to vertebrate syntaxin 7 (S...TX7) [Danio rerio] emb|CAI29417.1| novel protein similar to vertebrate syntaxin 7 (STX7) [Danio rerio] CAI21049.1 1e-17 24% ...
Directory of Open Access Journals (Sweden)
Feifei Zheng
2015-05-01
Full Text Available Mannose receptor (MR is a member of pattern-recognition receptors (PRRs, which plays a significant role in immunity responses. Much work on MR has been done in mammals and birds while little in fish. In this report, a MR gene (designated as zfMR was cloned from zebra fish (Danio rerio, which is an attractive model for the studies of animal diseases. The full-length cDNA of zfMR contains 6248 bp encoding a putative protein of 1428 amino acids. The predicted amino acid sequences showed that zfMR contained a cysteine-rich domain, a single fibronectin type II (FN II domain, eight C-type lectin-like domains (CTLDs, a transmembrane domain and a short C-terminal cytoplasmic domain, sharing highly conserved structures with MRs from the other species. The MR mRNA could be detected in all examined tissues with highest level in kidney. The temporal expression patterns of MR, IL-1β and TNF-α mRNAs were analyzed in the liver, spleen, kidney and intestine post of infection with Aeromonas sobria. By immunohistochemistry assay, slight enhancement of MR protein was also observed in the spleen and intestine of the infected zebra fish. The established zebra fish-A. sobria infection model will be valuable for elucidating the role of MR in fish immune responses to infection.
DEHP impairs zebrafish reproduction by affecting critical factors in oogenesis.
Directory of Open Access Journals (Sweden)
Oliana Carnevali
Full Text Available Public concerns on phthalates distributions in the environment have been increasing since they can cause liver cancer, structural abnormalities and reduce sperm counts in male reproductive system. However, few data are actually available on the effects of Di-(2-ethylhexyl-phthalate (DEHP in female reproductive system. The aim of this study was to assess the impacts of DEHP on zebrafish oogenesis and embryo production. Female Danio rerio were exposed to environmentally relevant doses of DEHP and a significant decrease in ovulation and embryo production was observed. The effects of DEHP on several key regulators of oocyte maturation and ovulation including bone morphogenetic protein-15 (BMP15, luteinizing hormone receptor (LHR, membrane progesterone receptors (mPRs and cyclooxygenase (COX-2 (ptgs2 were determined by real time PCR. The expressions of BMP15 and mPR proteins were further determined by Western analyses to strengthen molecular findings. Moreover, plasma vitellogenin (vtg titers were assayed by an ELISA procedure to determine the estrogenic effects of DEHP and its effects on oocyte growth. A significant reduction of fecundity in fish exposed to DEHP was observed. The reduced reproductive capacity was associated with an increase in ovarian BMP15 levels. This rise, in turn, was concomitant with a significant reduction in LHR and mPRbeta levels. Finally, ptgs2 expression, the final trigger of ovulation, was also decreased by DEHP. By an in vitro maturation assay, the inhibitory effect of DEHP on germinal vesicle breakdown was further confirmed. In conclusion, DEHP affecting signals involved in oocyte growth (vtg, maturation (BMP15, LHR, mPRs, and ovulation (ptgs2, deeply impairs ovarian functions with serious consequences on embryo production. Since there is a significant genetic similarity between D.rerio and humans, the harmful effects observed at oocyte level may be relevant for further molecular studies on humans.
Energy Technology Data Exchange (ETDEWEB)
Cooper, C.A. [Division of Health and Life Sciences, King' s College London, 150 Stamford Street, London SE1 9NN (United Kingdom)]. E-mail: chris.cooper@ex.ac.uk; Handy, R.D. [School of Biological Sciences, University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom); Bury, N.R. [Division of Health and Life Sciences, King' s College London, 150 Stamford Street, London SE1 9NN (United Kingdom)
2006-08-23
Zebrafish (Danio rerio) were fed either a diet containing 33 mg Fe kg{sup -1} (low) or 95 mg Fe kg{sup -1} (normal) for 10 weeks, after which short-term Cd and Fe uptake by the gastrointestinal tract and gill was assessed. Carcass metal content and transcript levels of the iron importer, Divalent Metal Transporter 1 (DMT1) and an iron exporter, ferroportin1, in both the gastrointestinal tract and gill were also measured. Fish fed the low Fe diet accumulated 13 times more Cd into their livers via the gastrointestinal tract than those fed the normal Fe diet. However, no significant increase in liver Fe accumulation was measured. Concomitantly, when exposed to 48 nmol Cd L{sup -1} fish fed the low Fe diet exhibited a {approx}4-fold increase in Cd accumulation on the gill and in the liver, compared to those fed a normal diet. In addition, fish fed the low Fe diet also significantly accumulated more Fe on the gill (nine-fold increase) and into the carcass (four-fold increase) when exposed to 96 nmol Fe L{sup -1}, compared to fish fed a normal diet. Surprisingly, carcass Fe, Ca and Mg concentrations were increased in fish fed the low Fe diet, which suggests that Fe body levels may not be a good indicator of whether a fish is more or less susceptible to increased non-essential metal accumulation via an Fe uptake pathway. However, significantly elevated transcript levels of DMT1 and ferroportin1 (2.7- and 3.8-fold induction, respectively) were seen in the gastrointestinal tract, and DMT1 in the gills (1.8-fold induction) of zebrafish fed a low Fe diet. The correlation between Cd uptake and DMT1 expression suggests that one route of uptake of Cd, either from the diet or from the water, could be via DMT1.
Marcus, Ernst
1960-01-01
A study of the several fresh and brackish-water springs on Curaçao, carried out by Dr. P. WAGENAAR HUMMELINCK, revealed (a) the common occurrence on that island of Dugesia festai (Borelli 1898), a species which until then had only been known from the South American mainland (nearest find: Ecuador!),
Dicty_cDB: Contig-U15883-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi
Directory of Open Access Journals (Sweden)
Robson da Fonseca Neves
2015-11-01
Full Text Available Resumo Transtornos mentais repercutem no mundo do trabalho. Estudos sobre interações entre os atores envolvidos no retorno ao trabalho são raros. A metaetnografia presta-se a sintetizar estudos qualitativos através da interpretação e comparação contínua dos conceitos presentes nos artigos. Este estudo propõe uma metaetnografia sobre as interações entre os atores sociais envolvidos no processo de retorno ao trabalho após afastamento por transtornos mentais. Visa: (1 explorar as interações entre os atores sociais envolvidos no retorno ao trabalho; (2 identificar facilitadores ou obstáculos para o retorno ao trabalho. A busca nas bases de dados produziu 619 artigos dos quais 16 atenderam aos critérios de inclusão. A análise dos artigos revelou seis conceitos de segunda ordem que resultaram em duas sínteses. A primeira diz respeito ao ethos do desempenho no retorno ao trabalho e a segunda aponta para o retorno ao trabalho como catalizador de novos modos de vida. Modelos que privilegiam o ethos do desempenho do trabalhador, bem como uma perspectiva orientada por aspectos psicossociais podem facilitar as praticas de retorno ao trabalho após afastamento por transtornos mentais.
Directory of Open Access Journals (Sweden)
Zhu Yi
2012-09-01
Full Text Available Abstract Object To compare the Sliding with Non-sliding lag screw of a gamma nail in the treatment of A1 and A2 AO-OTA intertrochanteric fractures. Materials and methods 80 patients were prospectively collected. In each group, AO/OTA 31-A were classified into group A. AO/OTA 31-A2.1 was classified as group B. We classified the A2.2 and A2.3 as group C. According to the set-screw locking formation of Gamma-III, the cases were randomly allocated to Sliding subgroup and Non-sliding subgroup in A, B and C groups. Follow-ups were performed 1, 3, 6 and 12 months postoperatively. Results In the Sliding group, the bone healing rate 3, 6, 12 months postoperatively reached 85.00%, 97.50%, 100% in group A, B and C. Meanwhile, in Non-sliding group, postoperatively, bone healing rate were 90.00%, 95.00% and 97.50% in group A, B and C, respectively. Both differences were not significant. Lower limb discrepancy between Sliding and Non-sliding pattern was significantly different in group C which represent fracture types of AO/OTA 31-A2.2 and A2.3 (0.573 ± 0.019 mm in Non-sliding group, 0.955 mm ± 0.024 mm in Sliding group, P Conclusions As a result, we can conclude that the sliding distance is minimal in Gamma nails and it is related to the comminuted extent of the intertrochanteric area in A1 and A2 AO-OTA intertrochanteric fractures. For treating these kinds of fractures, the sliding of the lag screw of an Gamma nail does not improve any clinical results and in certain cases, such as highly comminuted A1 and A2 fractures, can therefore even benefit from a locked lag screw by tightening the set-screw.
Liang, Xuefang; Souders, Christopher L; Zhang, Jiliang; Martyniuk, Christopher J
2017-12-01
Tributyltin (TBT) is an organotin compound that is the active ingredient of many biocides and antifouling agents. In addition to its well established role as an endocrine disruptor, TBT is also associated with adverse effects on the nervous system and behavior. In this study, zebrafish (Danio rerio) embryos were exposed to environmentally relevant concentrations of TBT (0.01, 0.1, 1 nM) to determine how low levels affected development and behavior. Fish exposed to 1 nM TBT hatched earlier when compared to controls. Following a 96-h exposure, total swimming distance, velocity, and activity of zebrafish larvae were reduced compared to controls. To identify putative mechanisms for these altered endpoints, we assessed embryo bioenergetics and gene expression. We reasoned that the accelerated hatch time could be related to ATP production and energy, thus embryos were exposed to TBT for 24 and 48-h exposure prior to hatch. There were no differences among groups for endpoints related to bioenergetics (i.e. basal, ATP-dependent, and maximal respiration). To address mechanisms related to changes in behavioral activity, we measured transcripts associated with muscle function (myf6, myoD, and myoG) and dopamine signaling (th, dat, dopamine receptors) as dopamine regulates behavior. No transcript was altered in expression by TBT in larvae, suggesting that other mechanisms exist that may explain changes in higher level endpoints. These results suggest that endpoints related to the whole animal (i.e. timing of hatch and locomotor behavior) are more sensitive to environmentally-relevant concentrations of TBT compared to the molecular and metabolic endpoints examined here. Copyright © 2017 Elsevier Ltd. All rights reserved.
Avaliação do potencial antioxidante da geleia real ao longo do tempo de armazenamento
Directory of Open Access Journals (Sweden)
Maria Luisa Teles Marques Florencio Alves
2012-05-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n3p257 A geleia real é uma substância com aspecto de pasta gelatinosa, de cor branca, ligeiramente amarelada, secretada pelas glândulas hipofaringeanas e mandibulares das abelhas operárias. O objetivo desta pesquisa foi avaliar o potencial antioxidante da geleia real, ao longo do tempo de armazenamento. Os parâmetros físico-químicos utilizados foram: umidade, teor de ácido ascórbico e de fenólicos totais. As amostras foram submetidas ao processo de extração dando origem ao extrato alcoólico, que foi aplicado ao teste do 1,1-difenil-2-picrilhidrazil (DPPH para avaliação da atividade antioxidante in vitro. A geleia real apresentou baixos teores de ácido ascórbico (de 0,75 a 1,31mg/100g base úmida e de fenólicos totais (de 14,26 a 28,30mg EAG/100g base úmida. As porcentagens de descoloração do DPPH pelo extrato alcoólico das amostras ficaram acima de 50%, exceto aos 90 dias de armazenamento. A partir dos resultados obtidos, considerando-se os reduzidos teores de ácido ascórbico e de fenólicos totais e, ainda, o baixo desempenho do extrato alcoólico das amostras no teste de atividade antioxidante in vitro, conclui-se que a geleia real apresenta potencial antioxidante relativamente baixo. O tempo de armazenamento não foi determinante nas alterações encontradas.
O DUALISMO DO SER ÓRFICO NA EPÍSTOLA DE PAULO AOS ROMANOS
Directory of Open Access Journals (Sweden)
Roger Ribeiro da Silva
2010-01-01
Full Text Available Este trabalho consiste na comparação de fragmentos de textos encontrados na obra de Platão e na Epístola aos Romanos atribuída à Paulo. Retirados de inúmeros textos atribuídos a Platão, estes fragmentos tiveram confirmados indícios da teologia órfica pelo professor Alberto Bernabé Pajares. E ao aplicar a Metodologia de Analise do Discurso Teológico, desenvolvido especificamente para este trabalho, e comparado os resultados individuais, encontramos pontos de encontro entre as duas teologias, a Órfica e a Paulina, acentuando o que tange a crença no Dualismo do Ser. A problemática levantada neste trabalho se refere a como a representação1 da alma unida ao corpo, encontrada em escritos paulinistas, apresenta indícios de contatos com fundamentos órficos no berço do cristianismo.
Barreiras ao tratamento da hipertensão arterial
Directory of Open Access Journals (Sweden)
Maria Vilani Cavalcante Guedes
2011-12-01
Full Text Available Objetivou-se descrever as barreiras encontradas pelas pessoas portadoras de hipertensão arterial para a não adesão ao tratamento e controle dos níveis de sua pressão arterial. Estudo descritivo e transversal realizado em seis unidades básicas de saúde em Fortaleza-Ceará, Brasil, com 246 pessoas inscritas no Programa de Controle de Hipertensão Arterial há, no mínimo, um ano. Coletaram-se dados com entrevista estruturada e no prontuário eletrônico. Identificaram-se 69 pesquisados com níveis pressóricos normalizados. As principais barreiras apontadas foram: baixas condições financeiras, tratamento contínuo com muitos remédios e prática de atividade física. Concluiu-se que as barreiras ao tratamento anti-hipertensivo compreendem a pessoa adoecida, seu ambiente de vida e acesso aos cuidados de saúde.
Photoluminescent properties of Pr3+ doped YTiAO6 (A= Nb&Ta) euxenite compounds
Venugopal, Meenu; Kumar, H. Padma
2018-04-01
Pr3+ doped YTiAO6 (A = Nb and Ta) compounds were prepared by conventional solid state ceramic route. X - ray diffraction studies of the samples confirmed the euxenite orthorhombic phase formation. Effect of Pr3+ doping on the optical and luminescence properties of YTiAO6 (A = Nb and Ta) were studied. The strong absorption in the UV region are due to the absorption by the host YTiAO6 (A = Nb and Ta) and all other peaks can be attributed to that of Pr3+. Host emission peaks are observed around 485 nm and 460 nm in all samples. The red emission observed at 614 nm in the doped samples corresponds to the 1D2 to 3H4 transition of Pr3+ ion. CIE colour coordinates and chromaticity values were also discussed.
Corrêa, Diva Diniz
1963-01-01
All species treated in this paper were collected by me between January and June 1962, during my stay at the “Caraïbisch Marien-Biologisch Instituut” (Caribbean Marine Biological Institute), Curaçao. I am deeply indebted to the Government of the Netherlands, which awarded me a grant enabling me to
Gubert, Priscila; Puntel, Bruna; Lehmen, Tassia; Bornhorst, Julia; Avila, Daiana S; Aschner, Michael; Soares, Felix A A
2016-04-15
Vitellogenesis is the yolk production process which provides the essential nutrients for the developing embryos. Yolk is a lipoprotein particle that presents lipids and lipid-binding proteins, referred to as vitellogenins (VIT). The Caenorhabditis elegans nematode has six genes encoding VIT lipoproteins. Several pathways are known to regulate vitellogenesis, including the DAF-16 transcription factor. Some reports have shown that heavy metals, such as manganese (Mn), impair brood size in C. elegans; however the mechanisms associated with this effect have yet to be identified. Our aim was to evaluate Mn's effects on C. elegans reproduction and better understand the pathways related to these effects. Young adult larval stage worms were treated for 4h with Mn in 85mM NaCl and Escherichia coli OP50 medium. Mn reduced egg-production and egg-laying during the first 24h after the treatment, although the total number of progenies were indistinguishable from the control group levels. This delay may have occurred due to DAF-16 activation, which was noted only after the treatment and was not apparent 24h later. Moreover, the expression, protein levels and green fluorescent protein (GFP) fluorescence associated with VIT were decreased soon after Mn treatment and recovered after 24h. Combined, these data suggest that the delay in egg-production is likely regulated by DAF-16 and followed by the inhibition of VIT transport activity. Further studies are needed to clarify the mechanisms associated with Mn-induced DAF-16 activation. Copyright © 2016 Elsevier Inc. All rights reserved.
Dayal, Navami; Thakur, Mansee; Patil, Poonam; Singh, Dipty; Vanage, Geeta; Joshi, D. S.
2016-10-01
Gold nanoparticles (AuNPs) have attracted a lot of attention due to their usage in consumer- and therapy-based biomedical applications. These particles are frequently the medium-sized particles within the range of 10-50 nm. A number of scientific reports have addressed the cytotoxic potential of these NPs. However, their genotoxic potential with respect to reproductive aspects remains unclear. For assessment of safety and risks associated with AuNPs to female reproductive system, adult female zebrafish (Danio rerio) were exposed in vivo to 20 μg/g/day of AuNPs of two different sizes. AuNPs of 15 nm (type I) and 47 nm (type II) in diameters were administered orally to female zebrafish for a period of 28 days (chronic). The ability of these AuNPs to gain access to female reproductive organs was confirmed by their accumulation pattern through inductive coupled plasma mass spectroscopy. Gonads were assessed for changes in ovarian morphology at histopathological level followed by the confirmation of bioaccumulation of AuNPs using transmission electron microscopy. Using comet assay, strand breaks in DNA of ovarian cells were investigated. Chronic exposure to type I and II AuNPs showed distinctive patterns of bioaccumulation in ovaries. Interestingly, accumulated NPs resulted in gross cellular alterations in different cell types of ovarian tissue. Comet assay analysis revealed extensive number of strand breaks in ovarian cells from the NP exposed fishes. In conclusion, AuNPs ranging between 10 and 50 nm are capable of gaining access to ovaries of zebrafish and potential enough to cause strand breaks in ovarian cells. The findings of the present study highlight the adverse effects of these NPs to female reproductive system. It opens up further avenues for research on effects of these NPs on F1 generation descending from the exposed fishes.
Energy Technology Data Exchange (ETDEWEB)
Dayal, Navami, E-mail: navamidayal@gmail.com [MGM Institute of Health Sciences, Department of Medical Genetics (India); Thakur, Mansee, E-mail: mansibiotech79@gmail.com [MGM Institute of Health Sciences and College of Engineering and Technology, Department of Medical Biotechnology and Central Research Laboratory (India); Patil, Poonam, E-mail: poonamparth14@yahoo.in [MGM Institute of Health Sciences, Department of Medical Biotechnology (India); Singh, Dipty, E-mail: diptyasingh@gmail.com; Vanage, Geeta, E-mail: geetavanage@gmail.com [National Institute of Research in Reproductive Health (ICMR), National Centre for Preclinical Reproductive and Genetic Toxicology (NIRRH) (India); Joshi, D. S. [MGM Institute of Health Sciences, Department of Medical Genetics (India)
2016-10-15
Gold nanoparticles (AuNPs) have attracted a lot of attention due to their usage in consumer- and therapy-based biomedical applications. These particles are frequently the medium-sized particles within the range of 10–50 nm. A number of scientific reports have addressed the cytotoxic potential of these NPs. However, their genotoxic potential with respect to reproductive aspects remains unclear. For assessment of safety and risks associated with AuNPs to female reproductive system, adult female zebrafish (Danio rerio) were exposed in vivo to 20 μg/g/day of AuNPs of two different sizes. AuNPs of 15 nm (type I) and 47 nm (type II) in diameters were administered orally to female zebrafish for a period of 28 days (chronic). The ability of these AuNPs to gain access to female reproductive organs was confirmed by their accumulation pattern through inductive coupled plasma mass spectroscopy. Gonads were assessed for changes in ovarian morphology at histopathological level followed by the confirmation of bioaccumulation of AuNPs using transmission electron microscopy. Using comet assay, strand breaks in DNA of ovarian cells were investigated. Chronic exposure to type I and II AuNPs showed distinctive patterns of bioaccumulation in ovaries. Interestingly, accumulated NPs resulted in gross cellular alterations in different cell types of ovarian tissue. Comet assay analysis revealed extensive number of strand breaks in ovarian cells from the NP exposed fishes. In conclusion, AuNPs ranging between 10 and 50 nm are capable of gaining access to ovaries of zebrafish and potential enough to cause strand breaks in ovarian cells. The findings of the present study highlight the adverse effects of these NPs to female reproductive system. It opens up further avenues for research on effects of these NPs on F{sub 1} generation descending from the exposed fishes.
International Nuclear Information System (INIS)
Dayal, Navami; Thakur, Mansee; Patil, Poonam; Singh, Dipty; Vanage, Geeta; Joshi, D. S.
2016-01-01
Gold nanoparticles (AuNPs) have attracted a lot of attention due to their usage in consumer- and therapy-based biomedical applications. These particles are frequently the medium-sized particles within the range of 10–50 nm. A number of scientific reports have addressed the cytotoxic potential of these NPs. However, their genotoxic potential with respect to reproductive aspects remains unclear. For assessment of safety and risks associated with AuNPs to female reproductive system, adult female zebrafish (Danio rerio) were exposed in vivo to 20 μg/g/day of AuNPs of two different sizes. AuNPs of 15 nm (type I) and 47 nm (type II) in diameters were administered orally to female zebrafish for a period of 28 days (chronic). The ability of these AuNPs to gain access to female reproductive organs was confirmed by their accumulation pattern through inductive coupled plasma mass spectroscopy. Gonads were assessed for changes in ovarian morphology at histopathological level followed by the confirmation of bioaccumulation of AuNPs using transmission electron microscopy. Using comet assay, strand breaks in DNA of ovarian cells were investigated. Chronic exposure to type I and II AuNPs showed distinctive patterns of bioaccumulation in ovaries. Interestingly, accumulated NPs resulted in gross cellular alterations in different cell types of ovarian tissue. Comet assay analysis revealed extensive number of strand breaks in ovarian cells from the NP exposed fishes. In conclusion, AuNPs ranging between 10 and 50 nm are capable of gaining access to ovaries of zebrafish and potential enough to cause strand breaks in ovarian cells. The findings of the present study highlight the adverse effects of these NPs to female reproductive system. It opens up further avenues for research on effects of these NPs on F_1 generation descending from the exposed fishes.
Social behavior of the Paguridae and Diogenidae of Curaçao
Hazlett, Brian A.
1966-01-01
1. The social behavior patterns of twelve species of hermit crabs found in the waters around Curaçao, N.A. are described. All species showed marked similarity in their aggressive displays, the most common of which are movements of the appendages, called here the ambulatory raise and cheliped
Shu, Xiaoyun; Tang, Yuping; Jiang, Chenxue; Shang, Erxing; Fan, Xinshen; Ding, Anwei
2012-11-01
A high performance liquid chromatographic (HPLC) method with diode array detection (DAD) was established for simultaneous determination of seven main bioactive components in San-ao decoction and its series of formulae (San-ao decoction, Wu-ao decoction, Qi-ao decoction and Jia-wei San-ao decoction). Seven compounds were analyzed simultaneously with a XTerra C(18) column (4.6 mm × 250 mm, 5 µm) using a linear gradient elution of a mobile phase containing acetonitrile (A) and a buffer solution (0.02 mol/L potassium dihydrogen phosphate and adjusted to pH 3 using phosphoric acid) (B); the flow rate was 1.0 mL/min. The sample was detected with DAD at 210, 254 and 360 nm and the column was maintained at 30 °C. All the compounds showed good linearity (r2 > 0.9984) in the tested concentration range. The precisions were evaluated by intra-day and inter-day tests, and relative standard deviation (R.S.D.) values within the range of 0.83%–2.53% and 0.64%–2.77% were reported, respectively. The recoveries of the quantified compounds were observed to cover a range from 95.34% and 104.82% with R.S.D. values less than 2.72%. The validated method was successfully applied for the simultaneous determination of seven main bioactive components including ephedrine (1), amygdalin (2), liquiritin (3), benzoic acid (4), isoliquiritin (5), formononetin (6) and glycyrrhizic acid (7) in San-ao decoction and its series of formulae. The results also showed a wide variation in the content of the identified active compounds in these samples, which could also be helpful to illustrate the drug interactions after some herbs combined in different formulations.
NCBI nr-aa BLAST: CBRC-DYAK-02-0020 [SEVENS
Lifescience Database Archive (English)
Full Text Available 12 (potassium/chloride transporters), member 9 (SLC12A9) [Danio rerio] emb|CAM14083.1| novel protein to ver...tebrate solute carrier family 12 (potassium/chloride transporters), member 9 (SLC12A9) [Danio rerio] CAM14224.1 1e-123 51% ...
NCBI nr-aa BLAST: CBRC-DRER-16-0034 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-16-0034 ref|NP_956704.1| solute carrier family 16 (monocarboxylic acid transporters...), member 9a [Danio rerio] gb|AAH54615.1| Solute carrier family 16 (monocarboxylic acid transporters), member 9a [Danio rerio] NP_956704.1 3e-83 51% ...
Customer satisfaction and response to AOS
1999-01-01
Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...
Subaru/SCExAO First-light Direct Imaging of a Young Debris Disk around HD 36546
Energy Technology Data Exchange (ETDEWEB)
Currie, Thayne; Guyon, Olivier; Kudo, Tomoyuki; Jovanovic, Nemanja; Lozi, Julien [National Astronomical Observatory of Japan, Subaru Telescope, National Institutes of Natural Sciences, Hilo, HI 96720 (United States); Tamura, Motohide; Kuzuhara, Masayuki [Astrobiology Center, National Institutes of Natural Sciences, 2-21-1 Osawa, Mitaka, Tokyo (Japan); Schlieder, Joshua E. [IPAC-NExScI, Mail Code 100-22, Caltech, 1200 E. California Boulevard, Pasadena, CA 91125 (United States); Brandt, Timothy D. [Astrophysics Department, Institute for Advanced Study, Princeton, NJ (United States); Kuhn, Jonas [Institute for Astronomy, ETH-Zurich, Wolfgang-Pauli-Str. 27, 8093 Zurich (Switzerland); Serabyn, Eugene; Singh, Garima [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA (United States); Janson, Markus [Department of Astronomy, Stockholm University, AlbaNova University Center, SE-106 91 Stockholm (Sweden); Carson, Joseph [Department of Physics and Astronomy, College of Charleston, 66 George Street, Charleston, SC (United States); Groff, Tyler; Kasdin, N. Jeremy [Department of Mechanical and Aerospace Engineering, Princeton University, Princeton, NJ (United States); McElwain, Michael W.; Grady, Carol [Exoplanets and Stellar Astrophysics Laboratory, Code 667, NASA-Goddard Space Flight Center, Greenbelt, MD (United States); Uyama, Taichi [Department of Astronomy, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo (Japan); Akiyama, Eiji [Chile Observatory, National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo (Japan); and others
2017-02-10
We present H -band scattered light imaging of a bright debris disk around the A0 star HD 36546 obtained from the Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) system with data recorded by the HiCIAO camera using the vector vortex coronagraph. SCExAO traces the disk from r ∼ 0.″3 to r ∼1″ (34–114 au). The disk is oriented in a near east–west direction (PA ∼ 75°), is inclined by i ∼ 70°–75°, and is strongly forward-scattering (g > 0.5). It is an extended disk rather than a sharp ring; a second, diffuse dust population extends from the disk’s eastern side. While HD 36546 intrinsic properties are consistent with a wide age range (t ∼ 1–250 Myr), its kinematics and analysis of coeval stars suggest a young age (3–10 Myr) and a possible connection to Taurus-Auriga’s star formation history. SCExAO’s planet-to-star contrast ratios are comparable to the first-light Gemini Planet Imager contrasts; for an age of 10 Myr, we rule out planets with masses comparable to HR 8799 b beyond a projected separation of 23 au. A massive icy planetesimal disk or an unseen super-Jovian planet at r > 20 au may explain the disk’s visibility. The HD 36546 debris disk may be the youngest debris disk yet imaged, is the first newly identified object from the now-operational SCExAO extreme AO system, is ideally suited for spectroscopic follow-up with SCExAO/CHARIS in 2017, and may be a key probe of icy planet formation and planet–disk interactions.
Subaru/SCExAO First-light Direct Imaging of a Young Debris Disk around HD 36546
International Nuclear Information System (INIS)
Currie, Thayne; Guyon, Olivier; Kudo, Tomoyuki; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kuzuhara, Masayuki; Schlieder, Joshua E.; Brandt, Timothy D.; Kuhn, Jonas; Serabyn, Eugene; Singh, Garima; Janson, Markus; Carson, Joseph; Groff, Tyler; Kasdin, N. Jeremy; McElwain, Michael W.; Grady, Carol; Uyama, Taichi; Akiyama, Eiji
2017-01-01
We present H -band scattered light imaging of a bright debris disk around the A0 star HD 36546 obtained from the Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) system with data recorded by the HiCIAO camera using the vector vortex coronagraph. SCExAO traces the disk from r ∼ 0.″3 to r ∼1″ (34–114 au). The disk is oriented in a near east–west direction (PA ∼ 75°), is inclined by i ∼ 70°–75°, and is strongly forward-scattering (g > 0.5). It is an extended disk rather than a sharp ring; a second, diffuse dust population extends from the disk’s eastern side. While HD 36546 intrinsic properties are consistent with a wide age range (t ∼ 1–250 Myr), its kinematics and analysis of coeval stars suggest a young age (3–10 Myr) and a possible connection to Taurus-Auriga’s star formation history. SCExAO’s planet-to-star contrast ratios are comparable to the first-light Gemini Planet Imager contrasts; for an age of 10 Myr, we rule out planets with masses comparable to HR 8799 b beyond a projected separation of 23 au. A massive icy planetesimal disk or an unseen super-Jovian planet at r > 20 au may explain the disk’s visibility. The HD 36546 debris disk may be the youngest debris disk yet imaged, is the first newly identified object from the now-operational SCExAO extreme AO system, is ideally suited for spectroscopic follow-up with SCExAO/CHARIS in 2017, and may be a key probe of icy planet formation and planet–disk interactions.
International Nuclear Information System (INIS)
Hsia, Chien-Chung; Huang, Fu-Lei; Hung, Guang-Uei; Shen, Lie-Hang; Chen, Chuan-Lin; Wang, Hsin-Ell
2011-01-01
Objectives: Tumor growth beyond the region where vascular oxygen can reach creates a hypoxic domain. In this study, BnAO, a ligand that had been labeled with 99m Tc-pertechnetate for hypoxia imaging, was conjugated with 2-nitroimidazole to give 3,3,10,10-tetramethyl-1-(2-nitro-1H-imidazo-1-y1)-4,9-diazadodecane-2,11- dionedioxime (BnAO-NI) as a potential ligand for hypoxia detection. Pentoxifylline is a peripheral vasodilator and has been used as a radiosensitizer in tumor radiotherapy. 99m Tc-BnAO-NI/SPECT was applied to noninvasively assess the pharmacological effect of pentoxifylline in reducing tumor hypoxia in vivo. Methods: BnAO-NI was synthesized and formulated with methylene diphosphonate (MDP), stannous chloride and carbonate buffer to afford kits. After mixing with 99m Tc-pertechnetate, 99m Tc-BnAO-NI injection can be readily prepared. The partition coefficient, radiochemical purity and in vitro stability were determined. Cellular uptake of radiotracers in KHT cells under hypoxia was conducted in a CO 2 incubator at 37 o C under hypoxia or normoxia. A biodistribution study after intravenous injection of 99m Tc-BnAO-NI in KHT sarcoma-implanted C3H mice was performed. The effect of pentoxifylline (100 mg/kg) on reducing tumor hypoxia was also studied. Results: The radiochemical purity (RCP) of the 99m Tc-BnAO-NI preparation was greater than 96% and stable at ambient temperature for 24 h (RCP>90%). The accumulation of 99m Tc-BnAO-NI and 99m Tc-BnAO in KHT cells under hypoxia were 3.57 and 4.13-fold higher than those under normoxic environment, indicating unambiguous oxygen-dependent uptakes of these two probes. The distribution of 99m Tc-BnAO-NI in KHT sarcoma-bearing mice revealed rapid clearance from the blood circulation. The tumor uptake peaked at 2 h post-injection (0.32±0.05%ID/g) with tumor-to-blood and tumor-to-muscle ratios of 10.32 and 3.96, respectively. The effect of pentoxifylline on the tumor blood perfusion was obvious. The tumor
Freshwater Bryozoa (Phylactolaemata) from Curaçao, Aruba and Bonaire
Lacourt, A.W.
1955-01-01
The Phylactolaemata-fauna of Curaçao, Aruba and Bonaire, as it appears from the samples collected by dr P. Wagenaar Hummelinck, is connected with the fauna of the South-American mainland. The material belongs to three species only: Hyalinella agilis — Curaçao, Aruba, Bonaire — in temporary or
High-Performance CCSDS AOS Protocol Implementation in FPGA
Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson
2010-01-01
The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.
African Journals Online: Curaçao
African Journals Online (AJOL)
... Cambodia, Cameroon, Canada, Cayman Islands, Central African Republic, Chad, Chile, China, Colombia, Comoros, Congo, Democratic Republic, Congo, Republic, Costa Rica, Côte d'Ivoire, Croatia, Cuba, Curaçao, Cyprus, Czech Republic, Denmark, Djibouti, Dominica, Dominican Republic, Ecuador, Egypt, Arab Rep.
Wandelli, Leonardo Vieira
2016-01-01
Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas ...
As sementes geneticamente modificadas e o direito ao desenvolvimento
Directory of Open Access Journals (Sweden)
Milena Barbosa Melo
2017-12-01
Full Text Available O presente artigo apresenta como objeto de investigação a ligação entre os direitos da propriedade intelectual no contexto dos organismos geneticamente modificados (OGM´S. Objetivou-se, especificamente, responder inquietações acerca dos danos reais para os consumidores, bem como o lucro para as empresas multinacionais, sem desconsiderar, ainda, os efetivos danos ao meio ambiente e à saúde. Utilizou metodologia pautada em pesquisa bibliográfica e documental a partir do método hermenêutico fazendo uso da interpretação judicial-histórica. Conclui pela relevância da temática para efetivação do direito ao desenvolvimento, bem como pela urgência de uma regulamentação da biossegurança, de forma a permitir melhor sustentação aos OGM´s.
Resistências aos Antibióticos em Pneumologia
Directory of Open Access Journals (Sweden)
J.G. Saraiva da Cunha
1999-01-01
Full Text Available RESUMO: A crescente resistência dos microrganismos aos agentes antimicrobianos tem motivado o interesse da comunidade científica com o objectivo de avaliar a dimensão do problema, perceber a sua origem e encontrar eveotuais soluções. São quatro os mecanismos basicos de resistência das bácterias aos antibióticos: inactivação enzimática, alteração ou excesso de produção das molécules alvo, diminuição da permeabilidade da parede celulalr e eliminação actia (eflauxo do antibiótico para o exterior da bactéria. Para cada uma das diferentes classes de antibioticos sio referidos os priocipais mecanismos de resisteocia, assim como se exemplifica quais os germes de particular relevância em pneumologia que maiores dificuldades terapêuticas actualmente colocam. Finalmente enumeram-se algumas medidas para contrariar a expansão do problema. Palavras-Chave: Resistências aos antibióticos, Pneumologia, Pneumococo
Dicty_cDB: Contig-U08780-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Y4) RecName: Full=Uncharacterized protein DDB_G0276777; &A... 138 5e-31 BC077988_1( BC077988 |pid:none) Xenopus laevis achalasia...s... 84 1e-17 BC067671_1( BC067671 |pid:none) Danio rerio achalasia, adrenocorti... 82 4e-17 AY891872_1( AY8...509 |pid:none) Homo sapiens mRNA for achalasia, a... 79 2e-16 (Q9NRG9) RecName: Full=Aladin; AltName: Full=A... BC120418_1( BC120418 |pid:none) Bos taurus achalasia, adrenocortic... 80 3e-16 E
ENSAIO: HOMENAGEM AO PROFESSOR REINIER ROZESTRATEN
Directory of Open Access Journals (Sweden)
Antonio C. R. Tupinambá
2014-02-01
Full Text Available Trata-se de uma homenagem póstuma ao Professor Doutor Reinier Rozestraten. O texto apresenta, suscintamente, o percurso acadêmico do nomeado professor, em especial a sua passagem pela Psicologia do Trânsito. Paralelamente discorre sobre sua principal obra na área, que, de certo modo introduz o discurso psicológico sobre o comportamento de trânsito em perspectiva nacional, juntamente com sua preocupação em imprimir um caráter científico ao tema e introduzi-lo no contexto da academia e na sociedade em perspectivas teórica e prática. A obra escolhida é considerada um marco para o estabelecimento teórico da disciplina da psicologia do trânsito no Brasil. A homenagem foi originalmente escrita por ocasião dos cinco anos de falecimento do professor Reinier.
The reliability of AO classification for distal radius fracture, using CT findings
International Nuclear Information System (INIS)
Nakanishi, Yasuaki; Ono, Hiroshi; Furuta, Kazuhiko; Fujitani, Ryoutarou; Ota, Hiroyoshi
2006-01-01
The purpose of this study was to assess the reliability of the AO (Association for the Study of Internal Fixation) classification of distal radius fracture, using plain radiographs and 2 cross-sectional computed tomographic (CT) surface images. Five observers independently classified 32 distal radius fractures into 9 groups under AO classification. We established 4 methods for observation. First, using only two-directional radiographs; second, four-directional radiographs; third, CT (axial view) with four-directional radiographs; and fourth, CT (axial and sagittal views) with four-directional radiographs. Kappa statistics were used to establish the relative level of agreement between the observers. Interobserver reliability was poor in both first and second methods in which only plain radiographs were used (κ=0.30 and 0.23, respectively). Furthermore, reliability did not increase in the third method with the addition of 1 CT surface image (κ=0.29). In the fourth method, with the addition of 2 cross-sectional CT surface images, the reliability increased to a moderate level (κ=0.44). Interobserver reliability of the AO system of the classification of distal radius fractures was observed on using 2 cross-sectional CT surface images with four-directional radiographs. (author)
Directory of Open Access Journals (Sweden)
Fernanda Lucia Colla
2014-04-01
Full Text Available Os objetivos do trabalho foram avaliar o perfil de sensibilidade a antimicrobianos e a eficácia de três sanitizantes frente a isolados de Salmonella spp. oriundos de carcaças na tecnologia de abate de suínos. Avaliaram-se 120 amostras, das quais 39 foram positivas para Salmonella spp. Os princípios ativos testados foram penicilina G 10 U, amoxicilina + ácido clavulânico 30mcg, ampicilina 10mcg, cloranfenicol 30mcg, tetraciclina 30mcg, estreptomicina 10mcg, neomicina 30mcg, gentamicina 10mcg, enrofloxacina 5mcg, sulfazotrim 25mcg, sulfonamida 300mcg e trimetropima 5mcg. Nos testes com sanitizantes utilizaram-se clorexidina, amônia quaternária e ácido peracético com tempos de contato de um, cinco, 10 e 15 minutos. Os índices de resistência aos antimicrobianos foram de 100% para penicilina, 94,9% para tetraciclina, 89,7% para trimetropima e 87,2% para ampicilina. Nenhum dos princípios ativos foi 100% eficaz frente aos isolados testados, observando-se melhor ação para amoxicilina+ácido clavulânico (86,7%, neomicina (86,7% e cloranfenicol (64,1%. Nos testes de eficácia dos sanitizantes, o ácido peracético a 0.5% foi efetivo a partir de 10 minutos (94,6% e 15 minutos (97,3% de contato; amônia quaternária a 1% por 10 minutos (89,2% e 15 minutos (97,3% e clorexidina a 0.5% por 10 minutos (70,3% e 15 minutos de contato (72,8%. Todas as amostras testadas apresentaram multirresistência e seis (15,3% apresentaram resistência à ampicilina, cloranfenicol, estreptomicina, sulfonamida e tetraciclina (denominado grupo ACSSuT, indicando a necessidade de monitorar a propagação da resistência aos antimicrobianos em Salmonella spp. oriundas de suínos. O sanitizante mais efetivo frente aos isolados testados foi o ácido peracético a 0.5% por 15 minutos, reforçando a necessidade de monitorar também a efetividade de produtos sanitizantes frente aos isolados de Salmonella spp.
Energy Technology Data Exchange (ETDEWEB)
Hsia, Chien-Chung [Institute of Biomedical imaging and Radiological Sciences, National Yang-Ming University, Taiwan (China); Institute of Nuclear Energy Research, Taiwan (China); Huang, Fu-Lei [Institute of Nuclear Energy Research, Taiwan (China); Hung, Guang-Uei [Department of Nuclear Medicine, Chang-Bing Show Chwan Hospital, Taiwan (China); Shen, Lie-Hang [Institute of Nuclear Energy Research, Taiwan (China); Chen, Chuan-Lin, E-mail: clchen2@ym.edu.t [Institute of Biomedical imaging and Radiological Sciences, National Yang-Ming University, Taiwan (China); Wang, Hsin-Ell, E-mail: hewang@ym.edu.t [Institute of Biomedical imaging and Radiological Sciences, National Yang-Ming University, Taiwan (China)
2011-04-15
Objectives: Tumor growth beyond the region where vascular oxygen can reach creates a hypoxic domain. In this study, BnAO, a ligand that had been labeled with {sup 99m}Tc-pertechnetate for hypoxia imaging, was conjugated with 2-nitroimidazole to give 3,3,10,10-tetramethyl-1-(2-nitro-1H-imidazo-1-y1)-4,9-diazadodecane-2,11- dionedioxime (BnAO-NI) as a potential ligand for hypoxia detection. Pentoxifylline is a peripheral vasodilator and has been used as a radiosensitizer in tumor radiotherapy. {sup 99m}Tc-BnAO-NI/SPECT was applied to noninvasively assess the pharmacological effect of pentoxifylline in reducing tumor hypoxia in vivo. Methods: BnAO-NI was synthesized and formulated with methylene diphosphonate (MDP), stannous chloride and carbonate buffer to afford kits. After mixing with {sup 99m}Tc-pertechnetate, {sup 99m}Tc-BnAO-NI injection can be readily prepared. The partition coefficient, radiochemical purity and in vitro stability were determined. Cellular uptake of radiotracers in KHT cells under hypoxia was conducted in a CO{sub 2} incubator at 37 {sup o}C under hypoxia or normoxia. A biodistribution study after intravenous injection of {sup 99m}Tc-BnAO-NI in KHT sarcoma-implanted C3H mice was performed. The effect of pentoxifylline (100 mg/kg) on reducing tumor hypoxia was also studied. Results: The radiochemical purity (RCP) of the {sup 99m}Tc-BnAO-NI preparation was greater than 96% and stable at ambient temperature for 24 h (RCP>90%). The accumulation of {sup 99m}Tc-BnAO-NI and {sup 99m}Tc-BnAO in KHT cells under hypoxia were 3.57 and 4.13-fold higher than those under normoxic environment, indicating unambiguous oxygen-dependent uptakes of these two probes. The distribution of {sup 99m}Tc-BnAO-NI in KHT sarcoma-bearing mice revealed rapid clearance from the blood circulation. The tumor uptake peaked at 2 h post-injection (0.32{+-}0.05%ID/g) with tumor-to-blood and tumor-to-muscle ratios of 10.32 and 3.96, respectively. The effect of pentoxifylline on the
Holocene Evolution of Qing'ao Embayment, Southern China
Switzer, A. D.; Yu, F.; Chen, B.; Zheng, Z.; Wang, D.
2012-12-01
The Holocene evolution of the Qing'ao embayment, Nan'ao Island, southern China, is primarily the result of the interaction of tectonic activity, climate variation and changes in relative sea level. Characterizing the evolutionary history of the relatively small Qing'ao embayment during the Holocene will help improve our understanding of the driving mechanisms of coastal evolution in the area. To reconstruct the Holocene evolution history we analyzed the grain size, loss on ignition (LOI) and carbonate content of modern and core samples. Modern environmental analogs were examined in surface samples ranging from the coastal sand dunes through to offshore. The results of these modern samples suggest that dune sand (mean size of ~2.33Phi) are slightly finer than beach sand (mean size of 2.13Phi), and nearshore sediment is much coarser than offshore sediment (mean size of 5.90Phi). This modern analogs were then applied to 8 percussion cores from the Qing'ao embayment. A chronological framework obtained from 11 radiocarbon samples suggests that the embayment started to accept deposition since early Holocene, ~8500 cal. yr. BP. Three main phases of Holocene evolution were identified. A basin wide shell-rich sand sheet forms the basal Holocene facies and overlies clay rich presumably Pleistocene sediments or bedrock. This facies records an initial sedimentation phase associated with the early Holocene transgression into the embayment (~8500-6000 cal. yr. BP). The basal facies grades upward to a mixed sandy-mud facies which includes lagoonal clayey-silts, flood tide delta sands and records an estuarine phase lasting from ~6000-1000 cal. yr. BP that appears coincident with falling regional sea levels. Coincident with the estuarine phase is a period of coastal dune building recorded as yet undated massive sands that are found in the upper fill. Toward the end of the estuarine phase it is apparent that dune migration has restricted the lagoon entrance and that this was
Directory of Open Access Journals (Sweden)
Bron Ilana Urbano
2002-01-01
Full Text Available O presente trabalho objetivou avaliar as características anatômicas e físico-químicas de pêssegos (Prunus persica (L. Batsch 'Aurora-1' e 'Dourado-2', armazenados em diferentes temperaturas e períodos. No primeiro experimento, os frutos foram armazenados a 0, 3 e 6masculineC por 14, 21, 28 e 35 dias (mais dois dias de simulação à comercialização, sob 25masculineC. No segundo experimento, os frutos foram armazenados a 0 e 3masculineC por 7, 14, 21, 28 e 35 dias (mais dois dias de simulação à comercialização, sob 25masculineC. O delineamento experimental empregado foi inteiramente ao acaso, em esquema fatorial, com quatro repetições em parcelas de seis frutos. Pêssegos 'Dourado-2', após sete dias de armazenamento a 3masculineC ou 14 dias de armazenamento a 0masculineC, apresentaram lanosidade caracterizada pela queda brusca na firmeza e pouca sucosidade. Os sintomas no mesocarpo foram caracterizados pelo afastamento das paredes de células adjacentes e acúmulo de substâncias pécticas no interior das células e dos espaços intercelulares. Pêssegos 'Aurora-1' sofreram redução na firmeza sem comprometer a qualidade dos frutos, podendo ser conservados por até 35 dias a 0 e 3masculineC; mesmo aos 35 dias de armazenamento, o mesocarpo não apresentou alterações típicas da lanosidade. Aos 35 dias de armazenamento a 6masculineC, os frutos de ambas cultivares estavam sobremaduros.
Chen, Ting; Zhang, Lv-Ping; Wong, Nai-Kei; Zhong, Ming; Ren, Chun-Hua; Hu, Chao-Qun
2014-03-01
Ovarian maturation in crustaceans is temporally orchestrated by two processes: oogenesis and vitellogenesis. The peptide hormone vitellogenesis-inhibiting hormone (VIH), by far the most potent negative regulator of crustacean reproduction known, critically modulates crustacean ovarian maturation by suppressing vitellogenin (VTG) synthesis. In this study, cDNA encoding VIH was cloned from the eyestalk of Pacific white shrimp, Litopenaeus vannamei, a highly significant commercial culture species. Phylogenetic analysis suggests that L. vannamei VIH (lvVIH) can be classified as a member of the type II crustacean hyperglycemic hormone family. Northern blot and RT-PCR results reveal that both the brain and eyestalk were the major sources for lvVIH mRNA expression. In in vitro experiments on primary culture of shrimp hepatopancreatic cells, it was confirmed that some endogenous inhibitory factors existed in L. vannamei hemolymph, brain, and eyestalk that suppressed hepatopancreatic VTG gene expression. Purified recombinant lvVIH protein was effective in inhibiting VTG mRNA expression in both in vitro primary hepatopancreatic cell culture and in vivo injection experiments. Injection of recombinant VIH could also reverse ovarian growth induced by eyestalk ablation. Furthermore, unilateral eyestalk ablation reduced the mRNA level of lvVIH in the brain but not in the remaining contralateral eyestalk. Our study, as a whole, provides new insights on VIH regulation of shrimp reproduction: 1) the brain and eyestalk are both important sites of VIH expression and therefore possible coregulators of hepatopancreatic VTG mRNA expression and 2) eyestalk ablation could increase hepatopancreatic VTG expression by transcriptionally abolishing eyestalk-derived VIH and diminishing brain-derived VIH.
Intra- and interobserver reliability of glenoid fracture classifications by Ideberg, Euler and AO.
Gilbert, F; Eden, L; Meffert, R; Konietschke, F; Lotz, J; Bauer, L; Staab, W
2018-03-27
Representing 3%-5% of shoulder girdle injuries scapula fractures are rare. Furthermore, approximately 1% of scapula fractures are intraarticularfractures of the glenoid fossa. Because of uncertain fracture morphology and limited experience, the treatment of glenoid fossa fractures is difficult. The glenoid fracture classification by Ideberg (1984) and Euler (1996) is still commonly used in literature. In 2013 a new glenoid fracture classification was introduced by the AO. The purpose of this study was to examine the new AO classification in clinical practice in comparison with the classifications by Ideberg and Euler. In total CT images of 84 patients with glenoid fossa fractures from 2005 to 2018 were included. Parasagittal, paracoronary and axial reconstructions were examined according to the classifications of Ideberg, Euler and the AO by 3 investigators (orthopedic surgeon, radiologist, student of medicine) at three individual time settings. Inter- and intraobserver reliability of the three classification systems were ascertained by computing Inter- and Intraclass (ICCs) correlation coefficients using Spearman's rank correlation coefficient, 95%-confidence intervals as well as F-tests for correlation coefficients. Inter- and intraobserver reliability for the AO classification showed a perspicuous coherence (R = 0.74 and R = 0.79). Low to moderate intraobserver reliability for Ideberg (R = 0.46) and Euler classification (R = 0.41) was found. Furthermore, data show a low Interobserver reliability for both Ideberg and Euler classification (R reliability using AO is significantly higher than those using Ideberg and Euler (p reliable grading of glenoid fossa fractures with high inter- and intraobserver reliability in 84 patients using CT images. It should possibly be applied in order to enable a valid, reliable and consistent academic description of glenoid fossa fractures. The established classifications by Euler and Ideberg are not capable of
Scrambled eggs: Proteomic portraits and novel biomarkers of egg quality in zebrafish (Danio rerio.
Directory of Open Access Journals (Sweden)
Ozlem Yilmaz
Full Text Available Egg quality is a complex biological trait and a major determinant of reproductive fitness in all animals. This study delivered the first proteomic portraits of egg quality in zebrafish, a leading biomedical model for early development. Egg batches of good and poor quality, evidenced by embryo survival for 24 h, were sampled immediately after spawning and used to create pooled or replicated sample sets whose protein extracts were subjected to different levels of fractionation before liquid chromatography and tandem mass spectrometry. Obtained spectra were searched against a zebrafish proteome database and detected proteins were annotated, categorized and quantified based on normalized spectral counts. Manually curated and automated enrichment analyses revealed poor quality eggs to be deficient of proteins involved in protein synthesis and energy and lipid metabolism, and of some vitellogenin products and lectins, and to have a surfeit of proteins involved in endo-lysosomal activities, autophagy, and apoptosis, and of some oncogene products, lectins and egg envelope proteins. Results of pathway and network analyses suggest that this aberrant proteomic profile results from failure of oocytes giving rise to poor quality eggs to properly transit through final maturation, and implicated Wnt signaling in the etiology of this defect. Quantitative comparisons of abundant proteins in good versus poor quality eggs revealed 17 candidate egg quality markers. Thus, the zebrafish egg proteome is clearly linked to embryo developmental potential, a phenomenon that begs further investigation to elucidate the root causes of poor egg quality, presently a serious and intractable problem in livestock and human reproductive medicine.
Scrambled eggs: Proteomic portraits and novel biomarkers of egg quality in zebrafish (Danio rerio).
Yilmaz, Ozlem; Patinote, Amélie; Nguyen, Thao Vi; Com, Emmanuelle; Lavigne, Regis; Pineau, Charles; Sullivan, Craig V; Bobe, Julien
2017-01-01
Egg quality is a complex biological trait and a major determinant of reproductive fitness in all animals. This study delivered the first proteomic portraits of egg quality in zebrafish, a leading biomedical model for early development. Egg batches of good and poor quality, evidenced by embryo survival for 24 h, were sampled immediately after spawning and used to create pooled or replicated sample sets whose protein extracts were subjected to different levels of fractionation before liquid chromatography and tandem mass spectrometry. Obtained spectra were searched against a zebrafish proteome database and detected proteins were annotated, categorized and quantified based on normalized spectral counts. Manually curated and automated enrichment analyses revealed poor quality eggs to be deficient of proteins involved in protein synthesis and energy and lipid metabolism, and of some vitellogenin products and lectins, and to have a surfeit of proteins involved in endo-lysosomal activities, autophagy, and apoptosis, and of some oncogene products, lectins and egg envelope proteins. Results of pathway and network analyses suggest that this aberrant proteomic profile results from failure of oocytes giving rise to poor quality eggs to properly transit through final maturation, and implicated Wnt signaling in the etiology of this defect. Quantitative comparisons of abundant proteins in good versus poor quality eggs revealed 17 candidate egg quality markers. Thus, the zebrafish egg proteome is clearly linked to embryo developmental potential, a phenomenon that begs further investigation to elucidate the root causes of poor egg quality, presently a serious and intractable problem in livestock and human reproductive medicine.
Do ensinar ao aprender: o passaporte para o futuro
Almeida, Ana Rita Conceição
2016-01-01
O presente Relatório Final é apresentado no âmbito da conclusão do Mestrado de Educação Pré-Escolar e Ensino do 1.º Ciclo do Ensino Básico. Este documento reflete o caminho percorrido pelas aprendizagens adquiridas e reflexões proporcionadas ao longo dos dois estágios que constituem este Mestrado, sendo que um decorreu em Educação Pré-Escolar e o outro no 1.º Ciclo do Ensino Básico. Este documento divide-se em duas grandes partes estruturantes que constituem o pilar de todo este trabalho. Na ...
Directory of Open Access Journals (Sweden)
Érika Cardoso da Silva Baptista
2016-01-01
Full Text Available Desastres associados ao transporte marinho e terrestre de hidrocarbonetos causam sérios impactos aos ambientes costeiros, afetando a fauna e a flora marinha, além de prejudicar diversas atividades econômicas, inclusive àquelas tradicionais, como é o caso da pesca artesanal. Assim, faz-se necessário conhecer a geologia e a geomorfologia da costa, em especial as praias devido à elevada dinâmica e vulnerabilidade desses ambientes. A construção de megaempreendimentos na zona costeira e o tráfego de navios petroleiros e pequenas embarcações, ou mesmo a implantação de dutos, localizados junto à linha de costa, representam uma ameaça ao equilíbrio dos ecossistemas. Para tal, foram analisados diversos aspectos da geomorfologia costeira de Maricá, para posterior identificação do grau de sensibilidade deste litoral a eventos de derramamento de óleo, a partir do Índice de Sensibilidade Ambiental (ISA proposto pelo Ministério do Meio Ambiente. O litoral de Maricá, ao longo de 34 km de extensão entre Itaipuaçú (no extremo oeste e Ponta Negra (a leste, apresenta quatro áreas distintas quanto à sensibilidade à poluição decorrente de derramamento de óleo, sendo: ISA1, para as áreas de costões rochosos localizados nas extremidades leste e oeste deste litoral; ISA4, para a quase totalidade das praias, formadas por areias quartzosas grossa e média, exceto o extremo-oeste de Itaipuaçú, que possui areia muito grossa e cascalhos sendo, portanto, representada pelo ISA5; e ISA10, para as lagoas costeiras e canais na retaguarda das barreiras arenosas, sujeitas à contaminação por meio dos canais e por transposição por grandes ondas de tempestades. Os índices compreendem os extremos dessa classificação, devido à grande variedade de elementos na paisagem costeira de Maricá e mostra a elevada sensibilidade deste litoral, frente à ameaça de desastres causados por derramamento de óleo.
A Arqueologia do cuidado: da prática ao discurso
Directory of Open Access Journals (Sweden)
Sidi Askofare
2006-06-01
Full Text Available A noção de cuidado, assimilada há muito tempo ao tratamento e, então, ao conceito de terapêutica, retorna, logo depois, nos estudos, pesquisas e reflexões nas ciências humanas. Mas, daí em diante, está emancipado de suas aderências e conotações médicas por serem demasiadamente redutoras. O presente artigo propõe uma arqueologia (no sentido foucaultiano do cuidado &– de suas origens animais às suas formas culturalmente e historicamente definidas &– e põe em evidência a subversão que produz no campo do cuidado &– das práticas aos discursos &– a emergência e a dominação do discurso da ciência.
Dicty_cDB: Contig-U12744-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available i voucher ufs ... 105 1e-21 AY310255_1( AY310255 |pid:none) Docodesmus trinidadensis voucher...4173 |pid:none) Leptofauchea chiloensis elongation... 96 1e-18 EF033524_1( EF033524 |pid:none) Balbiania investiens...AY391422_1( AY391422 |pid:none) Danio rerio eukaryotic translation... 93 7e-18 BC089730_1( BC089730 |pid:none) Xenopus tropical...e-20 FM992689_285( FM992689 |pid:none) Candida dubliniensis CD36 chromo... 102 1e-20 AF240835_1( AF240835 |p...ia uvarioides elongation... 96 7e-19 DQ357217_1( DQ357217 |pid:none) Leishmania braziliensi
Spicer, Olivia Smith; Zmora, Nilli; Wong, Ten-Tsao; Golan, Matan; Levavi-Sivan, Berta; Gothilf, Yoav; Zohar, Yonathan
2017-05-01
Gonadotropin-inhibitory hormone (GNIH) was discovered in quail with the ability to reduce gonadotropin expression/secretion in the pituitary. There have been few studies on GNIH orthologs in teleosts (LPXRFamide (Lpxrfa) peptides), which have provided inconsistent results. Therefore, the goal of this study was to determine the roles and modes of action by which Lpxrfa exerts its functions in the brain-pituitary axis of zebrafish (Danio rerio). We localized Lpxrfa soma to the ventral hypothalamus, with fibers extending throughout the brain and to the pituitary. In the preoptic area, Lpxrfa fibers interact with gonadotropin-releasing hormone 3 (Gnrh3) soma. In pituitary explants, zebrafish peptide Lpxrfa-3 downregulated luteinizing hormone beta subunit and common alpha subunit expression. In addition, Lpxrfa-3 reduced gnrh3 expression in brain slices, offering another pathway for Lpxrfa to exert its effects on reproduction. Receptor activation studies, in a heterologous cell-based system, revealed that all three zebrafish Lpxrfa peptides activate Lpxrf-R2 and Lpxrf-R3 via the PKA/cAMP pathway. Receptor activation studies demonstrated that, in addition to activating Lpxrf receptors, zebrafish Lpxrfa-2 and Lpxrfa-3 antagonize Kisspeptin-2 (Kiss2) activation of Kisspeptin receptor-1a (Kiss1ra). The fact that kiss1ra-expressing neurons in the preoptic area are innervated by Lpxrfa-ir fibers suggests an additional pathway for Lpxrfa action. Therefore, our results suggest that Lpxrfa may act as a reproductive inhibitory neuropeptide in the zebrafish that interacts with Gnrh3 neurons in the brain and with gonadotropes in the pituitary, while also potentially utilizing the Kiss2/Kiss1ra pathway. © The Authors 2017. Published by Oxford University Press on behalf of Society for the Study of Reproduction. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Tsai Tzu-Chun
2012-07-01
Full Text Available Abstract Background Dysmorphogenesis and multiple organ defects are well known in zebrafish (Danio rerio embryos with T-box transcription factor 5 (tbx5 deficiencies, mimicking human Holt-Oram syndrome. Methods Using an oligonucleotide-based microarray analysis to study the expression of special genes in tbx5 morphants, we demonstrated that GH and some GH-related genes were markedly downregulated. Zebrafish embryos microinjected with tbx5-morpholino (MO antisense RNA and mismatched antisense RNA in the 1-cell stage served as controls, while zebrafish embryos co-injected with exogenous growth hormone (GH concomitant with tbx5-MO comprised the treatment group. Results The attenuating effects of GH in tbx5-MO knockdown embryos were quantified and observed at 24, 30, 48, 72, and 96 h post-fertilization. Though the understanding of mechanisms involving GH in the tbx5 functioning complex is limited, exogenous GH supplied to tbx5 knockdown zebrafish embryos is able to enhance the expression of downstream mediators in the GH and insulin-like growth factor (IGF-1 pathway, including igf1, ghra, and ghrb, and signal transductors (erk1, akt2, and eventually to correct dysmorphogenesis in various organs including the heart and pectoral fins. Supplementary GH also reduced apoptosis as determined by a TUNEL assay and decreased the expression of apoptosis-related genes and proteins (bcl2 and bad according to semiquantitative reverse-transcription polymerase chain reaction and immunohistochemical analysis, respectively, as well as improving cell cycle-related genes (p27 and cdk2 and cardiomyogenetic genes (amhc, vmhc, and cmlc2. Conclusions Based on our results, tbx5 knockdown causes a pseudo GH deficiency in zebrafish during early embryonic stages, and supplementation of exogenous GH can partially restore dysmorphogenesis, apoptosis, cell growth inhibition, and abnormal cardiomyogenesis in tbx5 knockdown zebrafish in a paracrine manner.
Aditivos alternativos ao uso de antimicrobianos na alimentação de frangos de corte
Directory of Open Access Journals (Sweden)
Felipe Santos Dalólio
2015-07-01
Full Text Available Objetivou-se com este trabalho avaliar o efeito de diferentes aditivos alternativos aos antimicrobianos promotores de crescimento sobre o desempenho, o rendimento de carcaça e cortes e a qualidade da carne de frangos de corte no período de 1 a 42 dias de idade. Foram utilizadas 480 pintainhas de corte da linhagem Cobb 500, distribuídas em delineamento inteiramente casualizado, com seis tratamentos e quatro repetições de 20 aves cada. Foi avaliado na fase total de criação, 1 a 42 dias, o ganho de peso (GP, a conversão alimentar (CA, o consumo de ração (CR, a viabilidade criatória (VB e o índice de eficiência produtivo (IEP. O rendimento de carcaça e a qualidade da carne foi avaliado aos 42 dias de idade. Avaliou-se as características de perda de peso por cocção (PPC, a maciez objetiva (MO, a capacidade de retenção de água (CRA e o pH. Os parâmetros de desempenho, de rendimento de carcaça e cortes e de qualidade da carne não foram afetados pela suplementação dos diferentes tipos de aditivos alternativos aos antimicrobianos promotores de crescimento (P>0,05. Conclui-se que, os aditivos promotores de crescimento podem ser utilizados na alimentação de frangos de corte, em substituição ao antibiótico, sem comprometer o desempenho e características de carcaça, no período de 1 a 42 dias de idade.
Directory of Open Access Journals (Sweden)
Patrícia Lígia Dantas de Morais
2006-12-01
Full Text Available Este trabalho tem como objetivo avaliar o efeito do 1-MCP no controle do amadurecimento de sapoti. Os frutos foram colhidos no estádio de maturação fisiológico (fruto apto para amadurecer separado da planta-mãe, tratados com 0; 300 e 600 nL L-1 de 1-MCP por 12 horas em câmaras vedadas a 25 ± 2ºC e umidade relativa de 70 ± 5%. Ao término do tratamento com 1-MCP, os frutos foram armazenados por 23 dias nas mesmas condições de temperatura e umidade. As variáveis analisadas foram: perda de massa fresca, aparência externa, firmeza, cor da polpa, acidez titulável, pH, sólidos solúveis e açúcares solúveis totais. O 1-metilciclopropeno (1-MCP retarda o amadurecimento e prolonga a vida útil pós-colheita de sapoti. A concentração de 300 nL.L-1 de 1-MCP apresentou melhores resultados, prolongando a vida útil pós-colheita do sapoti por seis dias.This work aimed to evaluate the effect of different concentrations of 1-MCP on the ripening process of sapodilla. Fruits were harvested at the physiologically mature stage and treated with 0, 300 and 600 nL.L-1 dosages of 1-MCP for 12 hours in hermetically closed chambers at 25 ± 2ºC and 70 ± 5% R.H.. After the 12 h 1-MCP treatment, the fruits were stored for 23 days under the same conditions of temperature and humidity. The parameters analyzed for postharvest quality were: weight loss, external appearance, firmness, pulp color, total titrable acidity, total soluble solids and total soluble sugar content. In sapodilla, 1-MCP delays ripening and prolongs the postharvest shelf life and the 300 nL.L-1 of 1-MCP dosage showed the best results extending the postharvest life of sapodilla in 6 days.
Simon, Olivier; Mottin, Elmina; Geffroy, Benjamin; Hinton, Thomas
2011-01-01
Exposure to metal-contaminated water has been shown to result in a number of reproductive abnormalities in adult and larvae fish, such as failure of oocyte maturation and teratogenic effects. Recently, dietary uptake of metals by fish has been recognized as a critical route of exposure, however, the mechanisms of metal uptake and toxicity are poorly understood and in need of further investigation. The objectives of the present study are to quantify uranium (U dietary transfers from spiked artificial diets) in Danio rerio tissues and embryos, as well as establish its effect on reproduction and embryonic development. Uranium's environmental prominence is currently increasing because of new mining and milling activities. Uranium concentrations range from 0.02 µg/L in natural waters to 2 mg/L. The focus of this study was to examine the trophic transfer and effects of U following exposure modalities (dose, exposure duration 1 to 20 d). Two different isotopes were used to distinguish between chemical and radioactivity toxicity of U. Results showed that U trophic transfer was low (0.52%). Uranium tissue distributions showed that accumulation occurred in digestive organs (liver, digestive tract) following dietary exposure. High levels of U were measured in the gonads (female in particular, >20% of relative burden). High U accumulation levels in eggs indicated maternal transfer of the contaminant. Moreover, U trophic exposure led to a reduction in reproduction success as a function of U accumulated levels. High U exposure conditions strongly reduced the total number of eggs (50%) and their viability at 10 d (reduction of the clutch number, low quality of eggs). © 2010 SETAC.
Performance of a MEMS-based AO-OCT system using Fourier Reconstruction
Energy Technology Data Exchange (ETDEWEB)
Evans, J; Zawadzki, R; Jones, S; Olivier, S; Werner, J S
2009-01-21
Adaptive optics (AO) and optical coherence tomography (OCT) are powerful imaging modalities that, when combined, can provide high-resolution (3.5 {micro}m isotropic), 3-D images of the retina. The AO-OCT system at UC Davis has demonstrated the utility of this technology for microscopic, volumetric, in vivo retinal imaging. The current system uses an AOptix bimorph deformable mirror (DM) for low-order, high-stroke correction and a 140-actuator Boston Micromachines DM for high-order correction. Developments to improve performance or functionality of the instrument are on-going. Based on previous work in system characterization we have focused on improved AO control. We present preliminary results and remaining challenges for a newly implemented Fourier transform reconstructor (FTR). The previously reported error budget analysis is also reviewed and updated, with consideration of how to improve both the amount of residual error and the robustness of the system. Careful characterization of the AO system will lead to improved performance and inform the design of future systems.
Suscetibilidade do capim-colonião e de cultivares de milho ao flúor
Directory of Open Access Journals (Sweden)
Rimena Ramos Domingues
2011-01-01
Full Text Available A emissão de fluoretos à atmosfera oriunda da produção de superfosfatos e de cerâmica tem causado preocupação pelo efeito tóxico às plantas, contudo são poucos os estudos desenvolvidos acerca do problema com espécie de interesse econômico agrícola. Desenvolveu-se o estudo para avaliar o efeito do flúor (F atmosférico em plantas de capim-colonião e de cultivares de milho, utilizando como referência espécies bioindicadoras do tipo sensível e tolerante. As plantas foram expostas à contaminação pelo F atmosférico por curtos períodos durante 32 dias em sistema de nebulização com 0,16 mol L-1 de ácido fluorídrico no ambiente interno de uma câmara (~0,20 mmol m-3 de F, havendo um controle não exposto, com quatro repetições. A exposição das plantas ao F causou aumento da concentração do elemento nas folhas até 60 mg kg-1 para o capim-colonião, e entre 100 mg kg-1 nas folhas novas e 170 mg kg-1 nas folhas velhas para quatro cultivares de milho, o que demonstrou o efeito cumulativo do elemento no ambiente. Sintomas visuais da toxicidade foram observados nas plantas e se caracterizaram pela ocorrência de cloroses e necroses na lâmina foliar. O capim-colonião é uma espécie bastante sensível ao poluente no ar. As cultivares de milho DKB 390 e Ômega 8315 também são mais sensíveis ao F quando comparadas às AG7088 e 2B707. Os teores de clorofila a nas plantas foram mais afetados pelo F em relação aos teores de clorofila b.
Estados Unidos: do Iraque ao Brasil
Directory of Open Access Journals (Sweden)
Virgílio Caixeta Arraes
2010-12-01
Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.
SIG aplicado ao Ensino de Geografia
Dornelles, Liane Maria Azevedo; Universidade do Estado do Rio de Janeiro - UERJ
2009-01-01
Este trabalho descreve as atividades desenvolvidas junto à disciplina eletiva SIG aplicado ao ensino de Geografia. Foram elaboradas aplicações ambientais para os Ensinos Fundamental e Médio, com auxílio dos programas VistaSAGA/UFRJ, SISPLAMTE 5as com GIS, SPRING/INPE e MapServer.
Directory of Open Access Journals (Sweden)
Joselina da Silva
2017-04-01
Full Text Available A década de setenta marca um dos momentos inauguradores, no Brasil, da constituição do corpo como bandeira e afirmação identitária por parte dos movimentos sociais negros. A negritude, em performance inspirada nos movimentos brasileiros dos anos trinta, em São Paulo, tomou a rua nas diversas capitais do país. Eram os movimentos Black Soul e os blocos afros. Os primeiros, aludiam diretamente aos afro estadunidenses; os segundos, por sua vez, cunhados por uma juventude cultural afro-baiana, instituíam uma moda capilar advinda dos trançados de diferentes países do continente africano, somados aos dreadlocks jamaicanos rematados com as roupas trajadas pelos orixás do panteão yorubá, das casas de culto ancestral. Nessa ambiência é que se destaca o protagonismo da intelectual que organiza o livro Negritude e universidade.
Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item
Directory of Open Access Journals (Sweden)
Malvina Thais Pacheco Rodrigues
2013-06-01
Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.
An experimental study of 99Tcm-PnAO-nitroimidazole and 99Tcm-HL91 in detection of myocardial hypoxia
International Nuclear Information System (INIS)
Yao Zhiming; Liu Xiujie; Shi Rongfang; Guo Feng; Liu Yunzhong; Wang Qi; Wei Hongxing; Zhu Lin
1999-01-01
Objective: To investigate the biological characteristics of two hypoxic-avid imaging agents, 99 Tc m -PnAO-nitroimidazole and 99 Tc m -HL91, and the experimental myocardial hypoxia, low perfusion and ischemic reperfusion were performed. Methods: Isolated rat hearts were retrograde perfused with Kerbs-Henscleit buffer (KH) in four phantoms: control, low perfusion, ischemic reperfusion and hypoxia. Control hearts were perfused with 95% O 2 and 5% CO 2 balanced KH at 9∼10 mL/min rate. Low perfusion hearts were perfused with the same KH at 1 mL/min rate, and ischemic reperfusion rat hearts were discontinued perfusion for 20 min then reperfused with the same KH. Hypoxic hearts were perfused with 100% N 2 balanced KH. Results: 1) At 30 and 60 min, the radioactivity ratio of liver to heart (L/H) was 11.6 and 6.9 ( 99 Tc m -PnAO-nitroimidazole), and 5.7 and 6.2 ( 99 Tc m -HL91), respectively. The lung to heart ratios at 60 min of 99 Tc m -PnAO-nitroimidazole and 99 Tc m -HL91 were 1.8 and 2.1, respectively 2) The accumulation of 99 Tc m -PnAo-nitroimidazole in the hypoxic, low perfusion and ischemic hearts was 4.8, 3.7 and 2.8 times that in the control hearts. At 60 min after starting washout, the retentions of 99 Tc m -PnAO-nitroimidazole in hypoxic, low flow and ischemic reperfusion myocardium were much higher than that of control hearts [(23.7 +- 9.1)%]. The accumulation of 99 Tc m -HL91 in the hypoxic and low perfusion hearts was also significantly higher than that in the control and ischemic reperfusion hearts, P 99 Tc m -HL91 in the low perfusion heart was 5.34, 3.43 and 1.23 times those of control, ischemic reperfusion and hypoxic hearts, respectively. Conclusions: 99 Tc m -PnAO-nitroimidazole can be accumulated in low perfusion, ischemic reperfusion and hypoxic hearts, while 99 Tc m -HL91 is mainly accumulated in hypoxic, specially low perfusion hearts. Since there is a high L/H in perfusions with either agent, the detecting of inferoposterior wall may be
Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.
2010-01-01
Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome
Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.
2010-01-01
Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome
Chen, Fangfang; Gong, Zhiyuan; Kelly, Barry C
2017-10-03
The factors influencing bioaccumulation of pharmaceuticals and personal care products (PPCPs) in aquatic organisms are not well understood. The present study involved a comprehensive laboratory investigation to assess the bioaccumulation behavior of several PPCPs in adult zebrafish (Danio rerio). The studied PPCPs included several ionogenic organic compounds (IOCs) such as weak acids and weak bases. Experiments involved two exposure groups (high and low) and a control group, with a 6 day aqueous exposure, followed by a 7 day depuration phase under flow-through conditions. Uptake rate constants (k u ) ranged between 0.19 and 8610 L·kg -1 ·d -1 , while depuration rate constants (k d ) ranged between 0.14 and 5.14 d -1 in different fish tissues. Steady-state bioconcentration factor (BCF ss ) values varied widely among the studied PPCPs, ranging from 0.09 to 6,460. In many cases, BCF ss values of individual PPCPs differed substantially among different fish tissues. Positive linear relationships were observed between log BCF ss values and physical-chemical properties such as octanol-water distribution coefficients (log D ow ), membrane-water distribution coefficients (log D mw ), albumin-water distribution coefficients (log D BSAw ), and muscle protein-water distribution coefficients (log D mpw ), indicating the importance of lipid-, phospholipid-, and protein-water partitioning. The results also showed that for many PPCPs, the estimated whole-body metabolism rate constant (k m ) values were comparable to the observed depuration rate (k d ), indicating that metabolism plays a major role in the overall elimination of these compounds in zebrafish. An exception was sertraline, which exhibited a k d value (0.4-0.5 d -1 ) that was much higher than the estimated whole-body k m (0.03 d -1 ). Overall, the results help to better understand the influence of physical-chemical properties and biotransformation on bioaccumulation behavior of these contaminants of concern in aquatic
Directory of Open Access Journals (Sweden)
Ling Lee
Full Text Available The zebrafish (Danio rerio is an important organism as a model for understanding vertebrate cardiovascular development. However, little is known about adult ZF cardiac function and how contractile function changes to cope with fluctuations in ambient temperature. The goals of this study were to: 1 determine if high resolution echocardiography (HRE in the presence of reduced cardiodepressant anesthetics could be used to accurately investigate the structural and functional properties of the ZF heart and 2 if the effect of ambient temperature changes both acutely and chronically could be determined non-invasively using HRE in vivo. Heart rate (HR appears to be the critical factor in modifying cardiac output (CO with ambient temperature fluctuation as it increases from 78 ± 5.9 bpm at 18°C to 162 ± 9.7 bpm at 28°C regardless of acclimation state (cold acclimated CA- 18°C; warm acclimated WA- 28°C. Stroke volume (SV is highest when the ambient temperature matches the acclimation temperature, though this difference did not constitute a significant effect (CA 1.17 ± 0.15 μL at 18°C vs 1.06 ± 0.14 μl at 28°C; WA 1.10 ± 0.13 μL at 18°C vs 1.12 ± 0.12 μl at 28°C. The isovolumetric contraction time (IVCT was significantly shorter in CA fish at 18°C. The CA group showed improved systolic function at 18°C in comparison to the WA group with significant increases in both ejection fraction and fractional shortening and decreases in IVCT. The decreased early peak (E velocity and early peak velocity / atrial peak velocity (E/A ratio in the CA group are likely associated with increased reliance on atrial contraction for ventricular filling.
Controle de plantas daninhas na cultura de soja resistente ao glyphosate
Directory of Open Access Journals (Sweden)
Núbia Maria Correia
2010-01-01
Full Text Available O objetivo da pesquisa foi avaliar o controle de plantas daninhas em área cultivada com soja resistente ao herbicida glyphosate, sem a utilização de práticas complementares de manejo de plantas daninhas. Foram desenvolvidos experimentos, em condições de campo, nos anos agrícolas 2005/2006 e 2006/2007 em Jaboticabal (SP. Foram avaliadas duas cultivares de soja resistentes ao glyphosate (CD 214 RR e M-SOY 8008 RR, oito tratamentos de herbicidas (glyphosate, em aplicação única, nas doses de 0,48; 0,72; 0,96 e 1,20 kg ha-1 de equivalente ácido, associadas ou não a aplicação sequencial na dose de 0,48 kg ha-1, além de duas testemunhas, uma capinada e outra mantida infestada. As cultivares de soja influenciaram na infestação das espécies de plantas daninhas na área. Sem a aplicação de glyphosate, houve o predomínio de X. strumarium na área, desfavorecendo a ocorrência de outras espécies. Quando utilizado glyphosate, independentemente da dose, a infestação contabilizada aos 35 e 40 dias após a primeira aplicação, no primeiro e segundo ano, respectivamente, foi baixa. O controle de plantas daninhas na cultura da soja transgênica é diretamente influenciado pela dose de glyphosate, havendo controle satisfatório com a aplicação única de 0,96 kg ha-1 ou a sequencial de 0,48 + 0,48 kg ha-1 de glyphosate. Em situação de menor infestação (2006/2007, a aplicação única de 0,48 kg ha-1 de glyphosate é suficiente para o controle das plantas daninhas. As cultivares de soja transgênica CD 214 RR e M-SOY 8008 RR influenciam diferencialmente a dinâmica das espécies de plantas daninhas, sendo o controle químico mais efetivo na situação de cultivo de M-SOY 8008 RR, em que houve menor diversidade e desenvolvimento das plantas daninhas.
GOALS, STRATEGIES AND FIRST DISCOVERIES OF AO327, THE ARECIBO ALL-SKY 327 MHz DRIFT PULSAR SURVEY
Energy Technology Data Exchange (ETDEWEB)
Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); Stovall, K.; Martinez, J. G.; Jenet, F. [Center for Advanced Radio Astronomy, Department of Physics and Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); McLaughlin, M. A.; Bates, S. D.; Bagchi, M. [Department of Physics, West Virginia University, 111 White Hall, Morgantown, WV 26506 (United States); Freire, P. C. C. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)
2013-09-20
We report initial results from AO327, a drift survey for pulsars with the Arecibo telescope at 327 MHz. The first phase of AO327 will cover the sky at declinations of –1° to 28°, excluding the region within 5° of the Galactic plane, where high scattering and dispersion make low-frequency surveys sub-optimal. We record data from a 57 MHz bandwidth with 1024 channels and 125 μs sampling time. The 60 s transit time through the AO327 beam means that the survey is sensitive to very tight relativistic binaries even with no acceleration searches. To date we have detected 44 known pulsars with periods ranging from 3 ms to 2.21 s and discovered 24 new pulsars. The new discoveries include 3 ms pulsars, three objects with periods of a few tens of milliseconds typical of young as well as mildly recycled pulsars, a nuller, and a rotating radio transient. Five of the new discoveries are in binary systems. The second phase of AO327 will cover the sky at declinations of 28°-38°. We compare the sensitivity and search volume of AO327 to the Green Bank North Celestial Cap survey and the GBT350 drift survey, both of which operate at 350 MHz.
Directory of Open Access Journals (Sweden)
Fernanda A. Alves-Costa
2012-06-01
Full Text Available The presence of higher level of exogenous growth hormone (GH in transgenic animals could lead to several physiological alterations. A GH transgenic zebrafish (Danio rerio line was compared to nontransgenic (NT samples of the species through a DDRT-PCR approach, with the goal of identifying candidate differentially expressed transcripts in brain tissues that could be involved in GH overexpression. Densitometric analyses of two selected amplification products, p300 and ADCY2, pointed to a significant lower gene expression in the transgenic zebrafish (104.02 ± 57.71; 224.10 ± 91.73 when compared to NT samples (249.75 ± 30.08; 342.95 ± 65.19. The present data indicate that p300 and ADCY2 are involved in a regulation system for GH when high circulating levels of this hormone are found in zebrafishes.A presença de níveis mais elevados do hormônio de crescimento (GH em animais transgênicos poderia levar a várias alterações fisiológicas. Uma linhagem transgênica de paulistinha (Danio rerio para o GH foi comparada com amostras não transgênicas (NT desta espécie, através de uma abordagem de DDRT-PCR, com o objetivo de identificar transcritos candidatos diferencialmente expressos em tecido cerebral que poderiam estar envolvidos na superexpressão de GH. Análises densitométricas de dois produtos de amplificação selecionados, p300 e ADCY2, apontaram uma expressão gênica significativamente menor nas amostras transgênicas de paulistinha (104.02 ± 57.71; 224.10 ± 91.73, quando comparadas com as amostras NT (249.75 ± 30.08; 342.95±65.19. Os presentes dados indicam que p300 e ADCY2 estão envolvidos em um sistema de regulação do GH, quando altos níveis circulantes desse hormônio são encontrados em paulistinha.
Dicty_cDB: Contig-U08229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ng_GS-30-02-01-1... 38 1.9 2 ( EJ159318 ) 1092344041638 Global-Ocean-Sampling_GS-27-01-01-1... 42 2.0...7171311. 44 4.5 1 ( DL062932 ) Cancer Gene Determination and Therapeutic Screeni... 44 4.5 1 ( DJ444382 ) Methods, agents, and comp...mosome UNK clone OAB... 46 1.1 1 ( ER387042 ) 1094426031825 Global-Ocean-Sampling_GS-34-01-01-1... 46 1.1 1 ...( DY568895 ) AGENCOURT_69769162 NIH_ZGC_29 Danio rerio cDNA cl... 46 1.1 1 ( EJ043112 ) 1095454102199 Global-Ocean-Sampli...ng_GS-26-01-01-1... 38 1.7 2 ( EJ656472 ) 1092955007584 Global-Ocean-Sampli
Propaganda de álcool e associação ao consumo de cerveja por adolescentes
Directory of Open Access Journals (Sweden)
Roberta Faria
2011-06-01
Full Text Available OBJETIVO: Analisar a associação entre propaganda de álcool e o consumo de cerveja por adolescentes. MÉTODOS: Foram entrevistados 1.115 estudantes de 7º e 8º anos de três escolas públicas de São Bernardo do Campo, SP, em 2006. As variáveis independentes foram: atenção prestada às propagandas de álcool, crença na veracidade das propagandas, resposta afetiva às propagandas, uso prévio de cigarro, entre outras. A variável dependente foi consumo de cerveja nos últimos 30 dias. Análises de regressões logísticas univariada e múltipla foram realizadas. Idade, importância dada à religião e ter banheiro em casa foram utilizadas como controle. RESULTADOS: O consumo de cerveja nos últimos 30 dias esteve associado ao uso de cigarro (OR = 4,551, ter uma marca preferida de bebida alcoólica (OR = 5,150, não ser monitorado pelos pais (OR = 2,139, achar que as festas que freqüentam parecem-se com as de comerciais (OR = 1,712, prestar muita atenção aos comerciais (OR = 1,563 e acreditar que os comerciais falam a verdade (OR = 2,122. Essa associação manteve-se mesmo na presença de outras variáveis associadas ao seu consumo. CONCLUSÕES: As propagandas de bebidas alcoólicas associam-se positivamente ao consumo recente de cerveja, por remetem os adolescentes à própria realidade ou por fazê-los acreditar em sua veracidade. Limitar a veiculação de propagandas de bebidas alcoólicas pode ser um dos caminhos para a prevenção do uso e abuso de álcool por adolescentes.
Directory of Open Access Journals (Sweden)
Ana Paula Morais Fernandes
2005-10-01
Full Text Available O diabetes mellitus do tipo 1 tem sido considerado uma doença auto-imune órgão-específica, decorrente da destruição seletiva das células betapancreáticas. Apresenta patogenia complexa, envolvendo a participação de vários fatores, dentre esses a susceptibilidade imunogenética com forte associação aos genes de histocompatibilidade (HLA, eventos ambientais e resposta auto-imune com presença de auto-anticorpos e/ou linfócitos auto-reativos, culminando em anormalidades metabólicas. Neste estudo, a revisão da literatura descreve os mecanismos pelos quais determinados fatores conferem susceptibilidade para o seu desencadeamento e, adicionalmente, as inovações na predição dessa desordem que, certamente, contribuirão para a assistência de enfermagem aos pacientes portadores do diabetes tipo 1.La Diabetes Mellitus tipo 1 ha sido considerada una enfermedad autoinmune órgano-específica debido a la destrucción selectiva de las células beta pancreáticas. Presenta una patogenia compleja, involucrando la participación de varios factores, entre esos la susceptibilidad inmunogenética con fuerte asociación a los genes de histocompatibilidad (HLA, eventos ambientales y respuesta autoinmune con presencia de auto-anticuerpos y/o linfocitos auto-reactivos, culminando en anormalidades metabólicas. En este estudio, la revisión de la literatura describe los mecanismos por los cuales determinados factores resultan en susceptibilidad para su desarrollo y, adicionalmente, las innovaciones en la predicción de ese desorden que, por cierto, van a contribuir para la atención de enfermería a los pacientes portadores de la diabetes tipo 1.Type 1 diabetes mellitus has been considered an organ-specific autoimmune disease derived from the selective destruction of pancreatic beta cells. It presents a complex pathogenesis, involving the participation of several factors, including the immunogenetic susceptibility with strong association to
O letramento e a organização da informação digital aliados ao aprendizado ao longo da vida
Directory of Open Access Journals (Sweden)
Sonia Boeres
2018-03-01
Full Text Available O letramento digital é fruto de pensamento crítico e busca potencializar os métodos de estudo pela tecnologia da informação. A questão de pesquisa aqui tratada é compreender como o letramento digital pode contribuir para o aprendizado ao longo da vida. O objetivo é traçar um paralelo entre o letramento e a informação digital e o aprendizado ao longo da vida. Como metodologia fez-se uma revisão de literatura, nacional e internacional, sobre o processo de ensino e aprendizagem, letramento informacional, digital e aprendizado ao longo da vida. Esta pesquisa é de natureza descritiva e base qualitativa. Os principais resultados observados foram que o letramento digital leva a variadas práticas de leitura e escrita por meio das tecnologias da informação. Estas trazem novas possibilidades para educadores e educandos, profissionais e usuários, transcendendo o simples ato de decodificar sinais ou pesquisar na Internet. Ser letrado digitalmente leva à compreensão de que a tecnologia da informação vai além de novas formas de acesso à informação, mas também a novos processos cognitivos e formas de conhecimento. Chegando-se a esse patamar, cabe o árduo e prazeroso trabalho de manter-se atualizado ao longo do tempo, por meio de um esforço pessoal, que envolvem cursos e treinamentos como fonte de aprendizagem e desenvolvimento de trabalho em conjunto com especialistas. Em suma, há que se manter atualizado, acompanhando a evolução tecnológica, e para tanto, ser destemido das tecnologias e do uso das mídias digitais.
International Nuclear Information System (INIS)
Bourrachot, Stephanie; Simon, Olivier; Gilbin, Rodolphe
2008-01-01
In this study, we investigated the effects of the radioactive metal uranium (U) on the embryonic development, hatching success, growth rate, and survival of juvenile zebrafish (Danio rerio). We studied the effects of depleted uranium (20-500 μg L -1 of DU), inducing mainly chemical toxicity due to its low specific activity, and the combined effects of chemical and radiological toxicity by using a higher specific activity uranium isotope (20 and 100 μg L -1 of 233 U). Results showed that early life stages are significantly affected by uranium exposure through both chemical and combined (chemical and radiological) toxicity. Experiments showed significant effects of U on hatching success starting at the concentration of 250 μg L -1 of DU, causing a 42% delay in median hatching times relative to control. Furthermore, a reduction of growth (decrease in body length and weight) was observed followed by a high mortality of pro-larvae stage (up to 100% at DU concentrations of 250 μg L -1 upon a 15 day exposure). Bioaccumulation measurements highlighted that U was mainly localised in the chorion but penetrated in the embryo inside eggs at a higher concentration. The effects differed depending on the isotopic composition of the uranium: sublethal defects in the tail detachment process were more pronounced for 233 U than DU exposure, while the presence of 233 U specifically affected embryo development and led to higher mortality rates of the prolarvae. The results from this study showed that the early life stages of zebrafish seems to be more sensitive to uranium contamination than more mature stages, and underline the importance of including pro-larval stages into toxicity tests in order to improve the relevancy for environmental risk assessments
Frank, Daniel F; Miller, Galen W; Harvey, Danielle J; Brander, Susanne M; Geist, Juergen; Connon, Richard E; Lein, Pamela J
2018-04-18
Over the last few decades, the pyrethroid insecticide bifenthrin has been increasingly employed for pest control in urban and agricultural areas, putting humans and wildlife at increased risk of exposure. Exposures to nanomolar (nM) concentrations of bifenthrin have recently been reported to alter calcium oscillations in rodent neurons. Neuronal calcium oscillations are influenced by ryanodine receptor (RyR) activity, which modulates calcium-dependent signaling cascades, including the mechanistic target of rapamycin (mTOR) signaling pathway. RyR activity and mTOR signaling play critical roles in regulating neurodevelopmental processes. However, whether environmentally relevant levels of bifenthrin alter RyR or mTOR signaling pathways to influence neurodevelopment has not been addressed. Therefore, our main objectives in this study were to examine the transcriptomic responses of genes involved in RyR and mTOR signaling pathways in zebrafish (Danio rerio) exposed to low (ng/L) concentrations of bifenthrin, and to assess the potential functional consequences by measuring locomotor responses to external stimuli. Wildtype zebrafish were exposed for 1, 3 and 5 days to 1, 10 and 50 ng/L bifenthrin, followed by a 14 d recovery period. Bifenthrin elicited significant concentration-dependent transcriptional responses in the majority of genes examined in both signaling cascades, and at all time points examined during the acute exposure period (1, 3, and 5 days post fertilization; dpf), and at the post recovery assessment time point (19 dpf). Changes in locomotor behavior were not evident during the acute exposure period, but were observed at 19 dpf, with main effects (increased locomotor behavior) detected in fish exposed developmentally to bifenthrin at 1 or 10 ng/L, but not 50 ng/L. These findings illustrate significant influences of developmental exposures to low (ng/L) concentrations of bifenthrin on neurodevelopmental processes in zebrafish. Copyright © 2018
Anil, Siji; Rawson, David; Zhang, Tiantian
2018-05-29
Development of in vitro culture protocol for early stage ovarian follicles of zebrafish is important since cryopreserved early stage ovarian follicles would need to be matured in vitro following cryopreservation before they can be fertilised. Development of molecular markers for zebrafish (Danio rerio) ovarian follicle growth assessment following in vitro culture of early stage zebrafish ovarian follicles in ovarian tissue fragments is reported here for the first time although some work has been reported for in vitro culture of isolated early stage zebrafish ovarian follicles. The main aim of the present study was to develop molecular markers in an optimised in vitro culture protocol for stage I and stage II zebrafish ovarian follicles in ovarian tissue fragments. The effect of concentration of the hormones human chorionic gonadotropin and follicle stimulating hormones, and additives such as Foetal Bovine Serum and Bovine Serum Albumin were studied. The results showed that early stage zebrafish ovarian fragments containing stage I and stage II follicles which are cultured in vitro for 24 h in 20% FBS and 100mIU/ml FSH in 90% L-15 medium at 28 °C can grow to the size of stage II and stage III ovarian follicles respectively. More importantly the follicle growth from stage I to stage II and from stage II to stage III were confirmed using molecular markers such as cyp19a1a (also known as P450aromA) and vtg1 genes respectively. However, no follicle growth was observed following cryopreservation and in vitro culture. Copyright © 2018 Elsevier Inc. All rights reserved.
Noninvasive technique for measurement of heartbeat regularity in zebrafish (Danio rerio embryos
Directory of Open Access Journals (Sweden)
Cheng Shuk
2009-02-01
Full Text Available Abstract Background Zebrafish (Danio rerio, due to its optical accessibility and similarity to human, has emerged as model organism for cardiac research. Although various methods have been developed to assess cardiac functions in zebrafish embryos, there lacks a method to assess heartbeat regularity in blood vessels. Heartbeat regularity is an important parameter for cardiac function and is associated with cardiotoxicity in human being. Using stereomicroscope and digital video camera, we have developed a simple, noninvasive method to measure the heart rate and heartbeat regularity in peripheral blood vessels. Anesthetized embryos were mounted laterally in agarose on a slide and the caudal blood circulation of zebrafish embryo was video-recorded under stereomicroscope and the data was analyzed by custom-made software. The heart rate was determined by digital motion analysis and power spectral analysis through extraction of frequency characteristics of the cardiac rhythm. The heartbeat regularity, defined as the rhythmicity index, was determined by short-time Fourier Transform analysis. Results The heart rate measured by this noninvasive method in zebrafish embryos at 52 hour post-fertilization was similar to that determined by direct visual counting of ventricle beating (p > 0.05. In addition, the method was validated by a known cardiotoxic drug, terfenadine, which affects heartbeat regularity in humans and induces bradycardia and atrioventricular blockage in zebrafish. A significant decrease in heart rate was found by our method in treated embryos (p p Conclusion The data support and validate this rapid, simple, noninvasive method, which includes video image analysis and frequency analysis. This method is capable of measuring the heart rate and heartbeat regularity simultaneously via the analysis of caudal blood flow in zebrafish embryos. With the advantages of rapid sample preparation procedures, automatic image analysis and data analysis, this
Hao, Jiawei; Luo, Jin; Chen, Ze; Ren, Qiaoyun; Guo, Jinxia; Liu, Xiaocui; Chen, Qiuyu; Wu, Feng; Wang, Zhen; Luo, Jianxun; Yin, Hong; Wang, Hui; Liu, Guangyuan
2017-05-22
The hard tick Haemaphysalis longicornis is widely distributed in eastern Asia, New Zealand and Australia and is considered the major vector of Theileria and Babesia, harmful parasites to humans and animals. Female ticks need successful blood meals to complete the life-cycle. Therefore, elucidation of the underlying molecular mechanisms of H. longicornis development and reproduction is considered important for developing control strategies against the tick and tick-borne pathogens. Luciferase assays were used to identify the targets of micro RNA miR-275 in vitro. RNAi of Vitellogenin (Vg) was used in phenotype rescue experiments of ticks with miR-275 inhibition, and these analyses were used to identify the authentic target of miR-275 in vivo. The expression of miR-275 in different tissues and developmental stages of ticks was assessed by real-time PCR. To elucidate the functions of miR-275 in female ticks, we injected a miR-275 antagomir into female ticks and observed the phenotypic changes. Statistical analyses were performed with GraphPad5 using Student's t-test. In this study, we identified Vg-2 as an authentic target of miR-275 both in vitro and in vivo by luciferase assays and phenotype rescue experiments. miR-275 plays the regulatory role in a tissue-specific manner and differentially in developmental stages. Silencing of miR-275 resulted in blood digestion problems, substantially impaired ovary development and significantly reduced egg mass (P development. These findings improve the molecular understanding of tick development and reproduction.
Craig, J.M.; Papoulias, D.M.; Thomas, M.V.; Annis, M.L.; Boase, J.
2009-01-01
This study focused on identifying the sex of lake sturgeon by measuring the sex hormones estradiol and testosterone, and the phosphoprotein vitellogenin (Vtg) in blood plasma by radioimmunoassay and enzyme-linked immunosorbent assay, respectively, and evaluating these techniques as tools in lake sturgeon population management. Surveys of the St Clair River (SCR) lake sturgeon population have characterized it as rebounding by having steady or increasing recruitment since 1997. However, researchers have not been able to effectively determine the sex for most of the sturgeon they capture because few fish caught during surveys are releasing gametes. A total of 115 fish were sampled from May through June in 2004 and 2005 from the SCR, Michigan, USA. Of these, only four females and eight males were verified (i.e. they were releasing gametes at time of capture), resulting in very few fish with which to validate blood hormone and Vtg biomarkers of sex. Fifty-six percent of the fish were assigned a sex designation based on biomarker criteria. Correspondence between actual gonadal sex and biomarker-directed classification was good for the small subset of fish for which gonadal sex was definitively determined. Moreover, application of the steroid values in a predictive sex assignment model developed for white sturgeon misclassified only the same two fish that were misclassified with the steroid and Vtg biomarkers. The experimental results suggest a sex ratio of 1 : 2.7 (F:M), however more conclusive methods are needed to confirm this ratio because so few fish were available for sex validation. Of the 43 males, 14 were within the legal slot limit, 11 were smaller than 1067 mm total length (TL), and 18 were larger than 1270 mm TL. All 15 females were larger than 1270 mm TL, and thus protected by the slot limit criteria. Considering that lake sturgeon are threatened in Michigan, an advantage to using blood plasma assays was that fish were not harmed, and sample collection was
International Nuclear Information System (INIS)
Barillet, S.; Devaux, A.; Simon, O.; Buet, A.; Pradines, C.
2004-01-01
Within the Envirhom research program, key advances have been obtained in uranium bioaccumulation and underlying mechanisms understanding in various biological models at the individual level. However, considering different scales of biological effects (from early to delayed ones, from low to high level of organization) is crucial to provide ecologically relevant indicators. Organisms counteract stress induced by pollutant exposure through a wide range of physiological responses being both dose and time dependent. Effects at higher hierarchical levels are always preceded by early changes in biological processes, from subtle biochemical disturbances to impaired physiological functions, increased susceptibility to other stresses, reduced life-span Within this global context, preliminary experiments were carried out on adult zebra fish (Danio rerio), to assess early changes after short-term uranium exposure. Among the subsequent primary subcellular damages oxidative stress and genotoxicity (characterizing both chemo-toxicity and radiotoxicity) are relevant endpoints, thus requiring the knowledge of dose-effects relationships as a first operational approach to provide useful tool in predicting possible effects of U exposure. Zebra fish has been selected due to its small size (facilitating its maintenance) and its extended use in eco-toxicological studies. Moreover, its short life-cycle will allow to carry out chronic exposure experiments (along the whole life-cycle). Four uranium concentrations (0, 20, 100 and 500μg.L -1 ) and five sampling times (0, 0.5, 1, 5 and 10 days) were selected. Catalase, glutathione peroxidase (GPx) and superoxide dismutase (SOD) activities were measured as oxidative stress bio-markers. DNA damage level was assessed in zebra fish erythrocytes using the comet assay. Uranium bioaccumulation was concurrently studied to understand observed bio-marker responses. Further experiments, dedicated to the assessment of the impact of chronic uranium
Atendimento domiciliar ao idoso: problema ou solução?
Directory of Open Access Journals (Sweden)
Ciro Augusto Floriani
Full Text Available O atendimento domiciliar ao idoso tem se tornado um importante instrumento de assistência nos últimos anos, tanto nos países desenvolvidos quanto nos países em desenvolvimento. Vários aspectos éticos, sociais e operacionais têm sido negligenciados e a literatura nacional é escassa em relação a esta temática. A partir de revisão bibliográfica em atendimento domiciliar, este artigo enfoca, do ponto de vista bioético, os potenciais problemas advindos com a implantação dessa crescente e importante modalidade de atendimento. Conclui ser necessário um maior direcionamento ético na implantação do atendimento domiciliar, com políticas de proteção ao paciente, à família e ao cuidador, visando a aperfeiçoar a qualidade dos programas oferecidos.
Directory of Open Access Journals (Sweden)
M. F. Fernandes
2000-06-01
Full Text Available O objetivo deste trabalho foi selecionar e caracterizar parcialmente rizóbios de tabuleiros costeiros com alta capacidade de fixação biológica do N, quando associados ao guandu. Dezesseis isolados de rizóbios de diferentes regiões desse ecossistema foram avaliados em casa de vegetação da Embrapa Tabuleiros Costeiros (Aracaju, SE. Quatro isolados destacaram-se quanto ao N acumulado (Nac, matéria seca da parte aérea (MSPA, área foliar (AF e matéria seca de nódulos (MSN. A MSN correlacionou-se com a MSPA, AF e Nac. A relação N-ureído/N-total na seiva xilemática correlacionou-se com Nac e MSN. Três desses isolados foram caracterizados (R1, R5 e R11 e apresentaram crescimento rápido e acidificaram o meio de cultura com manitol. Comparado ao R1 e R5, o isolado R11 foi o mais sensível aos antibióticos e o menos tolerante ao Al e às temperaturas elevadas.
Fatores associados à submissão ao teste rápido anti-HIV na assistência ao parto
Directory of Open Access Journals (Sweden)
Maria Inês Couto de Oliveira
Full Text Available Resumo Os testes rápidos anti-HIV vêm sendo empregados nas maternidades com vistas à prevenção da transmissão vertical. O objetivo do estudo foi analisar os fatores associados à submissão ao teste rápido anti-HIV (desfecho. Estudo transversal, conduzido em 2009, em 15 hospitais do SUS do Rio de Janeiro/RJ, mediante entrevista a amostra representativa de 835 parturientes internadas e consulta a prontuários. Razões de prevalência ajustadas foram obtidas por regressão de Poisson, segundo modelo hierarquizado, permanecendo no modelo final as variáveis associadas ao desfecho (p ≤ 0,05. Segundo os prontuários (SP, 79,6% das mães foram submetidas ao teste rápido anti-HIV e, segundo as entrevistas (SE, 55,7%. No nível distal, a ausência de companheiro (SP, ter ≥ 6 moradores na residência (SP e a cor da pele não branca (SE se associaram a uma maior prevalência do desfecho. No nível intermediário, não dispor de sorologia negativa para o HIV do pré-natal (SP e SE se associou a uma maior prevalência do desfecho, bem como a realização de pré-natal na rede básica (SP e a não realização de pré-natal (SE. No nível proximal, o parto em hospital não certificado como amigo da criança se associou a uma maior prevalência do desfecho (SP e SE.
The complexity of national identity Construction in Curaçao, Dutch Caribbean
Directory of Open Access Journals (Sweden)
Rose Mary Allen
2010-10-01
Full Text Available Curaçao, one of the five islands of the Dutch Caribbean federation called the Netherlands Antilles, currently stands at a crossroad of constitutional reform. In the context of these changes at the political level, it is logical that national identities are being redefined and repositioned. The developments in the fashioning of national identities in Curaçao deserve attention locally but also regionally. How do people in Curaçao construct national identities in daily life? How is a national collective constructed on the one hand, and how are differences with other collectivities constructed on the other hand? The historical context of constitutional changes that have occurred over the years is considered as well as an examination of the present discourse on constitutional reform. These identity issues are then placed within a wider Caribbean context. Resumen: La complejidad de la construcción de la identidad nacional en Curaçao,en el Caribe holandés Curaçao, una de las cinco islas de la federación caribeña neerlandesa llamada Antillas Holandesas, se encuentra hoy en día en una encrucijada de reformas constitucionales. En el contexto de estos cambios a nivel político, es lógico que las identidades nacionales sean redefinidas y reposicionadas. Los desarrollos en la formulación de identidades nacionales en Curaçao merecen atención local, y también regional. ¿Cómo construye la gente en Curaçao identidades nacionales en la vida cotidiana? ¿Cómo, por un lado, se construye el colectivo nacional y, por otro, cómo se construyen las diferencias con otras colectividades? En este análisis se estudia el contexto histórico de los cambios constitucionales que han ocurrido en el curso del tiempo y se realiza igualmente una revisión del actual discurso sobre la reforma constitucional. Estos problemas de identidad son analizados entonces en un contexto caribeño más amplio.
Robo-AO Kepler Survey. IV. The Effect of Nearby Stars on 3857 Planetary Candidate Systems
Ziegler, Carl; Law, Nicholas M.; Baranec, Christoph; Riddle, Reed; Duev, Dmitry A.; Howard, Ward; Jensen-Clem, Rebecca; Kulkarni, S. R.; Morton, Tim; Salama, Maïssa
2018-04-01
We present the overall statistical results from the Robo-AO Kepler planetary candidate survey, comprising of 3857 high-angular resolution observations of planetary candidate systems with Robo-AO, an automated laser adaptive optics system. These observations reveal previously unknown nearby stars blended with the planetary candidate host stars that alter the derived planetary radii or may be the source of an astrophysical false positive transit signal. In the first three papers in the survey, we detected 440 nearby stars around 3313 planetary candidate host stars. In this paper, we present observations of 532 planetary candidate host stars, detecting 94 companions around 88 stars; 84 of these companions have not previously been observed in high resolution. We also report 50 more-widely separated companions near 715 targets previously observed by Robo-AO. We derive corrected planetary radius estimates for the 814 planetary candidates in systems with a detected nearby star. If planetary candidates are equally likely to orbit the primary or secondary star, the radius estimates for planetary candidates in systems with likely bound nearby stars increase by a factor of 1.54, on average. We find that 35 previously believed rocky planet candidates are likely not rocky due to the presence of nearby stars. From the combined data sets from the complete Robo-AO KOI survey, we find that 14.5 ± 0.5% of planetary candidate hosts have a nearby star with 4″, while 1.2% have two nearby stars, and 0.08% have three. We find that 16% of Earth-sized, 13% of Neptune-sized, 14% of Saturn-sized, and 19% of Jupiter-sized planet candidates have detected nearby stars.
Requirements Modeling with the Aspect-oriented User Requirements Notation (AoURN): A Case Study
Mussbacher, Gunter; Amyot, Daniel; Araújo, João; Moreira, Ana
The User Requirements Notation (URN) is a recent ITU-T standard that supports requirements engineering activities. The Aspect-oriented URN (AoURN) adds aspect-oriented concepts to URN, creating a unified framework that allows for scenario-based, goal-oriented, and aspect-oriented modeling. AoURN is applied to the car crash crisis management system (CCCMS), modeling its functional and non-functional requirements (NFRs). AoURN generally models all use cases, NFRs, and stakeholders as individual concerns and provides general guidelines for concern identification. AoURN handles interactions between concerns, capturing their dependencies and conflicts as well as the resolutions. We present a qualitative comparison of aspect-oriented techniques for scenario-based and goal-oriented requirements engineering. An evaluation carried out based on the metrics adapted from literature and a task-based evaluation suggest that AoURN models are more scalable than URN models and exhibit better modularity, reusability, and maintainability.
Dicty_cDB: Contig-U01890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available mfvplswfyglmn*skeis ltl*fsfknlqlkigknvilkvyslllsiidhymkklnhi*kvii*i*iiillksnifnn fffyfptkkkkkkkqkkkkn Translated...tum chromosome 30. 114 5e-25 AM494967_147( AM494967 |pid:none) Leishmania braziliensis chromoso... 112...a infantum chromosome 27. 79 5e-13 AM494964_217( AM494964 |pid:none) Leishmania braziliensi...2 ( CO474648 ) GQ0045.B3_N06 GQ004: Non-lignified secondary xyle... 62 6e-06 2 ( CO166798 ) FLD1_64_C09.g1_A029 Root flooded...nghamella elegans pBluescript (... 30 0.043 3 ( BC134880 ) Danio rerio apoptosis antagonizing trans
Optimal control strategy to reduce the temporal wavefront error in AO systems
Doelman, N.J.; Hinnen, K.J.G.; Stoffelen, F.J.G.; Verhaegen, M.H.
2004-01-01
An Adaptive Optics (AO) system for astronomy is analysed from a control point of view. The focus is put on the temporal error. The AO controller is identified as a feedback regulator system, operating in closed-loop with the aim of rejecting wavefront disturbances. Limitations on the performance of
The Ashkenazi Jews of Curaçao, a trading minority
Directory of Open Access Journals (Sweden)
Eva Abraham-Van der Mark
2000-07-01
Full Text Available First describes the early Sephardi presence in Curaçao, the arrival of the Ashkenazi in the 20th c., and the relations between these 2 groups. Author goes on to discuss the Ashkenazis' economic success and the exodus of the 1980s. She asks whether the success and the exodus can be attributed to the characteristics of the group itself or whether conditions and developments in Curaçao account for economic fortune and the departure of the Ashkenazi.
Quality control of Ling'ao nuclear power station civil construction
International Nuclear Information System (INIS)
Lu Buliang; Ye Changyuan
2001-01-01
Based on the quality control model adopted during Ling'ao Nuclear Power Station construction, the author briefly introduces quality control process of some main civil construction activities (reinforced concrete, steel liner, steel works and prestressing force) of nuclear power station, and makes some descriptions on non-conformance control of civil works. These quality control processes described come from the concrete practice during civil construction of Ling'ao Nuclear Power Station, and are based on Daya Bay Nuclear Power Station construction experience
GÓES, Maurício de Carvalho; UNISINOS/RS Faculdade IDC – Instituto de Desenvolvimento Cultural. PUC/RS.; BUBLITZ, Michelle Dias; Universidade Luterana do Brasil – ULBRA – campus Canoas/RS.
2013-01-01
Nos termos do artigo 7º, inciso XXI, da Constituição Federal de 1988, o aviso prévio será proporcional ao tempo de serviço, sendo de, no mínimo, 30 dias, nos termos da lei. Tal dispositivo revogou o inciso I do artigo 487 da CLT, que previa o aviso prévio de 8 dias ao trabalhador. Portanto, ao empregado, o aviso prévio não será inferior a 30 dias. Veja-se que, nos termos da Orientação Jurisprudencial 84 da SDI-1 do Tribunal Superior do Trabalho, a proporcionalidade do aviso prévio, com base n...
International Nuclear Information System (INIS)
Katsiadaki, Ioanna; Williams, Tim D.; Ball, Jonathan S.; Bean, Tim P.; Sanders, Matthew B.; Wu Huifeng; Santos, Eduarda M.; Brown, Margaret M.; Baker, Paul; Ortega, Fernando; Falciani, Francesco; Craft, John A.; Tyler, Charles R.; Viant, Mark R.; Chipman, James K.
2010-01-01
An established three-spined stickleback (Gasterosteus aculeatus) cDNA array was expanded to 14,496 probes with the addition of hepatic clones derived from subtractive and normalized libraries from control males and males exposed to model toxicants. Microarrays and one-dimensional 1 H nuclear magnetic resonance (NMR) spectroscopy, together with individual protein and gene biomarkers were employed to investigate the hepatic responses of the stickleback to ethinyl-estradiol (EE 2 ) exposure. Male fish were exposed via the water to EE 2 , including environmentally relevant concentrations (0.1-100 ng/l) for 4 days, and hepatic transcript and metabolite profiles, kidney spiggin protein and serum vitellogenin concentrations were determined in comparison to controls. EE 2 exposure did not significantly affect spiggin concentration but significantly induced serum vitellogenin protein at the threshold concentration of 32 ng/l. 1 H NMR coupled with robust univariate testing revealed only limited changes, but these did support the predicted modulation of the amino acid profile by transcriptomics. Transcriptional induction was found for hepatic vitellogenins and choriogenins as expected, together with a range of other EE 2 -responsive genes. Choriogenins showed the more sensitive responses with statistically significant induction at 10 ng/l. Real-time polymerase chain reaction (PCR) confirmed transcriptional induction of these genes. Phosvitinless vitellogenin C transcripts were highly expressed and represent a major form of the egg yolk precursors, and this is in contrast to other fish species where it is a minor component of vitellogenic transcripts. Differences in inducibility between the vitellogenins and choriogenins appear to be in accordance with the sequential formation of chorion and yolk during oogenesis in fish.
Energy Technology Data Exchange (ETDEWEB)
Katsiadaki, Ioanna, E-mail: ioanna.katsiadaki@cefas.co.uk [Centre for Environment, Fisheries and Aquaculture Science, Cefas Weymouth Laboratory, Weymouth, Dorset DT4 8UB (United Kingdom); Williams, Tim D. [School of Biosciences, University of Birmingham, Birmingham, B15 2TT (United Kingdom); Ball, Jonathan S. [School of Biosciences, University of Exeter, Exeter, Devon, EX4 4QJ (United Kingdom); Bean, Tim P.; Sanders, Matthew B. [Centre for Environment, Fisheries and Aquaculture Science, Cefas Weymouth Laboratory, Weymouth, Dorset DT4 8UB (United Kingdom); Wu Huifeng [School of Biosciences, University of Birmingham, Birmingham, B15 2TT (United Kingdom); Santos, Eduarda M. [School of Biosciences, University of Exeter, Exeter, Devon, EX4 4QJ (United Kingdom); Brown, Margaret M.; Baker, Paul [School of Biological and Biomedical Sciences, Glasgow Caledonian University, Glasgow, G4 0BA (United Kingdom); Ortega, Fernando; Falciani, Francesco [School of Biosciences, University of Birmingham, Birmingham, B15 2TT (United Kingdom); Craft, John A. [School of Biological and Biomedical Sciences, Glasgow Caledonian University, Glasgow, G4 0BA (United Kingdom); Tyler, Charles R. [School of Biosciences, University of Exeter, Exeter, Devon, EX4 4QJ (United Kingdom); Viant, Mark R.; Chipman, James K. [School of Biosciences, The University of Birmingham, Birmingham, B15 2TT (United Kingdom)
2010-05-05
An established three-spined stickleback (Gasterosteus aculeatus) cDNA array was expanded to 14,496 probes with the addition of hepatic clones derived from subtractive and normalized libraries from control males and males exposed to model toxicants. Microarrays and one-dimensional {sup 1}H nuclear magnetic resonance (NMR) spectroscopy, together with individual protein and gene biomarkers were employed to investigate the hepatic responses of the stickleback to ethinyl-estradiol (EE{sub 2}) exposure. Male fish were exposed via the water to EE{sub 2}, including environmentally relevant concentrations (0.1-100 ng/l) for 4 days, and hepatic transcript and metabolite profiles, kidney spiggin protein and serum vitellogenin concentrations were determined in comparison to controls. EE{sub 2} exposure did not significantly affect spiggin concentration but significantly induced serum vitellogenin protein at the threshold concentration of 32 ng/l. {sup 1}H NMR coupled with robust univariate testing revealed only limited changes, but these did support the predicted modulation of the amino acid profile by transcriptomics. Transcriptional induction was found for hepatic vitellogenins and choriogenins as expected, together with a range of other EE{sub 2}-responsive genes. Choriogenins showed the more sensitive responses with statistically significant induction at 10 ng/l. Real-time polymerase chain reaction (PCR) confirmed transcriptional induction of these genes. Phosvitinless vitellogenin C transcripts were highly expressed and represent a major form of the egg yolk precursors, and this is in contrast to other fish species where it is a minor component of vitellogenic transcripts. Differences in inducibility between the vitellogenins and choriogenins appear to be in accordance with the sequential formation of chorion and yolk during oogenesis in fish.
Costa-Silva, D G; Nunes, M E M; Wallau, G L; Martins, I K; Zemolin, A P P; Cruz, L C; Rodrigues, N R; Lopes, A R; Posser, T; Franco, J L
2015-10-01
Aquatic ecosystems are under constant risk due to industrial, agricultural, and urban activities, compromising water quality and preservation of aquatic biota. The assessment of toxicological impacts caused by pollutants to aquatic environment using biomarker measurements in fish can provide reliable data to estimate sublethal effects posed by chemicals in contaminated areas. In this study, fish (Astyanax sp. and Danio rerio) exposed to agricultural and urban effluents at the Vacacaí River, Brazil, were tested for potential signs of aquatic contamination. This river comprehends one of the main watercourses of the Brazilian Pampa, a biome with a large biodiversity that has been neglected in terms of environmental and social-economic development. Sites S1 and S2 were chosen by their proximity to crops and wastewater discharge points, while reference site was located upstream of S1 and S2, in an apparently non-degraded area. Fish muscle and brain tissues were processed for determination of acetylcholinesterase as well as oxidative stress-related biomarkers. The results showed signs of environmental contamination, hallmarked by significant changes in cholinesterase activity, expression of metallothionein, antioxidant enzymes, glutathione levels, and activation of antioxidant/cell stress response signaling pathways in fish exposed to contaminated sites when compared to reference. Based on these results, it is evidenced that urban and agricultural activities are posing risk to the environmental quality of water resources at the studied area. It is also demonstrated that cell stress biomarkers may serve as important tools for biomonitoring and development of risk assessment protocols in the Pampa biome.
Kang, Bong Jung; Okutsu, Tomoyuki; Tsutsui, Naoaki; Shinji, Junpei; Bae, Sun-Hye; Wilder, Marcy N
2014-01-01
Levels of vitellogenin (VG) and vitellogenesis-inhibiting hormone (VIH) in the whiteleg shrimp, Litopenaeus vannamei, were measured by time-resolved fluoroimmunoassay in relation to the molting cycle and ovarian maturation induced by eyestalk ablation. During the molt cycle, VG mRNA expression levels and VG concentrations showed similar patterns of fluctuation. VG levels increased significantly at early intermolt (stage C0) in adults, but not in subadults. Unilateral and bilateral eyestalk ablation increased VG levels in adults, whereas only bilateral eyestalk ablation affected subadults. VIH levels showed contrasting patterns between adults and subadults. In adults, levels were high in late postmolt adults (stage B) and then low thereafter, whereas they increased from postmolt (stage A) to intermolt (stage C0) in subadults and remained high. Unilateral eyestalk ablation increased VIH levels 10 days following ablation in adults, after which levels decreased at 20 days. VIH levels decreased from 10 to 20 days after bilateral ablation. Both unilateral and bilateral ablation led to increased VIH levels in subadults. Eyestalk ablation induced ovarian maturation, but did not reduce VIH concentrations in the hemolymph. This phenomenon was perhaps due to other crustacean hyperglycemic hormone peptides having cross-reactivity with VIH antibodies. This is the first report to quantify concentrations of VG and VIH together in L. vannamei hemolymph, and to examine their relative dynamics.
Zhang, Ji-Liang; Laurence Souders, Christopher; Denslow, Nancy D; Martyniuk, Christopher J
2017-07-15
Quercetin is a natural product that is sold as a supplement in health food stores. While there are reported benefits for this flavonoid as a dietary supplement due to antioxidant properties, the full scope of its biological interactions has not been fully addressed. To learn more about the mechanisms of action related to quercetin, we exposed zebrafish (Danio rerio) embryos to 1 and 10μg/L quercetin for 96h starting at 3h post fertilization. Quercetin up to 10μg/L did not induce significant mortality in developing fish, but did increase prevalence of an upward-curved dorsal plane in hatched larvae. To determine whether this developmental defect was potentially related to mitochondrial bioenergetics during development, we measured oxygen consumption rate in whole embryos following a 24-hour exposure to quercetin. Basal mitochondrial and ATP-linked respiration were decreased at 1 and 10μg/L quercetin, and maximal respiration was decreased at 10μg/L quercetin, suggesting that quercetin impairs mitochondrial bioenergetics. This is proposed to be related to the deformities observed during development. Due to the fact that ATP production was affected by quercetin, larval behaviors related to locomotion were investigated, as well as transcriptional responses of six myogenesis transcripts. Quercetin at 10μg/L significantly reduced the swimming velocity of zebrafish larvae. The expression levels of both myostatin A (mstna) and myogenic differentiation (myoD) were also altered by quercetin. Mstna, an inhibitory factor for myogenesis, was significantly increased at 1μg/L quercetin exposure, while myoD, a stimulatory factor for myogenesis, was significantly increased at 10μg/L quercetin exposure. There were no changes in transcripts related to apoptosis (bcl2, bax, casp3, casp7), but we did observe a decrease in mRNA levels for catalase (cat) in fish exposed to each dose, supporting an oxidative stress response. Our data support the hypothesis that quercetin may affect
Directory of Open Access Journals (Sweden)
Josef Daniel Rasinger
2017-03-01
Full Text Available The neurotoxicity of methylmercury (MeHg is well characterised, and the ameliorating effects of selenium have been described. However, little is known about the molecular mechanisms behind this contaminant-nutrient interaction. We investigated the influence of selenium (as selenomethionine, SeMet and MeHg on mercury accumulation and protein expression in the brain of adult zebrafish (Danio rerio. Fish were fed diets containing elevated levels of MeHg and/or SeMet in a 2 × 2 full factorial design for eight weeks. Mercury concentrations were highest in the brain tissue of MeHg-exposed fish compared to the controls, whereas lower levels of mercury were found in the brain of zebrafish fed both MeHg and SeMet compared with the fish fed MeHg alone. The expression levels of proteins associated with gap junction signalling, oxidative phosphorylation, and mitochondrial dysfunction were significantly (p < 0.05 altered in the brain of zebrafish after exposure to MeHg and SeMet alone or in combination. Analysis of upstream regulators indicated that these changes were linked to the mammalian target of rapamycin (mTOR pathways, which were activated by MeHg and inhibited by SeMet, possibly through a reactive oxygen species mediated differential activation of RICTOR, the rapamycin-insensitive binding partner of mTOR.
Directory of Open Access Journals (Sweden)
Luiza Wilges Kist
2011-01-01
Full Text Available Microcystins (MCs are toxins produced by cyanobacteria (blue-green algae, primarily Microcystis aeruginosa, forming water blooms worldwide. When an organism is exposed to environmental perturbations, alterations in normal behavioral patterns occur. Behavioral repertoire represents the consequence of a diversity of physiological and biochemical alterations. In this study, we assessed behavioral patterns and whole-body cortisol levels of adult zebrafish (Danio rerio exposed to cell culture of the microcystin-producing cyanobacterium M. aeruginosa (MC-LR, strain RST9501. MC-LR exposure (100 μg/L decreased by 63% the distance traveled and increased threefold the immobility time when compared to the control group. Interestingly, no significant alterations in the number of line crossings were found at the same MC-LR concentration and time of exposure. When animals were exposed to 50 and 100 μg/L, MC-LR promoted a significant increase (around 93% in the time spent in the bottom portion of the tank, suggesting an anxiogenic effect. The results also showed that none of the MC-LR concentrations tested promoted significant alterations in absolute turn angle, path efficiency, social behavior, or whole-body cortisol level. These findings indicate that behavior is susceptible to MC-LR exposure and provide evidence for a better understanding of the ecological consequences of toxic algal blooms.
Endocrine disruption and reproduction impairment in zebrafish after long-term exposure to DE-71.
Yu, Liqin; Liu, Chunsheng; Chen, Qi; Zhou, Bingsheng
2014-06-01
The objective of the present study was to investigate the impact of polybrominated diphenyl ethers (PBDEs) on fish reproduction over 2 generations. Zebrafish (Danio rerio) embryos (F0) were exposed to low concentrations (3 µg/L, 10 µg/L, and 30 µg/L) of the PBDE mixture DE-71 until they were sexually mature, and steroid hormone production, expression of genes involved in steroidogenesis, gonadal development, and gamete characteristics were examined. Exposure of female zebrafish to DE-71 resulted in lower estradiol production and downregulation of cytochrome P450 aromatase mRNA. In males, exposure to DE-71 resulted in greater testosterone production and greater cytochrome P450 c17 α-hydroxylase,17,20-lase mRNA expression. Moreover, hepatic vitellogenin mRNA and estrogenic receptor β gene transcription were downregulated in females and males. Expression of the follicle-stimulating hormone β gene in the pituitary was upregulated, and the expression of luteinizing hormone β was downregulated in both sexes. Histological examination showed inhibition of oocyte maturation in females and retarded spermiation in males. The average number of eggs (F1) produced was also reduced. Additionally, exposure of F0 embryos to DE-71 did not result in developmental toxicity, whereas delayed hatching, reduced survival, and decreased growth were observed in the F1 embryos derived from parent fish exposed to DE-71. Therefore, long-term exposure to low concentrations of PBDEs in zebrafish could cause reproductive impairment, suggesting that PBDEs might have significant adverse effects on fish population in the highly PBDEs-contaminated aquatic environment. © 2014 SETAC.
The nature of ethnic identity among the people of Curaçao
Dijs, N.M. van der
2011-01-01
This qualitative research explores the nature of ethnic identity among the people of Curaçao. The questions that are of fundamental interest to this study are: how do the people of Curaçao perceive themselves ethnically, how do they experience their sense of belonging to an ethnic group and what
Estrogenic effects of phytoestrogens in brown trout (Salmo trutta)
DEFF Research Database (Denmark)
Nielsen, Louise Marie; Holbech, Henrik; Bjerregaard, Poul
2010-01-01
, the potential effect of the waterborne phytoestrogens on endemic fish species is largely unknown. In the present investigation, the estrogenic effect of biochanin A was tested in brown trout through water exposure experiments. Juvenile brown trout of both sexes were exposed to different concentrations...... of biochanin A. In a ten day exposure experiments, NOEC and LOEC for plasma vitellogenin induction in brown trout were found to be 0.8µg biochanin A/L and 1.2µg biochanin A/L, respectively. A six hour pulse experiment resulted in NOEC and LOEC for induction of plasma vitellogenin in brown trout of 48µg...... biochanin A/L and 186µg biochanin A/L, respectively. Investigations of the ability of genistein to induce vitellogenin synthesis in brown trout are ongoing....
Software interativo: ecocardiografia na avaliaçao da hipertensao arterial
Directory of Open Access Journals (Sweden)
Fábio Abdalla Segamarchi
Full Text Available A hipertensao arterial é uma doença muito prevalente, evoluindo com lesoes em órgaos-alvo, alta morbidade e mortalidade. A avaliaçao das repercussoes cardíacas pela ecocardiografia tem papel importante na conduçao clínica dos indivíduos hipertensos, e suas imagens podem ser utilizadas como ferramenta para o ensino. OBJETIVOS: Desenvolver e avaliar um software, construído com base em imagens ecocardiográficas, abordando de forma ilustrativa e interativa a estrutura e funçao cardíacas normais,bem como as alteraçoes induzidas pela hipertensao arterial. MÉTODOS: Foram selecionadas imagens ecocardiográficas de indivíduos normais e com comprometimento cardíaco determinado pela hipertensao (hipertrofia ventricular esquerda, miocardiopatia dilatada e infarto do miocárdio. Com estas imagens foi construído um software no programa multimídia Flash, que foi avaliado por estudantes de Medicina (n=38 e Enfermagem (n=18, também submetidos a pré- e pós-teste. RESULTADOS: Os alunos consideraram o software útil, atraente e adequado as atuais metodologias educacionais proativas,promovendo ganho de conhecimento na compreensao do comprometimento cardíaco na hipertensao arterial. Conclusao: O software foi bem avaliado e considerado útil na aquisiçao de conhecimento numa área específica mais prevalente do comprometimento da saúde do adulto.
Dicty_cDB: Contig-U12832-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available N... 44 5.2 1 ( CV571667 ) oe15g07.y1 Human keratoconus cornea, unamplified,... 44 5.2 1 ( AI973283 ) wr54c0...Name: Full=E3 ubiquitin-protein ligase RNF19B; ... 41 0.024 (Q17RB8) RecName: Full=LON peptidase N-terminal ...urpuratus clone R3-3082J12, W... 38 0.34 6 ( EK301514 ) 1095462366289 Global-Ocean-Sampli...RI-214 Salmo salar genomic clone S... 44 5.2 1 ( ER301481 ) 1092343697994 Global-Ocean-Sampli...Y598454_1( AY598454 |pid:none) Danio rerio transcriptional interm... 39 0.070 CR853286_7( CR853286 |pid:none
East Asian winter temperature variation associated with the combined effects of AO and WP pattern
Park, Hye-Jin; Ahn, Joong-Bae
2016-04-01
The combined effects of the Arctic Oscillation (AO) and Western Pacific (WP) teleconnection pattern on the East Asian winter monsoon (EAWM) over the last 56 years (1958/59-2013/2014) were investigated using NCEP/NCAR reanalysis data (Park and Ahn, 2015). The study results revealed that the effect of the AO on winter temperature in East Asia could be changed depending on the phases of the WP pattern in the North Pacific. The negative relationship between the EAWM and the AO increased when the AO and WP were in-phase with each other. Hence, when winter negative (positive) AO was accompanied by negative (positive) WP, negative (positive) temperature anomalies were dominant across the entire East Asia region. Conversely, when the AO and WP were of-of-phase, the winter temperature anomaly in East Asia did not show distinct changes. Furthermore, from the perspective of stationary planetary waves, the zonal wavenumber-2 patterns of sea level pressure and geopotential height at 500hPa circulation strengthened when the AO and WP were in-phase but were not significant for the out-of-phase condition. It explained the possible mechanism of the combined effects of the AO and WP on the circulation related to EAWM. Reference Park, H.-J., and J.-B. Ahn (2015) Combined effect of the Arctic Oscillation and the Western Pacific pattern on East Asia winter temperature, Clim. Dyn. DOI:10.1007/s00382-015-2763-2. Acknowledgements This work was funded by the Korea Meteorological Administration Research and Development Program under grant KMIPA2015-2081.
Vulnerabilidade de adolescentes ao HIV/AIDS: revisão integrativa
Melina Mafra Toledo
2008-01-01
Introdução: A adolescência é um dos períodos mais intensos da vida, pelos desafios, descobertas e oportunidades de exploração nela presentes e, por isso, se constitui um determinante da vulnerabilidade ao HIV/AIDS. Objetivo: identificar as evidências científicas da literatura sobre os elementos da vulnerabilidade de adolescentes ao HIV/AIDS. Metodologia: Revisão sistemática da literatura, na modalidade de denominada revisão integrativa. A busca de dados foi realizada nas seguintes bases e ban...
Do mundano ao sagrado: o papel da efervescência na teoria moral durkheimiana
Directory of Open Access Journals (Sweden)
Raquel Andrade Weiss
2013-12-01
Full Text Available Meu objetivo neste artigo é discutir o significado do conceito de efervescência na obra durkheimiana e apontar o papel que esse processo desempenha em relação à sua teoria moral. De modo geral, a argumentação versa em torno da articulação de três pressupostos estruturais da teoria moral durkheimiana, quais sejam, 1 a vinculação entre sagrado e ideal moral, 2 a concepção acerca da natureza humana como sendo essencialmente dual e 3 a proposta normativa de Durkheim de institucionalização de uma moralidade laica. Ao final, proponho ao leitor uma reflexão sobre a pertinência de sua defesa de um "sagrado laico" a partir dos desafios morais que caracterizam o mundo contemporâneo.
Directory of Open Access Journals (Sweden)
Maria de Lourdes R. de Souza
1988-12-01
Full Text Available O peso ao nascer do recém-nascido é o resultado de diversos fatores (orgânicos, psíquicos e sociais sobre o potencial genético do feto. É natural que sua distribuição seja diferente conforme as características da população. Desta maneira, pretendeu-se estudar o peso ao nascer dos recém-nascidos vivos, de 1978 e 1979, de duas grandes maternidades de Florianópolis, SC (Brasil, nas quais ocorrem 90% dos partos da região, segundo sexo, tipo de nascimento e filiação previdenciária das mães. Observou-se que a média de peso ao nascer dos 18.491 recém-nascidos vivos estudados foi de 3.347,6g. Nessa população ocorreu 5,3% de baixo peso ao nascer e 11,1% de crianças com 4.000g ou mais. As crianças do sexo masculino pesaram ao nascer mais que as do sexo feminino, sendo esta diferença estatisticamente significativa. O mesmo fato ocorreu com as crianças de nascimentos únicos e múltiplos, tendo os primeiros peso ao nascer maior que os segundos, sendo também esta diferença estatisticamente significativa. O estudo da relação entre a filiação previdenciária das mães e o peso ao nascer das crianças mostrou que as mulheres da classe "indigente/serv. social" tiveram número significativamente maior de recém-nascidos de baixo peso do que os de outras categorias sociais. Esses dados mostram que a população estudada apresentou uma baixa incidência de baixo peso ao nascer, com uma distribuição de peso ao nascer semelhante a de países adiantados.Birthweight is the result of many factors (organic, psychological, social acting on the genetic potential of the fetus. Consequently, its distribution is different according to the characteristics of the population. In this paper the authors studied the weight at birth of live newborns (from 1978 to 1979 in the two big maternity hospitals, in Florianópolis, responsible for 90% of all births in the area, by sex, litter size and mother's health security. The authors verified that the
Adesão ao tratamento no transtorno bipolar Compliance to treatment in bipolar disorder
Directory of Open Access Journals (Sweden)
Aida Santin
2005-01-01
Full Text Available O transtorno bipolar (TB é uma doença crônica, recorrente, presente em 1,5% da população, estando associada a altas taxas de mortalidade e prejuízos socioeconômicos. O lítio, a carbamazepina e o ácido valpróico são os estabilizadores de humor mais usados. Em tratamentos prolongados, como é o caso do TB, a má-adesão dos pacientes é uma das maiores dificuldades. Verifica-se que fatores ligados ao paciente, aos medicamentos e aos médicos possam ser responsáveis pela baixa adesão. A psicoeducação, a terapia cognitivo-comportamental e a terapia focada na família são estratégias propostas para o aumento da adesão.Bipolar disorder (BD is a chronic and recurrent illness that occurs in 1,5% of the population. This illness is associated with high rates of mortality and social/economic burden. Lithium, carbamazepine and valproic acid are the most used mood stabilizers. In long term treatments, as in BD, one of the main difficulties is the patient's adherence. It appears that factors associated to the patient, drug and the physician are responsible for the low adherence. The use of psycho-education, cognitive-behavioral therapy and focused family therapy have been put forward as a means to increase adherence.
Avaliação da qualidade de vida e vulnerabilidade ao estresse no contexto hospitalar
Directory of Open Access Journals (Sweden)
Fernanda Ottati
2013-05-01
Full Text Available O conceito de Qualidade de Vida é usado para medir as condições de vida de um ser humano, já a palavra vulnerabilidade refere-se à chance das pessoas estarem expostas ao adoecer. Objetivou-se analisar possíveis relações entre percepção de qualidade de vida e a vulnerabilidade ao estresse no trabalho em enfermeiros, técnicos e auxiliares de enfermagem que atuam na UTI e no setor de emergência de um hospital público. Utilizou-se o instrumento de qualidade de vida da Organização Mundial da Saúde, WHOQOL-Bref e a Escala de Vulnerabilidade ao Estresse no Trabalho. Encontrou-se, em relação ao setor de trabalho, diferença significativa apenas para Qualidade de vida total. Portanto pode-se afirmar que os profissionais que atuam na UTI possuem maior percepção de qualidade de vida quando comparados aos do SUS. Na correlação entre os dois instrumentos, o domínio meio ambiente do WHOQOL-Bref correlacionou-se negativa e significativamente com todos os fatores da EVENT, indicando que a percepção da pessoa em relação aos diversos aspectos do meio em que vive tem relação com a vulnerabilidade ao estresse.
Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT
Directory of Open Access Journals (Sweden)
Jorge Henrique Santos Saldanha
Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.
Hinck, Jo Ellen; Papoulias, Diana M.; Annis, Mandy L.; Tillitt, Donald E.; Marr, Carrie; Denslow, Nancy D.; Kroll, Kevin J.; Nachtmann, Jason
2011-01-01
Population declines of the endangered razorback sucker Xyrauchen texanus in the Colorado River basin have been attributed to predation by and competition with nonnative fishes, habitat alteration, and dam construction. The reproductive health and seasonal variation of the reproductive end points of razorback sucker populations are currently unknown. Using nonlethal methods, we characterized the plasma hormonal fluctuations of reproductively mature female and male razorback suckers over a 12-month period in a hatchery by measuring their vitellogenin (VTG) and three sex hormones: 17β-estradiol (E2), testosterone (T), and 11-ketotestosterone (KT). Fish were identified as reproductive or nonreproductive based on their body weight, VTG, and sex hormone profiles. In reproductive females, the E2 concentration increased in the fall and winter, and increases in T and VTG concentrations were generally associated with the spawning period. Mean T concentrations were consistently greater in reproductive females than in nonreproductive females, but this pattern was even more pronounced during the spawning period (spring). Consistently low T concentrations (the spawning period may indicate reproductive impairment. In reproductive males, spring increases in KT and T concentrations were associated with spawning; concentrations of E2 (the study. In addition, the E2 : KT ratio and T were the best metrics by which to distinguish female from male adult razorback suckers throughout the year. These metrics of reproductive health and condition may be particularly important to recovery efforts of razorback suckers given that the few remaining wild populations are located in a river where water quality and quantity issues are well documented. In addition to the size, age, and recruitment information currently considered in the recovery goals of this endangered species, reproductive end points could be included as recovery metrics with which to monitor seasonal trends and determine whether
Effects of phytosterols on zebrafish reproduction in multigeneration test
International Nuclear Information System (INIS)
Nakari, Tarja; Erkomaa, Kirsti
2003-01-01
A multigeneration test is used to show disruption of the reproductive system by phytosterols. - Zebrafish from mixed sex populations were exposed continuously across three generations to two phytosterol preparations both containing β-sitosterol. The phytosterols were isolated from wood and soy beans. Blood vitellogenin levels and sex ratio changes were used as intermediate indicators of the reproduction failures. Both sterol preparations caused vitellogenin induction in the exposed fish. The wood sterol changed the sex ratio of the exposed fish. In generation F1, the predominant sex was male, and in generation F2 it was female. The soy sterol in the used test concentration was lethal to the exposed fish in generation F1. This multigeneration test evidenced that phytosterols containing β-sitosterol disrupt the reproduction system of zebrafish by changing the sex ratios and by inducing the vitellogenin production in the exposed fish
Effects of phytosterols on zebrafish reproduction in multigeneration test
Energy Technology Data Exchange (ETDEWEB)
Nakari, Tarja; Erkomaa, Kirsti
2003-05-01
A multigeneration test is used to show disruption of the reproductive system by phytosterols. - Zebrafish from mixed sex populations were exposed continuously across three generations to two phytosterol preparations both containing {beta}-sitosterol. The phytosterols were isolated from wood and soy beans. Blood vitellogenin levels and sex ratio changes were used as intermediate indicators of the reproduction failures. Both sterol preparations caused vitellogenin induction in the exposed fish. The wood sterol changed the sex ratio of the exposed fish. In generation F1, the predominant sex was male, and in generation F2 it was female. The soy sterol in the used test concentration was lethal to the exposed fish in generation F1. This multigeneration test evidenced that phytosterols containing {beta}-sitosterol disrupt the reproduction system of zebrafish by changing the sex ratios and by inducing the vitellogenin production in the exposed fish.
Directory of Open Access Journals (Sweden)
Daniela Marreco Cerqueira
2004-09-01
Full Text Available The detection of polymorphisms associated to HIV-1 drug-resistance and genetic subtypes is important for the control and treatment of HIV-1 disease. Drug pressure selects resistant variants that carry mutations in the viral reverse transcriptase (RT and protease (PR genes. For a contribution to the public health authorities in planning the availability of therapeutic treatment, we therefore described the genetic variability, the prevalence of mutations associated to drug resistance and the antiretroviral resistance profile in HIV-1 isolates from infected individuals in Central Brazil. Nineteen HIV-1 RNA samples from a Public Health Laboratory of the Federal District were reversely transcribed and cDNAs were amplified by nested PCR. One fragment of 297 bp coding the entire protease gene, and another of 647 bp, corresponding to the partial RT gene (codons 19-234, were obtained. Automated sequencing and BLAST analysis revealed the presence of 17 B and 2 F1 HIV-1 subtypes. The amino acid sequences were analyzed for the presence of resistance-associated mutations. A total of 6 PR mutations, 2 major and 4 accessory, and 8 RT mutations related to drug resistance were found. Our data suggest a high prevalence of HIV-1 B subtype in the studied population of Federal District as well as the presence of genetically-resistant strains in individuals failing treatment.A detecção de polimorfismos do HIV-1 que estejam associados à resistência às drogas anti-retrovirais e aos subtipos genéticos é importante para o controle e tratamento da infecção pelo HIV-1. A pressão exercida pela terapia anti-retroviral seleciona variantes resistentes com mutações nos genes virais da transcriptase reversa (RT e da protease (PR. Assim, visando contribuir com as autoridades de saúde pública na perspectiva de planejar a disponibilidade de um tratamento terapêutico, nós descrevemos a variabilidade genética e a prevalência de mutações associadas à resist
Comportamentos de adesão ao rastreio do cancro do colo do útero
Areias, Paula Alexandra Pombo Pereira
2011-01-01
Enquadramento: O cancro do colo do útero é o segundo tipo de cancro mais frequente na mulher, a adesão ao rastreio possibilita a identificação do problema numa fase precoce. Objectivos: O nosso estudo tem como objectivo analisar em que medida as características sóciodemográficas e profissionais, os conhecimentos em relação ao cancro do colo do útero e rastreio, as crenças de saúde afectam a adesão ao rastreio. Métodos: Realizamos um estudo de natureza quantitativa, não experime...
Adesão de pessoas com diabetes mellitus tipo 2 ao tratamento medicamentoso
Directory of Open Access Journals (Sweden)
Lilian Cristiane Gomes-Villas Boas
2014-04-01
Full Text Available Estudo seccional de abordagem quantitativa que objetivou avaliar a adesão ao tratamento medicamentoso entre pessoas com diabetes mellitus, e sua relação com variáveis clínicas, de tratamento e controle metabólico. A amostra constituiu-se de 162 pessoas com diabetes mellitus tipo 2 em seguimento ambulatorial. Para a coleta dos dados, foram utilizadas a Medida de Adesão aos Tratamentos e a consulta aos prontuários dos participantes. Obteve-se elevada adesão ao tratamento medicamentoso. Para um p<0,05, obteve-se correlação inversa com a pressão arterial diastólica e correlação direta com a frequência diária de administração de insulina e de antidiabéticos orais. Não houve correlações estatisticamente significantes entre adesão e variáveis de controle metabólico. Os resultados divergem da literatura no que se refere à taxa de adesão ao tratamento medicamentoso em doenças crônicas, bem como na correlação entre adesão e complexidade do regime medicamentoso, o que aponta para a necessidade de mais estudos sobre essa temática.
Bertotto, Luísa Becker; Richards, Jaben; Gan, Jay; Volz, David Christopher; Schlenk, Daniel
2018-01-01
Bifenthrin is a pyrethroid insecticide used in urban and agricultural applications. Previous studies have shown that environmentally relevant (ng/L) concentrations of bifenthrin increased plasma concentrations of 17β-estradiol (E2) and altered the expression of dopaminergic pathway components. The dopaminergic neurons can indirectly regulate E2 biosynthesis, suggesting that bifenthrin may disrupt the hypothalamic-pituitary-gonadal (HPG) axis. Because embryos do not have a complete HPG axis, the hypothesis that bifenthrin impairs dopamine regulation was tested in embryonic and 1-mo-old juvenile zebrafish (Danio rerio) with exposure to measured concentrations of 0.34 and 3.1 µg/L bifenthrin for 96 h. Quantitative reverse transcriptase polymerase chain reaction was used to investigate transcripts of tyrosine hydroxylase (TH), dopamine receptor 1 (DR1) and 2A (DR2A), dopamine active transporter (DAT), estrogen receptor α (ERα), ERβ1, ERβ2, luteinizing hormone β (LHβ), follicle-stimulating hormone β (FSHβ), vitellogenin (VTG), cytochrome P450 cyp19a1a, and cyp19a1b. Levels of E2 were measured by enzyme-linked immunosorbent assay (ELISA). Dopamine and its metabolites 3,4-dihydroxyphenylacetic acid (DOPAC) and homovanillic acid (HVA) concentrations were measured by liquid chromatrography-tandem mass spectrometry (LC-MS/MS). Significant decreases in TH and DR1 transcripts and HVA levels, as well as ratios of HVA/dopamine and HVA+DOPAC/dopamine, in zebrafish embryos were observed after bifenthrin treatment. In juveniles, a significant increase in the expression of ERβ1 and the DOPAC to dopamine ratio was noted. These results show a possible antiestrogenic effect of bifenthrin in embryos, and estrogenicity in juveniles, indicating life-stage-dependent toxicity in developing fish. Environ Toxicol Chem 2018;37:236-246. © 2017 SETAC. © 2017 SETAC.
Directory of Open Access Journals (Sweden)
Miaomiao Li
Full Text Available Agarose (AP from red algae has a long history as food ingredients in East Asia. Agaro-oligosaccharides (AO derived from AP have shown potential prebiotic effects. However, the human gut microbes responsible for the degradation of AO and AP have not yet been fully investigated. Here, we reported that AO and AP can be degraded and utilized at various rates by fecal microbiota obtained from different individuals. Bacteroides uniformis L8 isolated from human feces showed a pronounced ability to degrade AO and generate D-galactose as its final end product. PCR-DGGE analysis showed B. uniformis to be common in the fecal samples, but only B. uniformis L8 had the ability to degrade AO. A synergistic strain, here classified as Escherichia coli B2, was also identified because it could utilize the D-galactose as the growth substrate. The cross-feeding interaction between B. uniformis L8 and E. coli B2 led to exhaustion of the AO supply. Bifidobacterium infantis and Bifidobacterium adolescentis can utilize one of the intermediates of AO hydrolysis, agarotriose. Growth curves indicated that AO was the substrate that most favorably sustained the growth of B. uniformis L8. In contrast, κ-carrageenan oligosaccharides (KCO, guluronic acid oligosaccharides (GO, and mannuronic acid oligosaccharides (MO were found to be unusable to B. uniformis L8. Current results indicate that B. uniformis L8 is a special degrader of AO in the gut microbiota. Because B. uniformis can mitigate high-fat-diet-induced metabolic disorders, further study is required to determine the potential applications of AO.
Perez, Consuelo J.; Tata, Alessandra; de Campos, Michel L.; Peng, Chun; Ifa, Demian R.
2017-06-01
Ambient mass spectrometry imaging has become an increasingly powerful technique for the direct analysis of biological tissues in the open environment with minimal sample preparation and fast analysis times. In this study, we introduce desorption electrospray ionization mass spectrometry imaging (DESI-MSI) as a novel, rapid, and sensitive approach to localize the accumulation of a mildly toxic ionic liquid (IL), AMMOENG 130 in zebrafish ( Danio rerio). The work demonstrates that DESI-MSI has the potential to rapidly monitor the accumulation of IL pollutants in aquatic organisms. AMMOENG 130 is a quaternary ammonium-based IL reported to be broadly used as a surfactant in commercialized detergents. It is known to exhibit acute toxicity to zebrafish causing extensive damage to gill secondary lamellae and increasing membrane permeability. Zebrafish were exposed to the IL in a static 96-h exposure study in concentrations near the LC50 of 1.25, 2.5, and 5.0 mg/L. DESI-MS analysis of zebrafish gills demonstrated the appearance of a dealkylated AMMOENG 130 metabolite in the lowest concentration of exposure identified by a high resolution hybrid LTQ-Orbitrap mass spectrometer as the trimethylstearylammonium ion, [C21H46N]+. With DESI-MSI, the accumulation of AMMOENG 130 and its dealkylated metabolite in zebrafish tissue was found in the nervous and respiratory systems. AMMOENG 130 and the metabolite were capable of penetrating the blood brain barrier of the fish with significant accumulation in the brain. Hence, we report for the first time the simultaneous characterization, distribution, and metabolism of a toxic IL in whole body zebrafish analyzed by DESI-MSI. This ambient mass spectrometry imaging technique shows great promise for the direct analysis of biological tissues to qualitatively monitor foreign, toxic, and persistent compounds in aquatic organisms from the environment. [Figure not available: see fulltext.
O Primeiro Ano do Grupo de Apoio ao Primeiranista
Directory of Open Access Journals (Sweden)
Rodolfo Furlan Damiano
Full Text Available Este trabalho é um relato de experiência do primeiro ano de funcionamento do Grupo de Apoio ao Primeiranista (GAP. O GAP é um grupo desenvolvido por alunos de Medicina de uma universidade privada do Estado de São Paulo, apoiado por sua direção, com o intuito de amparar e humanizar a recepção aos ingressantes. O início das atividades do GAP ocorreu em 2013 com base nos conceitos de tutoria/mentoring, aplicado por outras escolas médicas brasileiras. Nas reuniões semanais do GAP, os participantes (alunos do primeiro ano e mentores (acadêmicos veteranos e uma psicóloga institucional discutiam temas como resiliência, compaixão, humildade e respeito. Durante as reuniões, notou-se uma problemática extensa em relação ao trote universitário, referido pelos primeiranistas como o pior problema enfrentado na universidade. Na sequência dos encontros, o grupo direcionou suas ações para reduzir o trote na universidade. O GAP, apesar de estar em seu primeiro ano de funcionamento, mostrou ter eficácia relevante, podendo ser um modelo a ser implementado em outras universidades.
Directory of Open Access Journals (Sweden)
Leonardo R. de Lima
2013-08-01
Full Text Available O recrutamento de leucócitos aos tecidos é uma parte essencial da resposta imune inata e esse processo de forma desregulada pode resultar em lesões aos tecidos. Assim, a infiltração de leucócitos tem sido implicada na patogênese de laminite aguda em equinos. Os objetivos dessa pesquisa foram verificar a ação da ICXCR1/2 sobre os sinais clínicos e parâmetros hematológicos de cavalos com laminite induzida por oligofrutose. Doze equinos receberam oligofrutose (10g/kg de peso vivo PO no tempo 0 e foram divididos em 2 grupos: tratados (30mg/kg p.v. ICXCR1/2 IV, nos tempos 6, 12, 18 e 24 h e não tratados. As frequências cardíaca e respiratória, temperatura retal, coloração de membranas mucosas, presença e intensidade de pulso digital, sensibilidade ao exame com pinça de casco e grau de claudicação segundo Obel, bem como parâmetros hematológicos e bioquímicos (hemograma e as concentrações sanguíneas de glicose, uréia, creatinina, ALT, AST, FA, GGT, bilirrubina total e proteína total foram aferidos nos tempos 0, 6, 12, 18, 24, 36, 48, 60 e 72 horas . O modelo usando oligofructose foi adequado para induzir sinais de laminite e de sinais de endotoxemia, como diarreia, febre e leucocitose em cavalos sem raça definida de origem nacional. Também, não foram observadas quaisquer reações adversas clínicas ou hematológicas relacionadas ao uso intravenoso do antagonista de CXCR1/2, contudo essa substância, quando administrada na dose de 30mg/kg de peso vivo, 4 vezes ao dia, por 4 aplicações, não foi capaz de prevenir os sinais clínicos e as alterações hematológicas causadas pela administração de oligofructose nos equinos deste estudo.
Combined effects of alpha particles and depleted uranium on Zebrafish (Danio rerio) embryos
International Nuclear Information System (INIS)
Ng, Candy Y.P.; Pereira, Sandrine; Cheng, Shuk Han; Adam-Guillermin, Christelle; Garnier-Laplace, Jacqueline; Yu, Kwan Ngok
2016-01-01
The combined effects of low-dose or high-dose alpha particles and depleted uranium (DU) in Zebrafish (Danio rerio) embryos were studied. Three schemes were examined—(i) [I L U L ]: 0.44 mGy alpha-particle dose + 10 µg/l DU exposure, (ii) [I H U H ]: 4.4 mGy alpha-particle dose + 100 µg/l DU exposure and (iii) [I H U L ]: 4.4 mGy alpha-particle dose + 10 µg/l DU exposure—in which Zebrafish embryos were irradiated with alpha particles at 5 h post fertilization (hpf) and/or exposed to uranium at 5–6 hpf. The results were also compared with our previous work, which studied the effects of [I L U H ]: 0.44 mGy alpha-particle dose + 100 µg/l DU exposure. When the Zebrafish embryos developed to 24 hpf, the apoptotic signals in the entire embryos, used as the biological endpoint for this study, were quantified. Our results showed that [I L U L ] and [I H U L ] led to antagonistic effects, whereas [I H U H ] led to an additive effect. The effect found for the previously studied case of [I L U H ] was difficult to define because it was synergistic with reference to the 100 µg/l DU exposure, but it was antagonistic with reference to the 0.44 mGy alpha-particle dose. All the findings regarding the four different schemes showed that the combined effects critically depended on the dose response to each individual stressor. We also qualitatively explained these findings in terms of promotion of early death of cells predisposed to spontaneous transformation by alpha particles, interacting with the delay in cell death resulting from various concentrations of DU exposure
Juan Manuel Yañez Arauz; Ignacio Arzac Ulla; Javier Del Vecchio; Andres Eksarho; Leandro Civetta; Rodrigo Perez Davila
2015-01-01
Introducción Las fracturas distales de tibia son un desafío para el tratamiento debido a la escasa cobertura y particular vascularización. Los objetivos del presente estudio son analizar los resultados clínicos y funcionales de los pacientes con fractura de tibia distal; tratados con técnica MIPO (minimally invasive plate osteosynthesis) con placas bloqueadas; comparar los resultados del grupo de fracturas tipo AO 43A con las tipo AO 43C1-C2; y comparar los resultados MIPO con el tratamie...
Análise de fatores associados ao significado do trabalho
Directory of Open Access Journals (Sweden)
Sergio Hideo Kubo
2012-12-01
Full Text Available O trabalho tem sido visto não somente como forma de obter a renda, mas também como atividade que proporciona realização pessoal, status social e possibilidade de estabelecer e manter contatos interpessoais, entre outros. Nesta pesquisa, teve-se como objetivo investigar os fatores que influenciam e conferem sentido ao trabalho, como centralidade do trabalho, normas da sociedade e objetivos e resultados valorizados. Na centralidade do trabalho, procurou-se investigar o grau de importância do trabalho dentro do contexto das diversas áreas da vida das pessoas, como família, lazer, religião e vida comunitária. Em normas da sociedade, foram analisados os pontos mais significativos no tocante ao que a sociedade deveria proporcionar ao indivíduo, assim como o que o indivíduo deveria fazer em prol da sociedade. Nos objetivos e resultados valorizados, foi pesquisado o que as pessoas buscam com o trabalho. A partir da pesquisa na literatura, foi elaborado um modelo inicial que, não se mostrando satisfatório segundo critérios estatísticos, foi substituído por outro que apresentou significância estatística e boa aderência aos dados. O modelo escolhido foi o que melhor goodness-of-fit apresentou, quando se utilizou modelagem de equações estruturais pelo método partial least square. O estudo revelou que o significado do trabalho se reflete, na ordem, na centralidade do trabalho, nos objetivos e resultados valorizados e, por último, nas normas sociais.
Projecto 254 - Produção de suínos ao ar livre : unidade de demonstração Programa AGRO
Marinho, M.C.; Dias, S.F.; Rodrigues, J.P.V.
2006-01-01
A produção de suínos ao ar livre pode contribuir para a preservação e valorização das raças autóctones e dos produtos delas derivados, evitando assim a sua extinção. O projecto, Produção de suínos ao ar livre – Unidade de demonstração, cujo período de execução vai de setembro de 2004 a dezembro de 2006, tem como principal objectivo demonstrar a tecnologia de produção de leitões ao ar livre. Programa AGRO - Projecto 254, Medida 8.1.
Dynamic SPECT of the brain using a lipophilic technetium-99m complex, PnAO
DEFF Research Database (Denmark)
Holm, S; Andersen, A R; Vorstrup, S
1985-01-01
m PnAO was injected i.v. as a bolus of 15 to 25 mCi. The distribution was followed over 10-sec intervals using a highly sensitive, rapidly rotating SPECT (Tomomatic 64) and compared to 133Xe flow maps. Upon arrival of the PnAO bolus to the brain, a high uptake was found in brain tissue with high......The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-99......AO has a high yet incomplete brain extraction yielding a flow dominated initial distribution with limitations mentioned....
Dicty_cDB: Contig-U12196-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available RecName: Full=Mitochondrial import inner membrane trans... 103 8e-21 BC122182_1( BC122182 |pid:none) Danio rerio CTD (carboxy-term...d:none) Leishmania braziliensis chromoso... 53 2e-05 (Q8SV03) RecName: Full=RNA polymerase II subunit A C-term...ecName: Full=RNA polymerase II subunit A C-terminal do... 39 0.18 BC063447_1( BC063447 |pid:none) Homo sapiens CTD (carboxy-term...clone BO... 44 8.9 1 ( ER303350 ) 1092343723909 Global-Ocean-Sampling_GS-34-01-01-1... 44 8.9 1 ( EJ487331 )... 1095403512301 Global-Ocean-Sampling_GS-28-01-01-1... 44 8.9 1 ( EJ415060 ) 10930
Dicty_cDB: Contig-U11124-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available P000388_1017( CP000388 |pid:none) Pseudoalteromonas atlantica T6c... 112 4e-23 FM992689_561( FM992689 |pid:none) Candida dubliniensi...8e-46 AY310275_1( AY310275 |pid:none) Uroblaniulus canadensis voucher Pa... 187 8e-46 AY310266_1( AY310266 |pid:none) Lamyctes..... 157 1e-36 AY310255_1( AY310255 |pid:none) Docodesmus trinidadensis voucher D... 156 2e-36 AY305524_1( AY3................done Score E Sequences producing significant alignments: (bits) Value N ( BJ427602 ) Dictyostelium disc...AF248644_1( AF248644 |pid:none) Filobasidiella neoformans var. neo... 191 7e-47 BC059523_1( BC059523 |pid:none) Danio rerio si
Oxidative stress and regulation of Pink1 in zebrafish (Danio rerio.
Directory of Open Access Journals (Sweden)
Madhusmita Priyadarshini
Full Text Available Oxidative stress-mediated neuronal dysfunction is characteristic of several neurodegenerative disorders, including Parkinson's disease (PD. The enzyme tyrosine hydroxylase (TH catalyzes the formation of L-DOPA, the rate-limiting step in the biosynthesis of dopamine. A lack of dopamine in the striatum is the most characteristic feature of PD, and the cause of the most dominant symptoms. Loss of function mutations in the PTEN-induced putative kinase (PINK1 gene cause autosomal recessive PD. This study explored the basic mechanisms underlying the involvement of pink1 in oxidative stress-mediated PD pathology using zebrafish as a tool. We generated a transgenic line, Tg(pink1:EGFP, and used it to study the effect of oxidative stress (exposure to H2O2 on pink1 expression. GFP expression was enhanced throughout the brain of zebrafish larvae subjected to oxidative stress. In addition to a widespread increase in pink1 mRNA expression, mild oxidative stress induced a clear decline in tyrosine hydroxylase 2 (th2, but not tyrosine hydroxylase 1 (th1 expression, in the brain of wild-type larvae. The drug L-Glutathione Reduced (LGR has been associated with anti-oxidative and possible neuroprotective properties. Administration of LGR normalized the increased fluorescence intensity indicating pink1 transgene expression and endogenous pink1 mRNA expression in larvae subjected to oxidative stress by H2O2. In the pink1 morpholino oliogonucleotide-injected larvae, the reduction in the expression of th1 and th2 was partially rescued by LGR. The pink1 gene is a sensitive marker of oxidative stress in zebrafish, and LGR effectively normalizes the consequences of mild oxidative stress, suggesting that the neuroprotective effects of pink1 and LGR may be significant and useful in drug development.
Manalo, Trina; May, Adam; Quinn, Joshua; Lafontant, Dominique S.; Shifatu, Olubusola; He, Wei; Gonzalez-Rosa, Juan M.; Burns, Geoffrey C.; Burns, Caroline E.; Burns, Alan R.; Lafontant, Pascal J.
2016-01-01
Lectins are carbohydrate-binding proteins commonly used as biochemical and histochemical tools to study glycoconjugate (glycoproteins, glycolipids) expression patterns in cells, tissues, including mammalian hearts. However, lectins have received little attention in zebrafish (Danio rerio) and giant danio (Devario aequipinnatus) heart studies. Here, we sought to determine the binding patterns of six commonly used lectins—wheat germ agglutinin (WGA), Ulex europaeus agglutinin, Bandeiraea simplicifolia lectin (BS lectin), concanavalin A (Con A), Ricinus communis agglutinin I (RCA I), and Lycopersicon esculentum agglutinin (tomato lectin)—in these hearts. Con A showed broad staining in the myocardium. WGA stained cardiac myocyte borders, with binding markedly stronger in the compact heart and bulbus. BS lectin, which stained giant danio coronaries, was used to measure vascular reconstruction during regeneration. However, BS lectin reacted poorly in zebrafish. RCA I stained the compact heart of both fish. Tomato lectin stained the giant danio, and while low reactivity was seen in the zebrafish ventricle, staining was observed in their transitional cardiac myocytes. In addition, we observed unique staining patterns in the developing zebrafish heart. Lectins’ ability to reveal differential glycoconjugate expression in giant danio and zebrafish hearts suggests they can serve as simple but important tools in studies of developing, adult, and regenerating fish hearts. PMID:27680670
DO ÊXTASE AO CRIME? UM CONTO POLICIAL BRASILEIRO RECHEADO DE LATIM
Directory of Open Access Journals (Sweden)
Valéria Marta Ribeiro Soares
2017-03-01
Full Text Available Os contos policiais, de Luiz Lopes Coelho, advogado paulista, são pouco conhecidos. Este trabalho visa analisar o conto Do êxtase ao crime?, tan-to do ponto de vista estético quanto lingüístico. No ângulo literário, serão analisados os elementos que fazem dele uma ficção policial e, no aspecto lin-güístico, serão destacados os termos latinos que causam uma singularidade na obra e ajudam a interpretá-la. Contistas do gênero policial no Brasil são muito raros, devido ao rótulo dado por muitos eruditos de tal gênero ser “uma das mais limitadas entre as formas populares de ficção”. Do êxtase ao crime? pode dar ao leitor uma nova visão desse gênero, pois o autor consegue aliar o engenho e a arte na escolha dos vocábulos, especialmente, os latinos, e na criação do mistério, suspense e situações imprevistas do conto em ques-tão.
Fatores associados ao óbito de motociclistas nas ocorrências de trânsito
Directory of Open Access Journals (Sweden)
Nelson Luiz Batista de Oliveira
2012-12-01
Full Text Available Para identificar fatores associados ao óbito em motociclistas envolvidos em ocorrências de trânsito, em Maringá-PR, foi realizado estudo retrospectivo incluindo os motociclistas envolvidos em acidentes no ano de 2004. As fontes de dados foram os registros da Polícia Militar, do SIATE e do Instituto Médico Legal. Foram realizadas análises bivariadas e regressão logística binária. Identificaram-se 2.362 motociclistas nos Boletins de Ocorrência e, destes, 1.743 tinham registros nos Relatórios de Atendimento do Socorrista. As vítimas fatais diferiram das demais quanto à faixa etária, ao local de residência, ao tempo de habilitação e as suas condições fisiológicas na cena da ocorrência. No modelo final permaneceram as seguintes variáveis: Escala de Coma de Glasgow (ECGl, Revised Trauma Score (RTS, pulso e saturação de O2 no sangue. As condições fisiológicas das vítimas na cena do acidente se destacaram no modelo final e a ECGl superou o RTS na associação com óbito.
Hemocyte-mediated phagocytosis differs between honey bee (Apis mellifera) worker castes.
Hystad, Eva Marit; Salmela, Heli; Amdam, Gro Vang; Münch, Daniel
2017-01-01
Honey bees as other insects rely on the innate immune system for protection against diseases. The innate immune system includes the circulating hemocytes (immune cells) that clear pathogens from hemolymph (blood) by phagocytosis, nodulation or encapsulation. Honey bee hemocyte numbers have been linked to hemolymph levels of vitellogenin. Vitellogenin is a multifunctional protein with immune-supportive functions identified in a range of species, including the honey bee. Hemocyte numbers can increase via mitosis, and this recruitment process can be important for immune system function and maintenance. Here, we tested if hemocyte mediated phagocytosis differs among the physiologically different honey bee worker castes (nurses, foragers and winter bees), and study possible interactions with vitellogenin and hemocyte recruitment. To this end, we adapted phagocytosis assays, which-together with confocal microscopy and flow cytometry-allow qualitative and quantitative assessment of hemocyte performance. We found that nurses are more efficient in phagocytic uptake than both foragers and winter bees. We detected vitellogenin within the hemocytes, and found that winter bees have the highest numbers of vitellogenin-positive hemocytes. Connections between phagocytosis, hemocyte-vitellogenin and mitosis were worker caste dependent. Our results demonstrate that the phagocytic performance of immune cells differs significantly between honey bee worker castes, and support increased immune competence in nurses as compared to forager bees. Our data, moreover, provides support for roles of vitellogenin in hemocyte activity.
Hemocyte-mediated phagocytosis differs between honey bee (Apis mellifera worker castes.
Directory of Open Access Journals (Sweden)
Eva Marit Hystad
Full Text Available Honey bees as other insects rely on the innate immune system for protection against diseases. The innate immune system includes the circulating hemocytes (immune cells that clear pathogens from hemolymph (blood by phagocytosis, nodulation or encapsulation. Honey bee hemocyte numbers have been linked to hemolymph levels of vitellogenin. Vitellogenin is a multifunctional protein with immune-supportive functions identified in a range of species, including the honey bee. Hemocyte numbers can increase via mitosis, and this recruitment process can be important for immune system function and maintenance. Here, we tested if hemocyte mediated phagocytosis differs among the physiologically different honey bee worker castes (nurses, foragers and winter bees, and study possible interactions with vitellogenin and hemocyte recruitment. To this end, we adapted phagocytosis assays, which-together with confocal microscopy and flow cytometry-allow qualitative and quantitative assessment of hemocyte performance. We found that nurses are more efficient in phagocytic uptake than both foragers and winter bees. We detected vitellogenin within the hemocytes, and found that winter bees have the highest numbers of vitellogenin-positive hemocytes. Connections between phagocytosis, hemocyte-vitellogenin and mitosis were worker caste dependent. Our results demonstrate that the phagocytic performance of immune cells differs significantly between honey bee worker castes, and support increased immune competence in nurses as compared to forager bees. Our data, moreover, provides support for roles of vitellogenin in hemocyte activity.
Bueno, Aloisio C D; Galuppo, Larry D; Taylor, Kenneth T; Jensen, David G; Stover, Susan M
2003-01-01
To compare the mechanical shear strengths and stiffnesses obtained from in vitro testing of a simulated complete third carpal bone (C3) frontal plane radial facet slab fracture (osteotomy) stabilized with either a 4/5 Acutrak (AT) compression screw or a 4.5-mm AO cortical bone (AO) screw inserted in lag fashion. Drilling, tapping, and screw insertion torques, forces, and times also were compared between AT and AO implants. In vitro biomechanical assessment of site preparation, screw insertion, and shear failure test variables of bone screw stabilized simulated C3 slab fracture in paired cadaveric equine carpi. Eight pairs of cadaveric equine C3 without orthopedic abnormalities. Standardized simulated C3 slab fractures were repaired with either AO or AT screws (AO/C3 and AT/C3 groups, respectively). Drilling, tapping, and screw insertion torques, forces, and times were measured with a materials testing machine for each screw type. Repaired specimens were tested in axially oriented shear until failure. Paired Students t-tests were used to assess differences between site preparation, screw insertion, and shear testing variables. Significance was set at P bone fragment measurements of the standardized simulated C3 slab fractures created for AO or AT screws. There were no significant differences for mean and maximum drilling torques; however, the tapered AT drill had greater maximum drilling force compared with the 3.2-mm and 4.5-mm AO drill bits. Mean insertion torque and force measured from the self-tapping AT screw were not significantly different compared with the 4.5-mm AO tap. There were no significant differences in maximum screw torque among constructs. Total procedure time was significantly longer for the AT group (5.8 +/- 1.6 minutes) compared with the AO group (2.9 +/- 1.1 minutes; P =.001). AT stabilized specimens had significantly greater mean +/- SD initial shear stiffness (3.64 +/- 1.08 kN/mm) than AO specimens (1.64 +/- 0.73 kN/mm; P =.005). All other
Reptiles and Amphibians of Curaçao
Rooij, de Nelly
1922-01-01
The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles
Directory of Open Access Journals (Sweden)
Cassandro Vidal Talamini do Amarante
2008-12-01
Full Text Available Os objetivos deste trabalho foram caracterizar a fisiologia e avaliar os efeitos da temperatura e da aplicação de 1-metilciclopropeno (1-MCP na qualidade pós-colheita de frutos de goiaba-serrana (Acca selowiana, em acessos do banco ativo de germoplasma da Empresa de Pesquisa Agropecuária e Extensão Rural de Santa Catarina. Os frutos foram colhidos na maturação comercial. Os genótipos Brasil (acesso 387 e Uruguai (acesso 454 foram avaliados quanto ao comportamento respiratório e de produção de etileno a 20ºC, e taxas respiratórias e alterações na cor da casca a 0, 5, 10, 20 e 30ºC. O genótipo Brasil (acesso 242 foi avaliado quanto ao amadurecimento a 4ºC, após tratamento com 1-MCP (0, 500 e 1.500 ppb. Os genótipos Brasil (acesso 387 e Uruguai (acesso 454 apresentaram comportamento climatérico, com picos de produção de etileno e de taxa respiratória aos 8 e 12 dias de armazenamento a 20ºC, respectivamente. Não houve diferença significativa entre as taxas respiratórias e de produção de etileno entre os genótipos, nessa temperatura. Houve aumento substancial na taxa respiratória em ambos os genótipos, com o aumento de 0 para 30ºC, com coeficiente metabólico de 3,5 aproximadamente. Com o aumento na temperatura, houve maior alteração na cor verde da epiderme, em frutos do tipo Brasil, e maior escurecimento da epiderme, em frutos do tipo Uruguai. Frutos do genótipo Brasil (acesso 242, tratados com 1-MCP e armazenados a 4ºC, apresentaram retardamento no amadurecimento.The objectives of this work were to characterize the postharvest physiology and to evaluate the effects of temperature and treatment with 1-methylcyclopropene (1-MCP on the postharvest quality of fruits of feijoa (Acca selowiana accessions from the germplasm bank of Empresa de Pesquisa Agropecuária e Extensão Rural de Santa Catarina. Fruits were harvested at commercial maturity. The genotypes Brasil (accession no. 387 and Uruguai (accession no. 454
Envolvimento paterno aos três meses de vida do bebê
Directory of Open Access Journals (Sweden)
Cesar Augusto Piccinini
Full Text Available O presente estudo investigou o envolvimento paterno aos três meses de vida do bebê. Foram entrevistados 38 pais primíparos, com idades entre 20 e 40 anos. Realizou-se uma análise de conteúdo baseada nas dimensões do conceito de envolvimento paterno: interação, acessibilidade e responsabilidade. Os pais revelaram envolverem-se nas atividades de cuidado, embora nem sempre de maneira rotineira. Também relataram preocupações e envolvimento nas decisões relativas aos cuidados, educação e saúde do bebê. Contudo, consideravam que sua participação estava aquém da ideal em função das restrições impostas pelo trabalho. Os resultados apontam para um aumento no envolvimento paterno nos primeiros meses do bebê e para a necessidade de apoio aos pais neste momento de transição familiar.
Pittman, Julian; Hylton, Andrew
2015-12-01
Most existing pharmacological treatments have focused on the "monoamine hypothesis" for targeted drug design for major depressive disorder (MDD). Many of these medications have a delayed onset-of-action and limited efficacy. Antidepressants with principal targets outside the monoamine system may offer the potential for more rapid activity with improved therapeutic benefit. Growing evidence suggests that the glutamatergic system is uniquely central to the neurobiology and treatment of MDD. Ketamine (Ketalar®) is a non-competitive glutamatergic antagonist classically used to induce sedation. However, preliminary clinical evidence has been promising with regard to its rapidly acting antidepressant profile. Zebrafish (Danio rerio) have emerged as a promising new animal model to screen the effects of numerous psychotropic compounds. This study aimed to determine if a sub-chronic low (sub-anesthetic) dose of ketamine could be used to augment the antidepressant effects of the widely used antidepressant fluoxetine (Prozac®) in adult zebrafish, employing an ethanol withdrawal model. Sub-chronic exposure to dosages of 100μg/L fluoxetine and 20mg/L of ketamine reduced anxiety/depression-like behaviors, leads to upregulation of serotonin synthesis and elevated whole-body cortisol levels. These results demonstrate the utility of zebrafish as a model for neuropharmacological research, and the possible efficacy of fluoxetine and ketamine coadministration. Copyright © 2015 Elsevier Inc. All rights reserved.
Nagel, Roland
2002-01-01
The acute fish test is an animal test whose ecotoxicological relevance is worthy of discussion. The primary aim of protection in ecotoxicology is the population and not the individual. Furthermore the concentration of pollutants in the environment is normally not in the lethal range. Therefore the acute fish test covers solely the situation after chemical spills. Nevertheless, acute fish toxicity data still belong to the base set used for the assessment of chemicals. The embryo test with the zebrafish Danio rerio (DarT) is recommended as a substitute for the acute fish test. For validation an international laboratory comparison test was carried out. A summary of the results is presented in this paper. Based on the promising results of testing chemicals and waste water the test design was validated by the DIN-working group "7.6 Fischei-Test". A normed test guideline for testing waste water with fish is available. The test duration is short (48 h) and within the test different toxicological endpoints can be examined. Endpoints from the embryo test are suitable for QSAR-studies. Besides the use in ecotoxicology the introduction as a toxicological model was investigated. Disturbance of pigmentation and effects on the frequency of heart-beat were examined. A further important application is testing of teratogenic chemicals. Based on the results DarT could be a screening test within preclinical studies.
Preditores das atitudes negativas face ao envelhecimento e face à sexualidade na terceira idade
Pereira, Diane; Ponte, Filomena; Costa, Eleonora
2018-01-01
Este estudo analisou as diferenças entre jovens e idosos ao nível das atitudes e dos conhecimentos face ao envelhecimento e face à sexualidade na terceira idade, a relação entre as variáveis em estudo, e os preditores das atitudes negativas face ao envelhecimento e das atitudes negativas face à sexualidade na terceira idade. Cento e cinquenta e três jovens universitários e 42 idosos participaram no estudo. Os resultados indicaram que os jovens apresentam um menor nível de conhecimentos acerca...
Sobre o ódio ao professor Entrevista com Fernando Penna
Directory of Open Access Journals (Sweden)
Fernando Penna
2016-01-01
Full Text Available Ao tomar a decisão de pautar o tema da violência para compor o dossiê do terceiro número de Movimento – revista eletrônica de educação da Universidade Federal Fluminense –, o Conselho Editorial elencou um grande número de facetas da violência que historicamente se manifestam física e presencialmente no interior e fora do espaço escolar. O fenômeno relativamente recente das redes sociais e o vertiginoso processo de crescimento de trocas de informação, interação e mediação virtual a ele agregado, não apenas ampliou o espectro da violência como contribuiu decisivamente para articular o dentro e o fora da escola. Dentre outros exemplos, talvez o mais comum e antigo é o registro de cenas reais de alunos e alunas brigando nos pátios escolares ou nas redondezas da instituição postadas nas redes sociais, muitas delas viralizadas – para usar o barbarismoda ocasião – por um número sempre crescente de adeptos do bullying escolar. Nos últimos cinco anos, nas redes sociais, o exemplo de articulação da violência dentro-fora da escola que mais chama a atenção é o ódio ao professor, conforme observa o professor Fernando Penna na entrevista que publicamos a seguir. Estudioso da manifestação reivindicatória por uma escola sem ideologia trazida nos últimos anos por setores conservadores e reacionários da sociedade brasileira, Penna busca oferecer na entrevista algumas hipóteses para compreendermos o fenômeno do ódio ao professor, bem como algumas pistas para apreendermos os fundamentos que movem aqueles setores no combate ao que denominam de doutrinação ideológica de esquerda, e, concluindo, observa a urgência da resistência ao assédio moral feito dos conservadores ereacionários, chamando a atenção para a importância da ampliação do conhecimento crítico sobre o tema.
Desempenho de genótipos de aveia branca em resposta ao estresse por alumínio
Directory of Open Access Journals (Sweden)
Solange Ferreira da Silveira Silveira
2013-01-01
Full Text Available A aveia branca (Avena sativa L. é uma cultura que tem um papel importante no sistema de produção de grãos e integração lavoura-pecuária, no entanto, em algumas regiões brasileiras, o pleno estabelecimento e desenvolvimento dessa cultura, bem como o aumento de produtividade são inviabilizados pelo excesso de alumínio (Al nos solos. A avaliação de caracteres de plântulas de aveia desenvolvidas sob cultivo hidropônico com adoção de solução nutritiva mínima pode ser eficiente para classificar genótipos sensíveis e tolerantes ao Al. Este trabalho objetivou avaliar o desempenho de 10 genótipos de aveia submetidos ao estresse por Al, baseando-se na análise da retomada do crescimento da raiz, com uso de solução mínima e identificando quais caracteres se mantêm correlacionados. Foram adotadas diferentes doses de Al (0, 3, 6, e 9 mg L-1 de Al. Com uso de solução mínima, a dose de 6 mg L-1 de Al é a mais adequada na diferenciação de genótipos sensíveis e tolerantes. Dentre os genótipos estudados, UFRGS 14, UFRGS 19 e URS Guapa são os mais tolerantes e UPFA 20, UPF 18 e IAC 7, os mais sensíveis ao Al. Com o objetivo de classificar genótipos de aveia entre sensíveis e tolerantes ao Al, nenhuma outra variável pode ser utilizada em substituição à retomada do crescimento da raiz.
Adesão ao Tratamento em Gestação de Alto Risco
Directory of Open Access Journals (Sweden)
Fabíola Langaro
Full Text Available No Brasil, aproximadamente 15% das gestações são de alto risco, sendo os diagnósticos de diabetes gestacional e hipertensão as causas mais frequentes dessa condição. Para a efetividade dos tratamentos indicados nesses casos, bem como alcance de desfechos favoráveis, é essencial a adesão da paciente às recomendações fornecidas pelas equipes de saúde, o que torna fundamental a avaliação desse indicador. A pesquisa apresentada avaliou a adesão de participantes de um programa de atendimento interdisciplinar a gestantes de alto risco desenvolvido em um hospital geral privado por meio de três instrumentos: Questionário Morisky-Green de adesão ao uso de medicação, Questionário de Adesão ao Tratamento e Pergunta descritiva de avaliação qualitativa. Durante oito meses, 83 gestantes responderam aos questionários, que possibilitaram identificar níveis de adesão ao longo do tempo de participação no programa, situações de não adesão mais frequentes, bem como variáveis que interferem nas medidas de adesão ao uso de medicação e ao tratamento global. Considera-se que os índices levantados são passíveis de uso como indicadores clínicos e gerenciais, possibilitando a comprovação da efetividade e melhoria constante das rotinas de saúde. Tais mecanismos são úteis para definição de protocolos, discussão de casos clínicos e mesmo para feedbackàs próprias pacientes.
Goszczynski, Barbara; Captan, Vasile V; Danielson, Alicia M; Lancaster, Brett R; McGhee, James D
2016-05-01
The Caenorhabditis elegans vitellogenin genes are transcribed in the intestine of adult hermaphrodites but not of males. A 44-bp region from the vit-2 gene promoter is able largely to reconstitute this tissue-, stage- and sex-specific-expression. This "enhancer" contains a binding site for the DM-domain factor MAB-3, the male-specific repressor of vitellogenesis, as well as an activator site that we show is the direct target of the intestinal GATA factor ELT-2. We further show that the enhancer is directly activated by the winged-helix/forkhead-factor FKH-9, (whose gene has been shown by others to be a direct target of DAF-16), by an unknown activator binding to the MAB-3 site, and by the full C. elegans TGF-β/Sma/Mab pathway acting within the intestine. The vit-2 gene has been shown by others to be repressed by the daf-2/daf-16 insulin signaling pathway, which so strongly influences aging and longevity in C. elegans. We show that the activity of the 44 bp vit-2 enhancer is abolished by loss of daf-2 but is restored by simultaneous loss of daf-16. DAF-2 acts from outside of the intestine but DAF-16 acts both from outside of the intestine and from within the intestine where it binds directly to the same non-canonical target site that interacts with FKH-9. Activity of the 44 bp vit-2 enhancer is also inhibited by loss of the germline, in a manner that is only weakly influenced by DAF-16 but that is strongly influenced by KRI-1, a key downstream effector in the pathway by which germline loss increases C. elegans lifespan. The complex behavior of this enhancer presumably allows vitellogenin gene transcription to adjust to demands of body size, germline proliferation and nutritional state but we suggest that the apparent involvement of this enhancer in aging and longevity "pathways" could be incidental. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Mikelsaar Aavo-Valdur
2012-09-01
Full Text Available Abstract Background Previously we have reported on the development of a new mouse anti-titin monoclonal antibody, named MAb Titl 5 H1.1, using the synthetic peptide N-AVNKYGIGEPLESDSVVAK-C which corresponds to an amino acid sequence in the A-region of the titin molecule as immunogen. In the human skeletal muscles, MAb Titl 5 H1.1 reacts specifically with titin in the A-band of the sarcomere and in different non-muscle cell types with nucleus and cytoplasm, including centrioles. In this report we have studied the evolutionary aspects of the binding of MAb Tit1 5 H1.1 with its target antigen (titin. Results We have specified the epitope area of MAb Tit1 5 H1.1 by subpeptide mapping to the hexapeptide N-AVNKYG-C. According to protein databases this amino acid sequence is located in the COOH-terminus of several different Fn3 domains of the A-region of titin molecule in many organisms, such as human being, mouse, rabbit, zebrafish (Danio rerio, and even in sea squirt (Ciona intestinalis. Our immunohisto- and cytochemical studies with MAb Tit1 5 H1.1 in human, mouse and zebrafish tissues and cell cultures showed a striated staining pattern in muscle cells and also staining of centrioles, cytoplasm and nuclei in non-muscle cells. Conclusions The data confirm that titin can play, in addition to the known roles in striated muscle cells also an important role in non-muscle cells as a centriole associated protein. This phenomenon is highly conserved in the evolution and is related to Fn3 domains of the titin molecule. Using titin A-band-specific monoclonal antibody MAb Tit1 5 H1.1 it was possible to locate titin in the sarcomeres of skeletal muscle cells and in the centrioles, cytoplasm and nuclei of non-muscle cells in phylogenetically so distant organisms as Homo sapiens, Mus musculus and zebrafish (Danio rerio.
Xing, Na; Ji, Lizhen; Song, Jie; Ma, Jingchun; Li, Shangge; Ren, Zongming; Xu, Fei; Zhu, Jianping
2017-10-01
The electrocardiogram (ECG) of zebra fish (Danio rerio) expresses cardiac features that are similar to humans. Here we use sharp microelectrode measurements to obtain ECG characteristics in adult zebra fish and analyze the effects of cadmium chloride (CdCl 2 ) on the heart. We observe the overall changes of ECG parameters in different treatments (0.1 TU, 0.5 TU and 1.0 TU CdCl 2 ), including P wave, Q wave, R wave, S wave, T wave, PR interval (atrial contraction), QRS complex (ventricular depolarization), ST segment, and QT interval (ventricular repolarization). The trends of the ECG parameters showed some responses to the concentration and exposure time of CdCl 2 , but it was difficult to obtain more information about the useful indicators in water quality assessment depending on tendency analysis alone. A self-organizing map (SOM) showed that P values, R values, and T values were similar; R wave and T wave amplitude were similar; and most important, QRS value was similar to the CdCl 2 stress according to the classified data patterns including CdCl 2 stress (E) and ECG components based on the Ward linkage. It suggested that the duration of QRS complex was related to environmental stress E directly. The specification and evaluation of ECG parameters in Cd 2+ pollution suggested that there is a markedly significant correlation between QRS complex and CdCl 2 stress with the highest r (0.729) and the smallest p (0.002) among all ECG characteristics. In this case, it is concluded that QRS complex can be used as an indicator in the CdCl 2 stress assessment due to the lowest AIC data abased on the linear regression model between the CdCl 2 stress and ECG parameters. Copyright © 2017 Elsevier B.V. All rights reserved.
Dicty_cDB: Contig-U05246-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ; Sh... 54 2e-06 AY082612_1( AY082612 |pid:none) Ocimum basilicum p-coumaroyl shiki... 54 2e-06 AM465802_1( AM465802 |pid:none) Vit... 1e-05 T03275( T03275 ) probable cytochrome P450, hypersensitivity-relate... 51 1e-05 AY056284_1( AY056284 |pid:none) Arabidopsis...one) Bos taurus cytochrome P450, family... 55 1e-06 DQ667171_1( DQ667171 |pid:none) Artemisia annua P450 mon...) RecName: Full=Cytochrome P450 2B1; EC=1.14.14.... 52 9e-06 DQ453967_1( DQ453967 |pid:none) Artemisia annua...16 |pid:none) Danio rerio cytochrome P450, famil... 52 9e-06 DQ315671_1( DQ315671 |pid:none) Artemisi
A crítica de Hegel ao formalismo moral Kantiano
Müller, Rudinei
2011-01-01
A crítica de Hegel ao formalismo da moral kantiana é um tema que pode ser abordado de diferentes modos. Esta tese demonstra que tanto na filosofia de Kant, quanto na de Hegel, os argumentos decisivos em relação ao formalismo (Kant) e a sua necessária superação (Hegel) estão desenvolvidos na filosofia especulativa. A superioridade crítica de Hegel em relação à Kant consiste na sua radicalidade. Demonstra-se como para Hegel o próprio finito, o fenômeno, já é um não não-finito, revelando a sua c...
Instrumentos relacionados ao diabetes mellitus adaptados e validados para a cultura brasileira
Directory of Open Access Journals (Sweden)
Raquel Curcio
2011-06-01
Full Text Available Trata-se de um estudo de revisão integrativa, cujo objetivo foi buscar evidências disponíveis na literatura sobre os instrumentos e escalas relacionados ao diabetes mellitus adaptados e validados para a cultura brasileira. Após busca nas bases eletrônicas BDENF, SciELO, LILACS, foram incluídos sete instrumentos que atenderam aos critérios de inclusão: Diabetes Mellitus Knowledge (DKN-A; Diabetes Mellitus Attitude (ATT-19; Diabetes Quality of Life Measure (DQOL-Brasil; Diabetes Quality of Life for Youths (DQOLY-Brasil; Diabetes 39 (D-39; Insulin Management Diabetes Self-efficacy (IMDSES; Problem Areas in Diabetes (PAID e Summary of Diabetes Self-Care Activities Questionnaire (QAD. Os resultados permitiram traçar uma comparação entre os instrumentos disponíveis, além de conhecer as limitações quanto ao processo de validação e aplicação clínica. Espera-se que esse estudo possa contribuir para uma maior divulgação dos instrumentos relacionados ao diabetes mellitus disponíveis para a cultura brasileira, e oferecer subsídios para a sua utilização em pesquisa ou assistência de enfermagem.
Uptake of 17β-estradiol and biomarker responses in brown trout (Salmo trutta) exposed to pulses
International Nuclear Information System (INIS)
Knudsen, Jacob J.G.; Holbech, Henrik; Madsen, Steffen S.; Bjerregaard, Poul
2011-01-01
In streams, chemicals such as 17β-estradiol (E2) are likely to occur in pulses. We investigated uptake and biomarker responses in juvenile brown trout (Salmo trutta) of 3- or 6-h pulses of concentrations up to 370 ng E2 L -1 . Uptake by the fish was estimated from disappearance of E2 from tank water. A single 6-h pulse of 370 ng E2 L -1 increased the plasma vitellogenin concentration, liver Erα- and vitellogenin-mRNA. Exposure to 150-160 ng E2 L -1 for 6 h increased vitellogenin in one experiment but not in another. Two 6-h pulses had a larger effect one pulse. Brown trout in the size range 24-74 g took up E2 linearly with time and exposure concentration with a concentration ratio rate of 20.2 h -1 . In conclusion, the threshold for induction of estrogenic effects in juvenile brown trout at short term pulse exposure appears to be in the range 150-200 ng E2 L -1 . - Highlights: → We investigated estrogenic effects of pulse exposure of 17β-estradiol in brown trout. → We used induction of vitellogenin and gene expression as biomarkers. → The threshold for effects after 6 h pulses ranges between 150 and 200 ng E2 L -1 . → E2 is taken up in ∼50 g fish linearly with time and concentration at 20 h -1 . - The threshold concentration for induction of estrogenic effects in brown trout upon short term (6 h) exposure is in the range 150-200 ng E2 L -1 .
Uptake of 17{beta}-estradiol and biomarker responses in brown trout (Salmo trutta) exposed to pulses
Energy Technology Data Exchange (ETDEWEB)
Knudsen, Jacob J.G.; Holbech, Henrik; Madsen, Steffen S. [Institute of Biology, University of Southern Denmark, Campusvej 55, DK-5230 Odense (Denmark); Bjerregaard, Poul, E-mail: poul@biology.sdu.dk [Institute of Biology, University of Southern Denmark, Campusvej 55, DK-5230 Odense (Denmark)
2011-12-15
In streams, chemicals such as 17{beta}-estradiol (E2) are likely to occur in pulses. We investigated uptake and biomarker responses in juvenile brown trout (Salmo trutta) of 3- or 6-h pulses of concentrations up to 370 ng E2 L{sup -1}. Uptake by the fish was estimated from disappearance of E2 from tank water. A single 6-h pulse of 370 ng E2 L{sup -1} increased the plasma vitellogenin concentration, liver Er{alpha}- and vitellogenin-mRNA. Exposure to 150-160 ng E2 L{sup -1} for 6 h increased vitellogenin in one experiment but not in another. Two 6-h pulses had a larger effect one pulse. Brown trout in the size range 24-74 g took up E2 linearly with time and exposure concentration with a concentration ratio rate of 20.2 h{sup -1}. In conclusion, the threshold for induction of estrogenic effects in juvenile brown trout at short term pulse exposure appears to be in the range 150-200 ng E2 L{sup -1}. - Highlights: > We investigated estrogenic effects of pulse exposure of 17{beta}-estradiol in brown trout. > We used induction of vitellogenin and gene expression as biomarkers. > The threshold for effects after 6 h pulses ranges between 150 and 200 ng E2 L{sup -1}. > E2 is taken up in {approx}50 g fish linearly with time and concentration at 20 h{sup -1}. - The threshold concentration for induction of estrogenic effects in brown trout upon short term (6 h) exposure is in the range 150-200 ng E2 L{sup -1}.
Magnetic MOF for AO7 Removal and Targeted Delivery
Directory of Open Access Journals (Sweden)
Xue-Qing Zhan
2018-06-01
Full Text Available Owing to their high surface area and porosity, metal-organic frameworks (MOFs have been gradually employed for a myriad of applications ranging from sensing, pollutant adsorption, and drug delivery to environmental remediation and catalysis. Magnetic nanoparticles-metal-organic frameworks (MMOFs hybrid materials can facilitate facile removal of MOFs from solutions. In this report, we report the synthesis of Fe3O4@UiO-66 by encapsulation and simulated the drug loading and release by studying the adsorption and release of AO7. Thus, we loaded these MMOFs with AO7 and found that they were able to trigger and control its release by simply applying an external magnetic field. The magnetic field heats the magnets in the MOF, which causes the load to burst from the framework.
Um modelo de hipertexto para apoio ao ensino mediado pela Web
Willie Dresler Leiva
2003-01-01
Atualmente há uma demanda crescente por aplicações hipermídia baseadas na WWW (World Wide Web), conhecidas como WIS (Web Information Systems). Esse novo tipo de aplicação apresenta requisitos adicionais aos sistemas de software clássicos, o que resulta na necessidade de investigar modelos mais adequados para apoiar o seu desenvolvimento. Em especial, os sistemas para apoio ao EaD (Ensino a Distância) baseados na Web apresentam características e requisitos ainda mais específicos. Os modelos at...
Os Fundamentos da Caracterização do Direito ao Bom Ambiente do Trabalho como Direito Fundamental
Pes, João Hélio Ferreira
2016-01-01
Este trabalho objetiva verificar quais são os fundamentos da caracterização do direito ao bom ambiente do trabalho como direito fundamental. Inicialmente, conceitua o direito ao bom ambiente do trabalho. Logo a seguir, menciona a diferenciação entre fundamentalidade formal e fundamentalidade material do direito ao bom ambiente do trabalho à luz da teoria pós positivista. Por fim, apresenta alguns fundamentos substanciais da caracterização do direito ao bom ambiente do trabalho como direito fu...
Directory of Open Access Journals (Sweden)
Borhan Mansouri
2015-11-01
Full Text Available Background: The increasing use of nanomaterials and nanoproducts has increased the possibility of contamination of the environment, which may have adverse effects on different organisms. The aim of this study was to evaluate the effects of silver nanoparticles on histopathology and gill ultrastructure of zebrafish (Danio rerio under laboratory conditions. Methods: Zebrafish were exposed to four concentrations of silver nanoparticles (0.0015, 0.00375, 0.0075, and 0.015 mg/l for a period of 4 days. Gill ultrastructure and histopathological changes were studied using scanning electron microscope and haematoxylin - eosin staining. Results: Exposure to silver nanoparticles significantly (P < 0.001 increased the diameter of gill filaments and secondary lamellae, while silver nanoparticles significantly reduced the length of the secondary gills in zebrafish. Moreover, other changes such as vacuolization, dilated and clubbed tips, hyperplasia, edema, fusion, swelling of mucocytes, hypertrophy, and necrosis were observed. The effects of silver nanoparticles in zebrafish gills were dose dependent. Conclusion: Based on the adverse effects of AgNPs on zebrafish gills, silver nanoparticle solutions can be hazardous pollutants for the environment.
Fatores associados à atividade física e aos comportamentos sedentários em adolescentes
Directory of Open Access Journals (Sweden)
Daniel Giordani Vasques
2009-01-01
Full Text Available http://dx.doi.org/10.5007/1980-0037.2009v11n1p59 Objetivou-se analisar fatores associados à atividade física e aos comportamentos sedentários em adolescentes. A amostra foi composta de 1675 escolares (784 rapazes e 891 moças, de 11 a 17 anos de idade, de Caxias do Sul-RS. Um questionário foi aplicado para identificar o nível de atividade física (recordatório de 3 dias e o número de horas em comportamentos sedentários. Considerou-se como baixo nível de atividade física (baixo NAF um gasto energético menor do que 37kcal/kg/dia e exposição elevada a comportamentos sedentários (CSE assistir TV, jogar videogame ou utilizar computador mais do que 14h/semana. Os resultados do teste qui-quadrado indicaram que as moças apresentaram maior prevalência de baixo NAF (66,8%>43,2%; p84,0%; p=0,001. Baixo NAF associou-se aos rapazes a partir da regressão de Poisson, com residir com até 4 pessoas (RP=1,21;IC95%1,00-1,46 e com o baixo NAF da mãe (RP=1,23;IC95%1,00-1,53, e nas moças, com a faixa etária de 15-17 anos (RP=1,30;IC95%1,18-1,44, residir com até 4 pessoas (RP=1,17;IC95%1,04-1,31, possuir TV no quarto (RP=1,13;IC95%1,02-1,25 e deslocar-se passivamente à escola (RP=1,10;IC95%1,00-1,22. A CSE associou-se às moças à maior escolaridade do chefe da família (RP=1,08;IC95%1,01-1,16 e a possuir TV no quarto (RP=1,15;IC95%1,08-1,22. Destaca-se a associação entre as medidas de aproximação socioeconômica e os comportamentos de risco (baixo NAF e CSE. O conhecimento dos fatores associados ao baixo NAF e à CSE facilita a implantação de intervenções mais efetivas, a fim de promover um estilo de vida mais ativo.
Tran, Thi Kim Anh; MacFarlane, Geoff R; Kong, Richard Yuen Chong; O'Connor, Wayne A; Yu, Richard Man Kit
2016-05-01
Marine molluscs, such as oysters, respond to estrogenic compounds with the induction of the egg yolk protein precursor, vitellogenin (Vtg), availing a biomarker for estrogenic pollution. Despite this application, the precise molecular mechanism through which estrogens exert their action to induce molluscan vitellogenesis is unknown. As a first step to address this question, we cloned a gene encoding Vtg from the Sydney rock oyster Saccostrea glomerata (sgVtg). Using primers designed from a partial sgVtg cDNA sequence available in Genbank, a full-length sgVtg cDNA of 8498bp was obtained by 5'- and 3'-RACE. The open reading frame (ORF) of sgVtg was determined to be 7980bp, which is substantially longer than the orthologs of other oyster species. Its deduced protein sequence shares the highest homology at the N- and C-terminal regions with other molluscan Vtgs. The full-length genomic DNA sequence of sgVtg was obtained by genomic PCR and genome walking targeting the gene body and flanking regions, respectively. The genomic sequence spans 20kb and consists of 30 exons and 29 introns. Computer analysis identified three closely spaced half-estrogen responsive elements (EREs) in the promoter region and a 210-bp CpG island 62bp downstream of the transcription start site. Upregulation of sgVtg mRNA expression was observed in the ovaries following in vitro (explants) and in vivo (tank) exposure to 17β-estradiol (E2). Notably, treatment with an estrogen receptor (ER) antagonist in vitro abolished the upregulation, suggesting a requirement for an estrogen-dependent receptor for transcriptional activation. DNA methylation of the 5' CpG island was analysed using bisulfite genomic sequencing of the in vivo exposed ovaries. The CpG island was found to be hypomethylated (with 0-3% methylcytosines) in both control and E2-exposed oysters. However, no significant differential methylation or any correlation between methylation and sgVtg expression levels was observed. Overall, the
Directory of Open Access Journals (Sweden)
M.T. Oliveira
2016-02-01
Full Text Available O objetivo deste estudo foi avaliar a eficácia do meloxicam associado ou não ao tramadol, no controle da dor após ovário-histerectomia (OVH laparoscópica com dois portais. Foram selecionadas 14 cadelas hígidas. Os animais foram separados de forma aleatória, em dois grupos. O grupo M (GM recebeu meloxicam (0,2mg kg-1, s.i.d., enquanto os animais do grupo MT (GMT receberam a associação de meloxicam (0,2mg kg-1, s.i.d. e tramadol (4mg kg-1, t.i.d., ambos durante dois dias de pós-operatório. Para avaliação da dor pós-cirúrgica, foram utilizadas as escalas de Melbourne e escala visual analógica (EVA, além de mensurações de glicemia e cortisol sérico. Não houve diferença ao se avaliarem os grupos GM e GMT pela escala de Melbourne nem pela EVA. As mensurações de cortisol não atingiram valores superiores aos de referência para a espécie, enquanto os valores de glicemia não apresentaram variação significativa ao longo do tempo de avaliação nem entre grupos. Com os resultados deste estudo, foi possível concluir que a utilização de meloxicam associado ou não ao tramadol, nas doses e posologias propostas, é eficaz para controlar a dor pós-operatória de cadelas submetidas à OVH laparoscópica com dois portais.
Implante Coclear: estudos concernentes à biopolítica, ao biopoder e ao biocapital em III volumes
Garcia, Eduardo de Campos
2015-01-01
Esta tese, embora aparentemente trate de assuntos concernentes ao Implante Coclear, seu objeto esbarra numa análise do que de modo visuoimperceptual autoriza a operacionalidade das modificações corporais que implicam do imbricamento entre homem e máquina: pela criação de linguagem clínico discursiva, na ordem jurídico-biológica, nas tramas interpessoais e pela própria pessoa que se autodeclara ciborgue de ouvido biônico e que acaba envolvida pela ideia da formação de outras identidades e de u...
Directory of Open Access Journals (Sweden)
Daniel Barbosa Coelho
2014-01-01
Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2014v16n2p129 A realização de exercícios físicos pode resultar em danos teciduais sobre o sis-tema muscular, inclusive durante a pré-temporada, que é um período de preparação física visando competições subsequentes. O objetivo do estudo foi analisar o comportamento da CK plasmática como marcador de dano muscular ao longo da pré-temporada de uma equipe de futebol profissional; determinar em que momento da pré-temporada os níveis de CK atingem o valor pico; e verificar a concentração de CK no dia antecedente ao primeiro jogo oficial da temporada. Participaram deste estudo 31 jogadores de futebol profissional (24.3 ± 3.9 anos, 181.0 ± 7.0 cm de altura, 9.1 ± 1.3 %GC e 66.0 ± 4.5 mlO2/kg/min. A concentração plasmática de CK foi determinada ao início da pré-temporada (M1, 4 (M2, 10 (M3 e 15 (M4 dias após. Identificaram-se valores de CK de 178.2 ± 12.0, 540.0 ± 59.1, 389.8 ± 49.5, 408.7 ± 45.0 U/L para M1, M2, M3 e M4, respectivamente. A concentração pico de CK ocorreu no M2 (p<0,05. A análise do comportamento da CK plasmática revelou níveis aumentados ao longo de toda a pré-temporada de uma equipe de futebol profissional em comparação com o período de férias. O valor pico de CK foi atingido no 4º dia da pré-temporada. A concentração de CK no dia antecedente ao primeiro jogo oficial da temporada mostrou-se na faixa de valores recomendada para jogadores profissionais.
Prevalência de dor associada ao transporte de material escolar
Directory of Open Access Journals (Sweden)
Windsor Ramos da Silva Júnior
2014-10-01
Full Text Available http://dx.doi.org/10.5007/1980-0037.2014v16n6p680 O objetivo do trabalho foi verificar a prevalência de dor associada ao transporte de material escolar por estudantes universitários. Realizou-se pesquisa transversal, quantitativa, descritiva-analítica, na qual foram avaliados 373 estudantes universitários da Universidade Estadual da Paraíba, entre fevereiro e setembro de 2012. As informações foram coletadas através de questionário sobre dados sociodemográficos, acadêmicos, transporte do material escolar e presença de dor, sendo ainda realizada a medição de dados antropométricos e pesagem de todos os volumes transportados pelo indivíduo. Os dados foram analisados de forma descritiva e inferencial através do software SPSSÒ 17.0. Utilizou-se modelo de Regressão Logística Hierárquica Binária, pelo método Backward LR, no qual o poder de influência das variáveis preditoras – divididas em blocos – foi testado na presença de dor musculoesquelética. Constatou-se uma prevalência de dor de 82,84%, com média geral de 5,21 pontos na Escala Visual Analógica (EVA para avaliação de dor. Nas mulheres, a influência exercida pela massa relativa dos volumes sobre a presença de dor foi 45,1% maior que entre os homens (OR = 0,689; IC95% = 0,503 – 0,942 para cada 1% de incremento. O tempo de carga, por sua vez, aumentou em 22,9% a probabilidade da presença de dor, a cada 15 minutos decorridos (OR = 1,229; IC95% = 1,090 – 1,386. Verificou-se alta prevalência de dor relacionada ao transporte de material escolar e a influência preditora de variáveis como peso relativo da carga transportada e tempo de transporte desse material, especialmente nos indivíduos do sexo feminino.
Bridging FPGA and GPU technologies for AO real-time control
Perret, Denis; Lainé, Maxime; Bernard, Julien; Gratadour, Damien; Sevin, Arnaud
2016-07-01
Our team has developed a common environment for high performance simulations and real-time control of AO systems based on the use of Graphics Processors Units in the context of the COMPASS project. Such a solution, based on the ability of the real time core in the simulation to provide adequate computing performance, limits the cost of developing AO RTC systems and makes them more scalable. A code developed and validated in the context of the simulation may be injected directly into the system and tested on sky. Furthermore, the use of relatively low cost components also offers significant advantages for the system hardware platform. However, the use of GPUs in an AO loop comes with drawbacks: the traditional way of offloading computation from CPU to GPUs - involving multiple copies and unacceptable overhead in kernel launching - is not well suited in a real time context. This last application requires the implementation of a solution enabling direct memory access (DMA) to the GPU memory from a third party device, bypassing the operating system. This allows this device to communicate directly with the real-time core of the simulation feeding it with the WFS camera pixel stream. We show that DMA between a custom FPGA-based frame-grabber and a computation unit (GPU, FPGA, or Coprocessor such as Xeon-phi) across PCIe allows us to get latencies compatible with what will be needed on ELTs. As a fine-grained synchronization mechanism is not yet made available by GPU vendors, we propose the use of memory polling to avoid interrupts handling and involvement of a CPU. Network and Vision protocols are handled by the FPGA-based Network Interface Card (NIC). We present the results we obtained on a complete AO loop using camera and deformable mirror simulators.
Brink, M.J.; Boersma, A.A.; Meyboom-deJong, B; de Bruijn, J.G.M.
2011-01-01
Background: In Curaçao is a high incidence of unintended pregnancies and induced abortions. Most of the induced abortions in Curaçao are on request of the woman and performed by general practitioners. In Curaçao, induced abortion is strictly prohibited, but since 1999 there has been a policy of
Safari, Roghieh; Hoseinifar, Seyed Hossein; Van Doan, Hien; Dadar, Maryam
2017-07-01
Myrtle (Myrtus communis L., Myrtaceae) is a significant plant which naturally distributed around the globe. Although numerous studies have demonstrated the benefits of myrtle in different species, studies using the oral route are rare in the literature. In the present study, we evaluated the effect of myrtle intake on the antioxidant, immune, appetite and growth related genes as well as mucosal immune responses in zebrafish (Danio rerio) model. Zebrafish were fed control or myrtle (5, 10 and 20 g kg -1 myrtle) supplemented diets for sixty days. The results showed that, oral administration of Myrtle significantly improved mucosal immune responses (the activity of lysozyme, total Ig and protease). Furthermore, fish fed 20 g kg -1 showed remarkably higher antioxidant (sod and cat) enzymes gene expression compared other treatment. There were significant difference between myrtle fed fish and control group regarding tnf-alpha and lyz expression. Also, evaluation of growth (gh and igf1) related genes revealed remarkable upregulation in 20 g kg -1 myrtle treatment compared other myrtle treatments and control group. Similar results was observed regarding the mRNA levels of appetite related genes (ghrl) in zebrafish fed 20 g kg -1 myrtle. The present results indicated that dietary administration of myrtle improved mucosal immune parameters and altered mRNA levels of selected genes. These results on zebrafish model also highlights the potential use of Myrtle supplements as additive in human diets. Copyright © 2017 Elsevier Ltd. All rights reserved.
Contribuições da Arte ao Atendimento Educacional Especializado e à Inclusão Escolar
Directory of Open Access Journals (Sweden)
Libéria Rodrigues NEVES
Full Text Available RESUMO este texto objetiva propor uma discussão acerca das contribuições da Arte ao Atendimento Educacional Especializado, direcionado ao público-alvo da Educação Especial na perspectiva da Educação Inclusiva. Com base na teoria da Cognição Imaginativa, busca-se apresentar a arte como área de conhecimento dotada de características que dialogam com os objetivos dos trabalhos desenvolvidos nas Salas de Recursos Multifuncionais, oferecidos aos alunos com deficiências, transtorno global do desenvolvimento e altas habilidades e três modelos de trabalho com Arte e Inclusão são relatados: 1 uma oficina desenvolvida na ONG Nosso Sonho (SP, reunindo seis crianças com paralisia cerebral, descrita em Tese de doutorado em Artes Visuais (Escola de Comunicações e Artes da Universidade de São Paulo; 2 um livro que sistematiza quinze anos de trabalho do Instituto Rodrigo Mendes (RJ, que desenvolve projetos em arte-educação para sujeitos com e sem deficiência; e, 3 o trabalho da ONG Corpo Cidadão, que, em uma de suas unidades de educação social, desenvolve oficinas de arte com alunos de escola especial juntamente com alunos de escolas regulares, na grande Belo Horizonte. Enfocando a criação e imaginação como uma atividade humana, e não como uma faculdade dada a priori, o ensaio propõe que a arte deve ser um componente nas atividades desenvolvidas nos espaços de Atendimento Educacional Especializado, direcionadas, principalmente, aos alunos com deficiências intelectuais.
Dicty_cDB: Contig-U04925-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available RT0512 Chinese cabbage root library Brassica rapa... 46 2.3 1 ( CT736909 ) Danio rerio EST, clone ZF_mu...S30TF EI_10_12_KB Entamoeba invadens genomic ... 44 8.9 1 ( ES277776 ) PQ028A01.XT7 non-sporulating culture ...202 ) 1095462295981 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.57 1 ( CV871352 ) PDUts1090D04 Porcine testis cDNA library...clone:VS... 46 2.3 1 ( CX056831 ) PDUts2007A02 Porcine testis cDNA library II Sus s... 46 2.3 1 ( CV432331 )...a tectiformis cDNA, cleaving embryo clone:m... 40 5.1 2 ( CV874903 ) PDUts1132F08 Porcine testis cDNA library
ViLLaGEs: opto-mechanical design of an on-sky visible-light MEMS-based AO system
Grigsby, Bryant; Lockwood, Chris; Baumann, Brian; Gavel, Don; Johnson, Jess; Ammons, S. Mark; Dillon, Daren; Morzinski, Katie; Reinig, Marc; Palmer, Dave; Severson, Scott; Gates, Elinor
2008-07-01
Visible Light Laser Guidestar Experiments (ViLLaGEs) is a new Micro-Electro Mechanical Systems (MEMS) based visible-wavelength adaptive optics (AO) testbed on the Nickel 1-meter telescope at Lick Observatory. Closed loop Natural Guide Star (NGS) experiments were successfully carried out during engineering during the fall of 2007. This is a major evolutionary step, signaling the movement of AO technologies into visible light with a MEMS mirror. With on-sky Strehls in I-band of greater than 20% during second light tests, the science possibilities have become evident. Described here is the advanced engineering used in the design and construction of the ViLLaGEs system, comparing it to the LickAO infrared system, and a discussion of Nickel dome infrastructural improvements necessary for this system. A significant portion of the engineering discussion revolves around the sizable effort that went towards eliminating flexure. Then, we detail upgrades to ViLLaGEs to make it a facility class instrument. These upgrades will focus on Nyquist sampling the diffraction limited point spread function during open loop operations, motorization and automation for technician level alignments, adding dithering capabilities and changes for near infrared science.
Suscetibilidade de genótipos de feijão ao vírus-do-mosaico-dourado
Directory of Open Access Journals (Sweden)
Lemos Leandro Borges
2003-01-01
Full Text Available O objetivo deste trabalho foi avaliar a suscetibilidade de diversos genótipos de feijão ao vírus-do-mosaico-dourado (VMDF, transmitido pela mosca branca (Bemisia tabaci. A semeadura foi realizada na época da seca e das águas, com e sem aplicação do inseticida granulado Aldicarb (3,0 kg ha-1 do i.a. no sulco de semeadura. O delineamento experimental utilizado foi o de blocos casualizados disposto em esquema fatorial 14x2, representado por genótipos e inseticida, respectivamente, com quatro repetições. A maior infestação de mosca-branca e incidência do vírus ocorreu na época da seca, causando prejuízos à produção do feijoeiro. Os genótipos apresentaram diferentes graus de suscetibilidade ao vírus e ao inseto vetor. Os genótipos mais tolerantes foram IAPAR 57, IAPAR 65, IAPAR 72, Ônix, Aporé e 606 (5(214-17. A aplicação do inseticida sistêmico controla o vetor em ambas as épocas de cultivo, proporcionando aumentos da produtividade.
Permeabilidade ao ar em Latossolo Vermelho sob diferentes sistemas de manejo
Directory of Open Access Journals (Sweden)
Sueli Rodrigues
2011-02-01
Full Text Available A permeabilidade ao ar pode ser utilizada para avaliar alterações que ocorrem na estrutura do solo em virtude da adoção de diferentes sistemas de manejo. Este estudo testou a hipótese de que o menor revolvimento do solo sob sistema plantio direto resulta na formação de poros mais contínuos e melhor condição de aeração no solo. O objetivo deste trabalho foi avaliar, por meio da permeabilidade ao ar (Ka, da porosidade de aeração (εa e dos índices de continuidade de poros (K1 e N, a aeração em um Latossolo Vermelho distrófico sob preparo convencional (PC e sistema plantio direto (SPD. Oitenta amostras de solo (2 tratamentos x 2 profundidades x 20 repetições com estrutura indeformada foram coletadas de cada sistema de manejo do solo nas profundidades de 0-0,10 e 0,10-0,20 m em área experimental do Instituto Agronômico do Paraná, no município de Ponta Grossa, Paraná. Depois de saturadas e equilibradas em seis potenciais mátricos (-2, -6, -10, -30, -70 e -100 kPa, determinou-se a permeabilidade ao ar e a porosidade de aeração em cada potencial. Também foram determinados a densidade do solo, a densidade de partícula, o carbono orgânico e a porosidade. A densidade do solo não consistiu em fator limitante, ficando abaixo do limite crítico para solos argilosos nos dois sistemas. No SPD, o maior volume de microporos resultou em maior retenção de água no intervalo de umidade avaliado (-2 a -100 kPa e em maior volume de poros bloqueados para o fluxo de ar (εb, ou seja, redução de Ka. Na profundidade avaliada (00,20 m, os índices de continuidade de poros (K1 e N revelaram que o PC apresentou poros mais contínuos do que o SPD, contradizendo a hipótese testada.
Um crime delicado: conversando aos infinitos - "Um retrato de cavalo"
Directory of Open Access Journals (Sweden)
Cid Ottoni Bylaardt
2010-12-01
um cavalo e seu retrato, a partir dos sentimentos contraditórios de seu dono, que considera um crime aquele clique. Temos aí um retrato, imagem subtraída ilicitamente ao seu dono: escrita, representação. Temos também uma narrativa, escrita do retrato, representação da representação. Este artigo pretende mostrar como Guimarães Rosa manipula as ambiguidades da linguagem literária, levando-a além dos limites da representação, explorando seu fascínio, seu saber, que não é da ordem da compreensão. O cavalo e seu retrato fazem refletir sobre a literatura, sobre seu excesso de verdade que compõe sua mentira. Ao escrever o cavalo e seu retrato, o texto não consegue fixar nenhuma verdade, apenas imagens fugidias que compõem recapítulos: há sempre um escrito a se sobrepor a outro, sem determinar onde está o verdadeiro, onde está o que o nega, a remeter o olhar ao reino da fascinação, onde a imagem perde o valor de significação para se tornar pura paixão da indeterminação, da indiferença.
Intelligent vibration control of ELTs and large AO hardware
Pott, J.-U.; Kürster, M.; Trowitzsch, J.; Borelli, J.; Rohloff, R.-R.; Herbst, T.; Böhm, M.; Keck, A.; Ruppel, T.; Sawodny, O.
2012-07-01
MPIA leads the construction of the LINC-NIRVANA instrument, the MCAO-supported Fizeau imager for the LBT, serves as pathfinder for future ELT-AO imagers in terms of size and technology. In this contribution, we review recent results and significant progress made on the development of key items of our stratgey to achieve a piston stability of up to 100nm during a science exposure. We present an overview of our vibration control strategies for optical path and tip-tilt stabilization, involving accelerometer based real-time vibration measurements, vibration sensitive active control of actuators, and the development of a dynamical model of the LBT. MPIA also co-develops the E-ELT first-light NIR imager MICADO (both SCAO and MCAO assisted). Our experiences, made with LINC-NIRVANA, will be fed into the MICADO structural AO design to reach highest on-sky sensitivity.
Pannexin1 in the outer retina of the zebrafish, Danio rerio
Prochnow, N.; Hoffmann, S.; Vroman, R.; Klooster, J.; Bunse, S.; Kamermans, M.; Dermietzel, R.; Zoidl, G.
2009-01-01
In the retina, chemical and electrical synapses couple neurons into functional networks. New candidates encoding for electrical synapse proteins have recently emerged. In the present study, we determined the localization of the candidate protein pannexin1 (zfPanx1) in the zebrafish retina and