WorldWideScience

Sample records for replot pause 1

  1. Pause

    OpenAIRE

    Travis, Michael Andrew

    2014-01-01

    Pause is a necessity within the rhythm of life. There are pauses everywhere around us; we pause when we breathe, we pause when we speak, and we pause when we think. Pause is a crucial part in the most beautiful pieces of music, it is in between our bites of food and sips of coffee. Pause is what makes life beautiful; without it the world around us will consist of a meaningless cacophony. Architecture, much like other things in life must also contain pauses to be enjoyable. The most memora...

  2. A positioned +1 nucleosome enhances promoter-proximal pausing.

    Science.gov (United States)

    Jimeno-González, Silvia; Ceballos-Chávez, María; Reyes, José C

    2015-03-31

    Chromatin distribution is not uniform along the human genome. In most genes there is a promoter-associated nucleosome free region (NFR) followed by an array of nucleosomes towards the gene body in which the first (+1) nucleosome is strongly positioned. The function of this characteristic chromatin distribution in transcription is not fully understood. Here we show in vivo that the +1 nucleosome plays a role in modulating RNA polymerase II (RNAPII) promoter-proximal pausing. When a +1 nucleosome is strongly positioned, elongating RNAPII has a tendency to stall at the promoter-proximal region, recruits more negative elongation factor (NELF) and produces less mRNA. The nucleosome-induced pause favors pre-mRNA quality control by promoting the addition of the cap to the nascent RNA. Moreover, the uncapped RNAs produced in the absence of a positioned nucleosome are degraded by the 5'-3' exonuclease XRN2. Interestingly, reducing the levels of the chromatin remodeler ISWI factor SNF2H decreases +1 nucleosome positioning and increases RNAPII pause release. This work demonstrates a function for +1 nucleosome in regulation of transcription elongation, pre-mRNA processing and gene expression.

  3. Model of the pathway of −1 frameshifting: Long pausing

    Directory of Open Access Journals (Sweden)

    Ping Xie

    2016-03-01

    Full Text Available It has been characterized that the programmed ribosomal −1 frameshifting often occurs at the slippery sequence on the presence of a downstream mRNA pseudoknot. In some prokaryotic cases such as the dnaX gene of Escherichia coli, an additional stimulatory signal—an upstream, internal Shine–Dalgarno (SD sequence—is also necessary to stimulate the efficient −1 frameshifting. However, the molecular and physical mechanism of the −1 frameshifting is poorly understood. Here, we propose a model of the pathway of the −1 translational frameshifting during ribosome translation of the dnaX −1 frameshift mRNA. With the model, the single-molecule fluorescence data (Chen et al. (2014 [29] on the dynamics of the shunt either to long pausing or to normal translation, the tRNA transit and sampling dynamics in the long-paused rotated state, the EF-G sampling dynamics, the mean rotated-state lifetimes, etc., are explained quantitatively. Moreover, the model is also consistent with the experimental data (Yan et al. (2015 [30] on translocation excursions and broad branching of frameshifting pathways. In addition, we present some predicted results, which can be easily tested by future optical trapping experiments.

  4. Predicting pauses in L1 and L2 speech: the effects of utterance boundaries and word frequency

    NARCIS (Netherlands)

    de Jong, N.H.

    2016-01-01

    This paper compares the distribution of silent and filled pauses in first (L1) and second language (L2) speech. The occurrence of pauses of 52 L2 and 18 L1 Dutch speakers was evaluated with respect to utterance boundaries and word frequency. We found that L2 speakers paused more often than L1

  5. Predicting pauses in L1 and L2 speech: the effects of utterance boundaries and word frequency

    NARCIS (Netherlands)

    de Jong, N.H.

    2016-01-01

    This paper compares the distribution of silent and filled pauses in first (L1) and second language (L2) speech. The occurrence of pauses of 52 L2 and 18 L1 Dutch speakers was evaluated with respect to utterance boundaries and word frequency. We found that L2 speakers paused more often than L1 speake

  6. The pause on avian H5N1 influenza virus transmission research should be ended

    NARCIS (Netherlands)

    R.A.M. Fouchier (Ron); A. García-Sastre (Adolfo); Y. Kawaoka (Yoshihiro)

    2012-01-01

    textabstractA voluntary 60-day pause on avian H5N1 influenza virus transmission research was announced in January 2012 by the international community of influenza scientists engaged in this work to provide time to explain the benefits of such work and the risk mitigation measures in place. Subsequen

  7. Comparison of pausing behavior in children who stutter and children who have Asperger syndrome.

    Science.gov (United States)

    Beltrame, Jessica Monique; Viera, Renata Alves Torello; Tamanaha, Ana Carina; Arcuri, Cláudia Fassin; Osborn, Ellen; Perissinoto, Jacy; Schiefer, Ana Maria

    2011-12-01

    The objective of this research was to compare the number and types of grammatical and non-grammatical silent pauses presented by stutterers and subjects with Asperger syndrome in their narratives. Ten children who stutter and four participants with Asperger syndrome (mean ages of both groups 10 years) were assessed at the Speech and Language Disorders Department of the Universidade Federal de São Paulo/Brasil. They narrated a story based on a pre-selected sequence of pictures. They were filmed and their productions were analyzed using version 5.0.47 of Praat (http://www.fon.hum.uva.nl/praat/download_win.html). Silent intervals in the speech that ranged from 0.25 to 4s were considered pauses. The pauses were classified as grammatical and non-grammatical, depending on the words that preceded and followed them. Both groups presented grammatical and non-grammatical pauses and the former predominated. The children with Asperger syndrome produced a greater number of pauses than the stutterers. The reader will be able to: (1) characterize the use of pauses in the oral narrative; (2) distinguish a grammatical pause from a non-grammatical pause regarding the use and function; (3) recognize the pattern of pause found in the two populations. Copyright © 2011 Elsevier Inc. All rights reserved.

  8. Thermodynamic and Kinetic Modeling of Transcriptional Pausing

    National Research Council Canada - National Science Library

    Vasisht R. Tadigotla; Dáibhid Ó. Maoiléidigh; Anirvan M. Sengupta; Vitaly Epshtein; Richard H. Ebright; Evgeny Nudler; Andrei E. Ruckenstein

    2006-01-01

    We present a statistical mechanics approach for the prediction of backtracked pauses in bacterial transcription elongation derived from structural models of the transcription elongation complex (EC...

  9. Back Channelling, Repair, Pausing, and Private Speech.

    Science.gov (United States)

    White, Ron

    1997-01-01

    Focuses on differences in back channelling, repair, repetition, pausing, and private speech among Japanese and American study participants, based on sales negotiations. Findings indicate that differences in the deployment of such features as back channelling and pausing can result in pragma-linguistic breakdown, which is linked to culturally…

  10. Interruption and Pausing of Public Display Games

    DEFF Research Database (Denmark)

    Feuchtner, Tiare; Walter, Robert; Müller, Jörg

    We present a quantitative and qualitative analysis of interruptions of interaction with a public display game, and explore the use of a manual pause mode in this scenario. In previous public display installations we observed users frequently interrupting their interaction. To explore ways...... of supporting such behavior, we implemented a gesture controlled multiuser game with four pausing techniques. We evaluated them in a field study analyzing 704 users and found that our pausing techniques were eagerly explored, but rarely used with the intention to pause the game. Our study shows...... that interactions with public displays are considerably intermissive, and that users mostly interrupt interaction to socialize and mainly approach public displays in groups. We conclude that, as a typical characteristic of public display interaction, interruptions deserve consideration. However, manual pause modes...

  11. A universal transcription pause sequence is an element of initiation factor σ70-dependent pausing

    Science.gov (United States)

    Bird, Jeremy G.; Strobel, Eric J.; Roberts, Jeffrey W.

    2016-01-01

    The Escherichia coli σ70 initiation factor is required for a post-initiation, promoter-proximal pause essential for regulation of lambdoid phage late gene expression; potentially, σ70 acts at other sites during transcription elongation as well. The pause is induced by σ70 binding to a repeat of the promoter −10 sequence. After σ70 binding, further RNA synthesis occurs as DNA is drawn (or ‘scrunched’) into the enzyme complex, presumably exactly as occurs during initial synthesis from the promoter; this synthesis then pauses at a defined site several nucleotides downstream from the active center position when σ70 first engages the −10 sequence repeat. We show that the actual pause site in the stabilized, scrunched complex is the ‘elemental pause sequence’ recognized from its frequent occurrence in the E. coli genome. σ70 binding and the elemental pause sequence together, but neither alone, produce a substantial transcription pause. PMID:27098041

  12. Transient pauses of the bacterial flagellar motor at low load

    Science.gov (United States)

    Nord, A. L.; Pedaci, F.; Berry, R. M.

    2016-11-01

    The bacterial flagellar motor (BFM) is the molecular machine responsible for the swimming and chemotaxis of many species of motile bacteria. The BFM is bidirectional, and changes in the rotation direction of the motor are essential for chemotaxis. It has previously been observed that many species of bacteria also demonstrate brief pauses in rotation, though the underlying cause of such events remains poorly understood. We examine the rotation of Escherichia coli under low mechanical load with high spatial and temporal resolution. We observe and characterize transient pauses in rotation in a strain which lacks a functional chemosensory network, showing that such events are a phenomenon separate from a change in rotational direction. Rotating at low load, the BFM of E. coli exhibits about 10 pauses s-1, lasting on average 5 ms, during which time the rotor diffuses with net forwards rotation. Replacing the wild type stators with Na+ chimera stators has no substantial effect on the pausing. We discuss possible causes of such events, which are likely a product of a transient change in either the stator complex or the rotor.

  13. Interword and intraword pause threshold in writing

    Science.gov (United States)

    Chenu, Florence; Pellegrino, François; Jisa, Harriet; Fayol, Michel

    2014-01-01

    Writing words in real life involves setting objectives, imagining a recipient, translating ideas into linguistic forms, managing grapho-motor gestures, etc. Understanding writing requires observation of the processes as they occur in real time. Analysis of pauses is one of the preferred methods for accessing the dynamics of writing and is based on the idea that pauses are behavioral correlates of cognitive processes. However, there is a need to clarify what we are observing when studying pause phenomena, as we will argue in the first section. This taken into account, the study of pause phenomena can be considered following two approaches. A first approach, driven by temporality, would define a threshold and observe where pauses, e.g., scriptural inactivity occurs. A second approach, linguistically driven, would define structural units and look for scriptural inactivity at the boundaries of these units or within these units. Taking a temporally driven approach, we present two methods which aim at the automatic identification of scriptural inactivity which is most likely not attributable to grapho-motor management in texts written by children and adolescents using digitizing tablets in association with Eye and Pen© (Chesnet and Alamargot, 2005). The first method is purely statistical and is based on the idea that the distribution of pauses exhibits different Gaussian components each of them corresponding to a different type of pause. After having reviewed the limits of this statistical method, we present a second method based on writing dynamics which attempts to identify breaking points in the writing dynamics rather than relying only on pause duration. This second method needs to be refined to overcome the fact that calculation is impossible when there is insufficient data which is often the case when working with young scriptors. PMID:24723896

  14. Pauses in theatrical interpretation: delimitation of prosodic constituents

    Directory of Open Access Journals (Sweden)

    Lourenço Chacon

    2014-07-01

    Full Text Available We intend to observe the function of a linguistic resource – the pause – in theatrical interpretation. Connected to the field of speech therapy, we search for theoretical support in the Linguistics field, mainly in prosodic phonology – specifically, we highlight intonational phrase and phonological utterance, prosodic constituents –, proposing a dialogue between these fields, regarding the work with actors. In speech therapy literature, the work with actors focuses, centrally, in organic issues involved in the vocal process, such as “misuse” or “voice abuse”. To a smaller extent, we find, in this literature, researches that emphasize issues regarding interpretation and expressive resources, besides a few emphasizing the importance of linguistic resources in interpretation. Differently, in linguistics literature, the pause is approached, to a larger extent, from the phonetic perspective, related to several language levels. In this research, we analyzed audio recordings of four actors from a same theatrical group, acting the theatrical text Brutas flores, focused on these aims: (1 detect the place where pauses happen in the interpretation of a single text by four actors; (2 survey physical characteristics of length of these pauses; (3 check to what extent the length of a pause is related to the place where it happens, regarding the prosodic limits of intonational phrases (I and phonological utterance (U. We could observe that, although the interpretation is characterized by the subjectivity of the actor, the interpretation is constructed based in the possibilities offered by the prosodic organization of the text itself, being more or less flexible.We were also able to confirm, by considering the length of VVs units containing pauses, the prosodic hierarchy proposed by Nespor & Vogel, once the length of these units in U's limits was significantly higher than the length in I's limits. Thus, our results reinforce the premise that a

  15. Thermodynamic and kinetic modeling of transcriptional pausing.

    Science.gov (United States)

    Tadigotla, Vasisht R; O Maoiléidigh, Dáibhid; Sengupta, Anirvan M; Epshtein, Vitaly; Ebright, Richard H; Nudler, Evgeny; Ruckenstein, Andrei E

    2006-03-21

    We present a statistical mechanics approach for the prediction of backtracked pauses in bacterial transcription elongation derived from structural models of the transcription elongation complex (EC). Our algorithm is based on the thermodynamic stability of the EC along the DNA template calculated from the sequence-dependent free energy of DNA-DNA, DNA-RNA, and RNA-RNA base pairing associated with (i) the translocational and size fluctuations of the transcription bubble; (ii) changes in the associated DNA-RNA hybrid; and (iii) changes in the cotranscriptional RNA secondary structure upstream of the RNA exit channel. The calculations involve no adjustable parameters except for a cutoff used to discriminate paused from nonpaused complexes. When applied to 100 experimental pauses in transcription elongation by Escherichia coli RNA polymerase on 10 DNA templates, the approach produces statistically significant results. We also present a kinetic model for the rate of recovery of backtracked paused complexes. A crucial ingredient of our model is the incorporation of kinetic barriers to backtracking resulting from steric clashes of EC with the cotranscriptionally generated RNA secondary structure, an aspect not included explicitly in previous attempts at modeling the transcription elongation process.

  16. Interruption and Pausing of Public Display Games

    DEFF Research Database (Denmark)

    Feuchtner, Tiare; Walter, Robert; Müller, Jörg

    2016-01-01

    We present a quantitative and qualitative analysis of interruptions of interaction with a public display game, and explore the use of a manual pause mode in this scenario. In previous public display installations we observed users frequently interrupting their interaction. To explore ways of supp...

  17. Thermodynamic and kinetic modeling of transcriptional pausing

    OpenAIRE

    Tadigotla, Vasisht R.; Maoiléidigh, Dáibhid Ó; Sengupta, Anirvan M.; Epshtein, Vitaly; Ebright, Richard H.; Nudler, Evgeny; Ruckenstein, Andrei E.

    2006-01-01

    We present a statistical mechanics approach for the prediction of backtracked pauses in bacterial transcription elongation derived from structural models of the transcription elongation complex (EC). Our algorithm is based on the thermodynamic stability of the EC along the DNA template calculated from the sequence-dependent free energy of DNA–DNA, DNA–RNA, and RNA–RNA base pairing associated with (i) the translocational and size fluctuations of the transcription bubble; (ii) changes in the as...

  18. Effects of transcriptional pausing on gene expression dynamics.

    Directory of Open Access Journals (Sweden)

    Tiina Rajala

    2010-03-01

    Full Text Available Stochasticity in gene expression affects many cellular processes and is a source of phenotypic diversity between genetically identical individuals. Events in elongation, particularly RNA polymerase pausing, are a source of this noise. Since the rate and duration of pausing are sequence-dependent, this regulatory mechanism of transcriptional dynamics is evolvable. The dependency of pause propensity on regulatory molecules makes pausing a response mechanism to external stress. Using a delayed stochastic model of bacterial transcription at the single nucleotide level that includes the promoter open complex formation, pausing, arrest, misincorporation and editing, pyrophosphorolysis, and premature termination, we investigate how RNA polymerase pausing affects a gene's transcriptional dynamics and gene networks. We show that pauses' duration and rate of occurrence affect the bursting in RNA production, transcriptional and translational noise, and the transient to reach mean RNA and protein levels. In a genetic repressilator, increasing the pausing rate and the duration of pausing events increases the period length but does not affect the robustness of the periodicity. We conclude that RNA polymerase pausing might be an important evolvable feature of genetic networks.

  19. ON THE PAUSED WARMING CONTROVERSY BASED ON IPCC AR5 AND BEYOND

    Directory of Open Access Journals (Sweden)

    MIKA J.

    2014-03-01

    Full Text Available The paused warming since ca. 2002 (maybe, 1998 is not satisfactorily reflected by the IPCC WGI (2013 Report. The aim of the present study is to collect, present and discuss the key arguments of the issue, selected strictly from this valuable Report. Our study tackles three aspects: (i Symptoms of pausing, including atmospheric changes, near-surface oceans, cryosphere and geographical differences. (ii Possible reasons of the paused warming, including external forcing factors, playing rather minor role, and the enhanced ocean heat uptake. Though missing warming is 0.2 K/decade compared to the model expectations, the whole climate system integrates continuously increasing amount of heat, 95 % of which is locked in the oceans. (iii Consequences of the pausing for the three main branches of the IPCC activity. For climate science, correct simulation of the enhanced heat uptake is a challenge. Since characteristic time scale of most adaptation measures is 1-2 decades, or shorter, near-term projections may not drive adaptation until climate models become able meet this challenge. On the other hand, pausing warming does not question the need for mitigation, since it is physically unlikely, that oceans can uptake endless amount of heat. Vertical temperature gradients of the upper ocean layers already show stagnation.

  20. Cold Water and Pauses in Illumination Reduces Pain During Photodynamic Therapy: A Randomized Clinical Study

    DEFF Research Database (Denmark)

    Wiegell, S.R.; Haedersdal, M.; Wulf, H.C.

    2009-01-01

    symmetrical areas and cooled with either cold-water-spray or cold-water-pack (Coo]Pack). Treatment areas were cooled during either the first or second period of illumination, which were separated by a 3-min pause in illumination. Pain intensity was scored from 0 to 10. Water-spray reduced the mean pain score...... by 1.2 points (p=0.030) and CoolPack by 1.3 points (p=0.007) during the first half of the illumination. Pain intensity decreased during the pause by 3.7 points in water-spray patients (p

  1. Phonetic Pause Unites Phonology and Semantics against Morphology and Syntax

    Science.gov (United States)

    Sakarna, Ahmad Khalaf; Mobaideen, Adnan

    2012-01-01

    The present study investigates the phonological effect triggered by the different types of phonetic pause used in Quran on morphology, syntax, and semantics. It argues that Quranic pause provides interesting evidence about the close relation between phonology and semantics, from one side, and semantics, morphology, and syntax, from the other…

  2. Phonetic Pause Unites Phonology and Semantics against Morphology and Syntax

    Science.gov (United States)

    Sakarna, Ahmad Khalaf; Mobaideen, Adnan

    2012-01-01

    The present study investigates the phonological effect triggered by the different types of phonetic pause used in Quran on morphology, syntax, and semantics. It argues that Quranic pause provides interesting evidence about the close relation between phonology and semantics, from one side, and semantics, morphology, and syntax, from the other…

  3. Using Habit Reversal to Decrease Filled Pauses in Public Speaking

    Science.gov (United States)

    Mancuso, Carolyn; Miltenberger, Raymond G.

    2016-01-01

    This study evaluated the effectiveness of simplified habit reversal in reducing filled pauses that occur during public speaking. Filled pauses consist of "uh," "um," or "er"; clicking sounds; and misuse of the word "like." After baseline, participants received habit reversal training that consisted of…

  4. PBMA Pause and Learn Video Nuggets Transcript

    Science.gov (United States)

    Rogers, Ed

    2006-01-01

    This document is a transcript for a video about a practice practiced at Goddard Space Flight Center called Pause and Learn (PaL). The PaL process is intended to, first of all, help the team learn. So, the team that was involved in the activity, the group that actually did the work, that handled the review, or ran the tests, or developed the piece of equipment, they sit down and actually say, "What did we learn from this exercise?" The idea is to create a learning environment at various key milestones in the execution of a process, rather than wait until the end of the given process, be it a launch or a mission.

  5. Pause and Utterance Duration in Child-Directed Speech in Relation to Child Vocabulary Size

    Science.gov (United States)

    Marklund, Ulrika; Marklund, Ellen; Lacerda, Francisco; Schwarz, Iris-Corinna

    2015-01-01

    This study compares parental pause and utterance duration in conversations with Swedish speaking children at age 1;6 who have either a large, typical, or small expressive vocabulary, as measured by the Swedish version of the McArthur-Bates CDI. The adjustments that parents do when they speak to children are similar across all three vocabulary…

  6. Transcriptional interference by RNA polymerase pausing and dislodgement of transcription factors.

    Science.gov (United States)

    Palmer, Adam C; Egan, J Barry; Shearwin, Keith E

    2011-01-01

    Transcriptional interference is the in cis suppression of one transcriptional process by another. Mathematical modeling shows that promoter occlusion by elongating RNA polymerases cannot produce strong interference. Interference may instead be generated by (1) dislodgement of slow-to-assemble pre-initiation complexes and transcription factors and (2) prolonged occlusion by paused RNA polymerases.

  7. Pause and Utterance Duration in Child-Directed Speech in Relation to Child Vocabulary Size

    Science.gov (United States)

    Marklund, Ulrika; Marklund, Ellen; Lacerda, Francisco; Schwarz, Iris-Corinna

    2015-01-01

    This study compares parental pause and utterance duration in conversations with Swedish speaking children at age 1;6 who have either a large, typical, or small expressive vocabulary, as measured by the Swedish version of the McArthur-Bates CDI. The adjustments that parents do when they speak to children are similar across all three vocabulary…

  8. High frequency of pauses during intermittent locomotion of small South American gymnophthalmid lizards (Squamata, Gymnophthalmidae

    Directory of Open Access Journals (Sweden)

    Elizabeth Höfling

    2004-12-01

    Full Text Available We studied the locomotor behavior of two closely-related species of Gymnophthalmini lizards, Vanzosaura rubricauda and Procellosaurinus tetradactylus, that was imaged under laboratory conditions at a rate of 250 frames/s with a high-speed video camera (MotionScope PCI 1000 on four different substrates with increasing degrees of roughness (smooth perspex, cardboard, glued sand, and glued gravel. Vanzosaura rubricauda and P. tetradactylus are both characterized by intermittent locomotion, with pauses occurring with high frequency and having a short duration (from 1/10 to 1/3 s, and taking place in rhythmic locomotion in an organized fashion during all types ofgaits and on different substrates. The observed variations in duration and frequency of pauses suggest that in V. rubricauda mean pause duration is shorter and pause frequency is higher than in P. tetradactylus. The intermittent locomotion observed in V.rubricauda and P. tetradactylus imaging at 250 frames/s is probably of interest for neurobiologists. In the review of possible determinants, the phylogenetic relationships among the species of the tribe Gymnophthalmini are focused. Keywords: .

  9. Computer work duration and its dependence on the used pause definition.

    Science.gov (United States)

    Richter, Janneke M; Slijper, Harm P; Over, Eelco A B; Frens, Maarten A

    2008-11-01

    Several ergonomic studies have estimated computer work duration using registration software. In these studies, an arbitrary pause definition (Pd; the minimal time between two computer events to constitute a pause) is chosen and the resulting duration of computer work is estimated. In order to uncover the relationship between the used pause definition and the computer work duration (PWT), we used registration software to record usage patterns of 571 computer users across almost 60,000 working days. For a large range of Pds (1-120 s), we found a shallow, log-linear relationship between PWT and Pds. For keyboard and mouse use, a second-order function fitted the data best. We found that these relationships were dependent on the amount of computer work and subject characteristics. Comparison of exposure duration from studies using different pause definitions should take this into account, since it could lead to misclassification. Software manufacturers and ergonomists assessing computer work duration could use the found relationships for software design and study comparison.

  10. Pause for thought: response perseveration and personality in gambling.

    Science.gov (United States)

    Corr, Philip J; Thompson, Stephen J

    2014-12-01

    In a sample of normal volunteers, response perseveration (RP) on a computerised gambling task, the card perseveration task, was examined under two conditions: No pause (Standard task) and a 5-s pause (Pause task) following feedback from previous bet. Behavioural outcomes comprised number of cards played (and cash won/lost) and latency of response. Individual differences in these outcomes were conceptualised in terms of the reinforcement sensitivity theory of personality. Results showed that, on the Standard task only, sub-scales of the Carver and White (J Pers Social Psychol 67:319-333, 1994) Behavioural Approach System scale positively correlated with number of cards played and amount of money lost (indicative of impaired RP), but these associations were abolished with the imposition of a 5-s pause between feedback and the opportunity to make the next bet-this pause also had an overall main effect of improving RP and reducing losses. As related research shows that such a pause normalises the RP deficit seen in pathological gamblers, these findings hold potentially valuable implications for informing practice in the prevention and treatment of pathological gambling, and point to the role played by individual differences in approach motivation.

  11. Global distribution of pauses observed with satellite measurements

    Indian Academy of Sciences (India)

    M Venkat Ratnam; P Kishore; Isabella Velicogna

    2013-04-01

    Several studies have been carried out on the tropopause, stratopause, and mesopause (collectively termed as ‘pauses’) independently; however, all the pauses have not been studied together. We present global distribution of altitudes and temperatures of these pauses observed with long-term space borne high resolution measurements of Global Positioning System (GPS) Radio Occultation (RO) and Sounding of the Atmosphere using Broadband Emission Radiometry (SABER) aboard Thermosphere-Ionosphere-Mesosphere Energetics and Dynamics (TIMED) satellite. Here we study the commonality and differences observed in the variability of all the pauses. We also examined how good other datasets will represent these features among (and in between) different satellite measurements, re-analysis, and model data. Hemispheric differences observed in all the pauses are also reported. In addition, we show that asymmetries between northern and southern hemispheres continue up to the mesopause. We analyze inter and intra-seasonal variations and long-term trends of these pauses at different latitudes. Finally, a new reference temperature profile is shown from the ground to 110 km for tropical, mid-latitudes, and polar latitudes for both northern and southern hemispheres.

  12. Detection of bursts and pauses in spike trains.

    Science.gov (United States)

    Ko, D; Wilson, C J; Lobb, C J; Paladini, C A

    2012-10-15

    Midbrain dopaminergic neurons in vivo exhibit a wide range of firing patterns. They normally fire constantly at a low rate, and speed up, firing a phasic burst when reward exceeds prediction, or pause when an expected reward does not occur. Therefore, the detection of bursts and pauses from spike train data is a critical problem when studying the role of phasic dopamine (DA) in reward related learning, and other DA dependent behaviors. However, few statistical methods have been developed that can identify bursts and pauses simultaneously. We propose a new statistical method, the Robust Gaussian Surprise (RGS) method, which performs an exhaustive search of bursts and pauses in spike trains simultaneously. We found that the RGS method is adaptable to various patterns of spike trains recorded in vivo, and is not influenced by baseline firing rate, making it applicable to all in vivo spike trains where baseline firing rates vary over time. We compare the performance of the RGS method to other methods of detecting bursts, such as the Poisson Surprise (PS), Rank Surprise (RS), and Template methods. Analysis of data using the RGS method reveals potential mechanisms underlying how bursts and pauses are controlled in DA neurons.

  13. Translational pauses during the synthesis of proteins and mRNA structure.

    Science.gov (United States)

    Zama, M

    1997-01-01

    Translational pauses are observed during a spider fibroin synthesis (1,2). The spider major ampullate (dragline) silk of the spider Nephila clavipes is composed of multiple proteins. The amino acid sequences of the partial cDNA clones for the two major dragline silk fibroin components (Spidroin 1 and 2) exhibit repetitive motifs (3,4). Our detailed inspection of the nucleotide sequences of the repetitive motifs revealed highly selective site-specific codon usage patterns within a motif, suggesting that the secondary structure of the spider fibroin mRNA is optimized by the nucleotide sequence of the fibroin gene. The results, combined with our preceding results on silk fibroin from Bombyx mori (5) suggest that translational pauses of spider silk are interpreted in terms of the mRNA secondary structure.

  14. Profiles and Pauses: Two Practical Activities for the Writing Class

    Directory of Open Access Journals (Sweden)

    Ernest Hall

    1998-01-01

    Full Text Available Abstract : This article describes two classroom activities, "Profiling" and "Pause Analysis", that can be successfully used in ESL writing classes. "Profiling" addresses such problems as poor development of ideas, simplistic ideas, and lack of coherence in written texts. "Pause Analysis" focusses on the thinking processes that students engage in while drafting text, processes such as searching for ideas, evaluat­ing ideas, and postponing ideas. Both activities enable the instructor to assume the role of intervener in the students' writing processes, rather than evaluator of the text produced. In drawing The attention of the student write to both product and process, "Profiling" and "Pause Analysis" help them develop an awareness of the relation-ship between ideas in English expository text and the thinking pro­cesses that writers engage in while drafting such text.

  15. eRNAs lure NELF from paused polymerases.

    Science.gov (United States)

    Plosky, Brian S

    2014-10-02

    RNAs transcribed from enhancers (eRNAs) have been linked to enhancer function. In this issue of Molecular Cell, Schaukowitch et al. (2014) show that upon activation, eRNAs can bind NELF and are necessary for its transient removal from promoters to release paused RNA polymerase II and drive expression of immediate-early genes in neurons.

  16. Code-Switching and Pausing: An Interdisciplinary Study

    Science.gov (United States)

    Gardner-Chloros, Penelope; McEntee-Atalianis, Lisa; Paraskeva, Marilena

    2013-01-01

    This study considers code-switching (CS) and pausing in two sociolinguistically distinct groups in London and Cyprus, bilingual in Greek-Cypriot Dialect (GCD) and English. The characteristics of their speech are examined both in monolingual and bilingual modes (Grosjean, 2001). It was hypothesised that in London Greek-Cypriots, where CS is a…

  17. Pause, Prompt, and Praise: The Need for More Research.

    Science.gov (United States)

    Goyen, Judith D.; McClelland, David J.

    1994-01-01

    Finds that the effectiveness of the "Pause, Prompt, and Praise" procedure varied according to the method of analysis used: subjective interpretation of gain scores indicated that the procedure was the most effective treatment for both tutees and tutors; the ANOVA indicated that the tutoring experience was effective; whereas the more rigorous…

  18. Pause, Prompt, and Praise: The Need for More Research.

    Science.gov (United States)

    Goyen, Judith D.; McClelland, David J.

    1994-01-01

    Finds that the effectiveness of the "Pause, Prompt, and Praise" procedure varied according to the method of analysis used: subjective interpretation of gain scores indicated that the procedure was the most effective treatment for both tutees and tutors; the ANOVA indicated that the tutoring experience was effective; whereas the more rigorous…

  19. Management of paroxysmal ectopic atrial tachycardia with long sinus pauses in a teenager.

    Science.gov (United States)

    Balaji, Seshadri

    2015-01-01

    Sinus pauses in the setting of supraventricular tachycardia is rare in children. We describe an asymptomatic teen with irregular heart rate detected during an incidental exam who was found to have short runs of a slow ectopic atrial tachycardia on electrocardiogram and prolonged sinus pauses on routine ambulatory ECG. Successful catheter ablation of the ectopic atrial tachycardia led to resolution of the sinus pauses.

  20. Responsible gambling tools: pop-up messages and pauses on video lottery terminals.

    Science.gov (United States)

    Cloutier, Martin; Ladouceur, Robert; Sévigny, Serge

    2006-09-01

    The authors examined the effect of messages and pauses, presented on video lottery terminal screens, on erroneous beliefs and persistence to play. At posttest, the strength of erroneous beliefs was lower for participants who received messages conveying information about randomness in gambling as compared to those who received pauses. Pauses also diminished the strength of erroneous beliefs, and there was no difference between the effects of pauses and messages on the number of games played. The authors discuss these results in terms of the use of messages and pauses on video lottery terminals as a strategy for promoting responsible gambling.

  1. Prolonging the postcomplex spike pause speeds eyeblink conditioning.

    Science.gov (United States)

    Maiz, Jaione; Karakossian, Movses H; Pakaprot, Narawut; Robleto, Karla; Thompson, Richard F; Otis, Thomas S

    2012-10-09

    Climbing fiber input to the cerebellum is believed to serve as a teaching signal during associative, cerebellum-dependent forms of motor learning. However, it is not understood how this neural pathway coordinates changes in cerebellar circuitry during learning. Here, we use pharmacological manipulations to prolong the postcomplex spike pause, a component of the climbing fiber signal in Purkinje neurons, and show that these manipulations enhance the rate of learning in classical eyelid conditioning. Our findings elucidate an unappreciated aspect of the climbing fiber teaching signal, and are consistent with a model in which convergent postcomplex spike pauses drive learning-related plasticity in the deep cerebellar nucleus. They also suggest a physiological mechanism that could modulate motor learning rates.

  2. Run-and-pause dynamics of cytoskeletal motor proteins

    Science.gov (United States)

    Hafner, Anne E.; Santen, Ludger; Rieger, Heiko; Shaebani, M. Reza

    2016-11-01

    Cytoskeletal motor proteins are involved in major intracellular transport processes which are vital for maintaining appropriate cellular function. When attached to cytoskeletal filaments, the motor exhibits distinct states of motility: active motion along the filaments, and pause phase in which it remains stationary for a finite time interval. The transition probabilities between motion and pause phases are asymmetric in general, and considerably affected by changes in environmental conditions which influences the efficiency of cargo delivery to specific targets. By considering the motion of individual non-interacting molecular motors on a single filament as well as a dynamic filamentous network, we present an analytical model for the dynamics of self-propelled particles which undergo frequent pause phases. The interplay between motor processivity, structural properties of filamentous network, and transition probabilities between the two states of motility drastically changes the dynamics: multiple transitions between different types of anomalous diffusive dynamics occur and the crossover time to the asymptotic diffusive or ballistic motion varies by several orders of magnitude. We map out the phase diagrams in the space of transition probabilities, and address the role of initial conditions of motion on the resulting dynamics.

  3. Analysis of Pause Occurrence in Three Kinds of Modified Speech: Public Address, Caretaker Talk, and Foreigner Talk.

    Science.gov (United States)

    Osada, Nobuko

    2003-01-01

    Analyzes the occurrence of silent pauses n monologues, especially in modified speech, such as in public address, caretaker talk, and foreigner talk. Discusses speech rate, articulation rate, pause unit length, individual pause length, and pause percentage to overall speech time. (Author/VWL)

  4. Cerebellar Nuclear Neurons Use Time and Rate Coding to Transmit Purkinje Neuron Pauses.

    Science.gov (United States)

    Sudhakar, Shyam Kumar; Torben-Nielsen, Benjamin; De Schutter, Erik

    2015-12-01

    Neurons of the cerebellar nuclei convey the final output of the cerebellum to their targets in various parts of the brain. Within the cerebellum their direct upstream connections originate from inhibitory Purkinje neurons. Purkinje neurons have a complex firing pattern of regular spikes interrupted by intermittent pauses of variable length. How can the cerebellar nucleus process this complex input pattern? In this modeling study, we investigate different forms of Purkinje neuron simple spike pause synchrony and its influence on candidate coding strategies in the cerebellar nuclei. That is, we investigate how different alignments of synchronous pauses in synthetic Purkinje neuron spike trains affect either time-locking or rate-changes in the downstream nuclei. We find that Purkinje neuron synchrony is mainly represented by changes in the firing rate of cerebellar nuclei neurons. Pause beginning synchronization produced a unique effect on nuclei neuron firing, while the effect of pause ending and pause overlapping synchronization could not be distinguished from each other. Pause beginning synchronization produced better time-locking of nuclear neurons for short length pauses. We also characterize the effect of pause length and spike jitter on the nuclear neuron firing. Additionally, we find that the rate of rebound responses in nuclear neurons after a synchronous pause is controlled by the firing rate of Purkinje neurons preceding it.

  5. Barack Obama’s pauses and gestures in humorous speeches

    DEFF Research Database (Denmark)

    Navarretta, Costanza

    2017-01-01

    and they emphasise the speech segment which they follow or precede. We also found a highly significant correlation between Obama’s speech pauses and audience response. Obama produces numerous head movements, facial expressions and hand gestures and their functions are related to both discourse content and structure....... Characteristics for these speeches is that Obama points to individuals in the audience and often smiles and laughs. Audience response is equally frequent in the two events, and there are no significant changes in speech rate and frequency of head movements and facial expressions in the two speeches while Obama...

  6. Kinetic modeling of molecular motors: pause model and parameter determination from single-molecule experiments

    Science.gov (United States)

    Morin, José A.; Ibarra, Borja; Cao, Francisco J.

    2016-05-01

    Single-molecule manipulation experiments of molecular motors provide essential information about the rate and conformational changes of the steps of the reaction located along the manipulation coordinate. This information is not always sufficient to define a particular kinetic cycle. Recent single-molecule experiments with optical tweezers showed that the DNA unwinding activity of a Phi29 DNA polymerase mutant presents a complex pause behavior, which includes short and long pauses. Here we show that different kinetic models, considering different connections between the active and the pause states, can explain the experimental pause behavior. Both the two independent pause model and the two connected pause model are able to describe the pause behavior of a mutated Phi29 DNA polymerase observed in an optical tweezers single-molecule experiment. For the two independent pause model all parameters are fixed by the observed data, while for the more general two connected pause model there is a range of values of the parameters compatible with the observed data (which can be expressed in terms of two of the rates and their force dependencies). This general model includes models with indirect entry and exit to the long-pause state, and also models with cycling in both directions. Additionally, assuming that detailed balance is verified, which forbids cycling, this reduces the ranges of the values of the parameters (which can then be expressed in terms of one rate and its force dependency). The resulting model interpolates between the independent pause model and the indirect entry and exit to the long-pause state model

  7. Promoter-proximal pausing of RNA polymerase II: emerging roles in metazoans

    Science.gov (United States)

    Adelman, Karen; Lis, John T.

    2013-01-01

    Recent years have witnessed a sea change in our understanding of transcription regulation: whereas traditional models focused solely on the events that brought RNA polymerase II (Pol II) to a gene promoter to initiate RNA synthesis, emerging evidence points to the pausing of Pol II during early elongation as a widespread regulatory mechanism in higher eukaryotes. Current data indicate that pausing is particularly enriched at genes in signal-responsive pathways. Here the evidence for pausing of Pol II from recent high-throughput studies will be discussed, as well as the potential interconnected functions of promoter-proximally paused Pol II. PMID:22986266

  8. Reducing Vocalized Pauses in Public Speaking Situations Using the VP Card

    Science.gov (United States)

    Ramos Salazar, Leslie

    2014-01-01

    This article describes a speaking problem very common in today's world--"vocalized pauses" (VP). Vocalized pauses are defined as utterances such as "uh," "like," and "um" that occur between words in oral sentences. This practice of everyday speech can affect how a speaker's intentions are…

  9. Progress in Written Language Bursts, Pauses, Transcription, and Written Composition across Schooling

    Science.gov (United States)

    Alves, Rui A.; Limpo, Teresa

    2015-01-01

    Research on adult writers has shown that writing proceeds through bursts of transcription activity interspersed by long pauses. Yet few studies have examined how these writing behaviors unfold during early and middle childhood. This study traces the progress of bursts, pauses, transcription, and written composition in Portuguese students from…

  10. What 50 Years of Research Tell Us about Pausing under Ratio Schedules of Reinforcement

    Science.gov (United States)

    Schlinger, H. D.; Derenne, A.; Baron, A.

    2008-01-01

    Textbooks in learning and behavior commonly describe performance on fixed-ratio schedules as "break and run," indicating that after reinforcement subjects typically pause and then respond quickly to the next reinforcement. Performance on variable-ratio schedules, on the other hand, is described as steady and fast, with few long pauses. Beginning…

  11. Absence of Non-histone Protein Complexes at Natural Chromosomal Pause Sites Results in Reduced Replication Pausing in Aging Yeast Cells

    Directory of Open Access Journals (Sweden)

    Marleny Cabral

    2016-11-01

    Full Text Available There is substantial evidence that genomic instability increases during aging. Replication pausing (and stalling at difficult-to-replicate chromosomal sites may induce genomic instability. Interestingly, in aging yeast cells, we observed reduced replication pausing at various natural replication pause sites (RPSs in ribosomal DNA (rDNA and non-rDNA locations (e.g., silent replication origins and tRNA genes. The reduced pausing occurs independent of the DNA helicase Rrm3p, which facilitates replication past these non-histone protein-complex-bound RPSs, and is independent of the deacetylase Sir2p. Conditions of caloric restriction (CR, which extend life span, also cause reduced replication pausing at the 5S rDNA and at tRNA genes. In aged and CR cells, the RPSs are less occupied by their specific non-histone protein complexes (e.g., the preinitiation complex TFIIIC, likely because members of these complexes have primarily cytosolic localization. These conditions may lead to reduced replication pausing and may lower replication stress at these sites during aging.

  12. Contextual Interaction Design: The Case of Pause Buddy

    Science.gov (United States)

    Keyson, David V.; Doff-Ottens, Hannah J.

    This paper describes a range of design techniques which have been elaborated upon by Industrial Designers to create novel interactive products in which context and social interaction play a central role in the user experience. The techniques described here can be broadly grouped under Context Mapping and Research through Design. The methods are presented as part of a design process, from "fuzzy front end" to a working field prototype. To illustrate how the methods can be applied, the design of a prototype product that was developed to reduce office stress by stimulating short breaks and social interaction pauses is described. The results of a field study are reported following by a reflection on the value of applied design methods.

  13. Transcriptional pausing at the translation start site operates as a critical checkpoint for riboswitch regulation

    Science.gov (United States)

    Chauvier, Adrien; Picard-Jean, Frédéric; Berger-Dancause, Jean-Christophe; Bastet, Laurène; Naghdi, Mohammad Reza; Dubé, Audrey; Turcotte, Pierre; Perreault, Jonathan; Lafontaine, Daniel A.

    2017-01-01

    On the basis of nascent transcript sequencing, it has been postulated but never demonstrated that transcriptional pausing at translation start sites is important for gene regulation. Here we show that the Escherichia coli thiamin pyrophosphate (TPP) thiC riboswitch contains a regulatory pause site in the translation initiation region that acts as a checkpoint for thiC expression. By biochemically probing nascent transcription complexes halted at defined positions, we find a narrow transcriptional window for metabolite binding, in which the downstream boundary is delimited by the checkpoint. We show that transcription complexes at the regulatory pause site favour the formation of a riboswitch intramolecular lock that strongly prevents TPP binding. In contrast, cotranscriptional metabolite binding increases RNA polymerase pausing and induces Rho-dependent transcription termination at the checkpoint. Early transcriptional pausing may provide a general mechanism, whereby transient transcriptional windows directly coordinate the sensing of environmental cues and bacterial mRNA regulation. PMID:28071751

  14. Pre-shock chest compression pause effects on termination of ventricular fibrillation/tachycardia and return of organized rhythm within mechanical and manual cardiopulmonary resuscitation

    NARCIS (Netherlands)

    Olsen, J.A.; Brunborg, C.; Steinberg, M.; Persse, D.; Sterz, F.; Lozano, M., Jr.; Westfall, M.; Travis, D.T.; Lerner, E.B.; Brouwer, M.A.; Wik, L.

    2015-01-01

    BACKGROUND: Shorter manual chest compression pauses prior to defibrillation attempts is reported to improve the defibrillation success rate. Mechanical load-distributing band (LDB-) CPR enables shocks without compression pause. We studied pre-shock pause and termination of ventricular

  15. Experimental pain leads to reorganisation of trapezius electromyography during computer work with active and passive pauses

    DEFF Research Database (Denmark)

    Samani, Afshin; Holtermann, Andreas; Søgaard, Karen

    2009-01-01

    in one day, with passive (relax) and active (30% maximum voluntary contraction of shoulder elevation) pauses given every 40 s without and with presence of experimental pain. Surface EMG signals were recorded from four parts of the trapezius. The centroid of exposure variation analysis along the time axis......The aim of this laboratory study was to investigate acute effects of experimental muscle pain on spatial electromyographic (EMG) activity of the trapezius muscle during computer work with active and passive pauses. Twelve healthy male subjects performed four sessions of computer work for 2 min...... was lower during computer work with active pauses when compared with passive one in all muscle parts (P

  16. Effects of eccentric exercise on trapezius electromyography during computer work with active and passive pauses

    DEFF Research Database (Denmark)

    Samani, Afshin; Holtermann, Andreas; Søgaard, Karen

    2009-01-01

    BACKGROUND: The aim of this laboratory study was to investigate the effects of eccentric exercises on the trapezius muscle spatial electromyographic (EMG) activity during computer work with active and passive pauses. METHODS: Twelve healthy male subjects performed computer work with passive (relax......) and active (30% maximum voluntary contraction of shoulder elevation) pauses given every 40s over 2 days, before, immediately and 24h after eccentric exercise. Surface EMG signals were recorded from four parts of the trapezius during computer work. FINDINGS: EMG amplitude during computer work decreased...... immediately after exercise (Pactive pauses compared with passive ones (P

  17. Active pauses induce more variable electromyographic pattern of the trapezius muscle activity during computer work

    DEFF Research Database (Denmark)

    Samani, Afshin; Holtermann, Andreas; Søgaard, Karen

    2009-01-01

    , with passive (relax) and active (30% maximum voluntary contraction of shoulder elevation) pauses given every 2 min at two different work paces (low/high). Bipolar SEMG from four parts of the trapezius muscle was recorded. The relative rest time was higher for the lower parts compared with the upper......The aim of this laboratory study was to evaluate effects of active and passive pauses and investigate the distribution of the trapezius surface electromyographic (SEMG) activity during computer mouse work. Twelve healthy male subjects performed four sessions of computer work for 10 min in one day...... of the trapezius (pactive pause compared with passive one (p

  18. Pol II Docking and Pausing at Growth and Stress Genes in C. elegans

    OpenAIRE

    Colin S. Maxwell; William S. Kruesi; Leighton J. Core; Nicole Kurhanewicz; Colin T. Waters; Caitlin L. Lewarch; Igor Antoshechkin; John T. Lis; Barbara J. Meyer; L. Ryan Baugh

    2014-01-01

    Fluctuations in nutrient availability profoundly impact gene expression. Previous work revealed postrecruitment regulation of RNA polymerase II (Pol II) during starvation and recovery in Caenorhabditis elegans, suggesting that promoter-proximal pausing promotes rapid response to feeding. To test this hypothesis, we measured Pol II elongation genome wide by two complementary approaches and analyzed elongation in conjunction with Pol II binding and expression. We confirmed bona fide pausing dur...

  19. Pausing Behavior of End -Users in Online Searching - A Case Study of National Taiwan University

    Directory of Open Access Journals (Sweden)

    Mu-hsuan Huang

    1998-12-01

    Full Text Available This article analyzes the pausing behavior of end-users. The subjects are real end-users from National Taiwan University. This article uses the Dialog command language as its searching tool. It attempts to investigate the characteristics of pausing behavior. In addition, it tries to compare the behavior difference between the Chinese and American end-users. [Article content in Chinese

  20. An investigation into the correlation of cue phrases, unfilled pauses and the structuring of spoken discourse

    CERN Document Server

    Cahn, J E

    1992-01-01

    Expectations about the correlation of cue phrases, the duration of unfilled pauses and the structuring of spoken discourse are framed in light of Grosz and Sidner's theory of discourse and are tested for a directions-giving dialogue. The results suggest that cue phrase and discourse structuring tasks may align, and show a correlation for pause length and some of the modifications that speakers can make to discourse structure.

  1. The Effect of Compressor-Administered Defibrillation on Peri-shock Pauses in a Simulated Cardiac Arrest Scenario

    Directory of Open Access Journals (Sweden)

    Joshua Glick

    2014-03-01

    Full Text Available Introduction: Coordination of the tasks of performing chest compressions and defibrillation can lead to communication challenges that may prolong time spent off the chest. The purpose of this study was to determine whether defibrillation provided by the provider performing chest compressions led to a decrease in peri-shock pauses as compared to defibrillation administered by a second provider, in a simulated cardiac arrest scenario. Methods: This was a randomized, controlled study measuring pauses in chest compressions for defibrillation in a simulated cardiac arrest model. We approached hospital providers with current CPR certification for participation between July, 2011 and October, 2011. Volunteers were randomized to control (facilitator-administered defibrillation or experimental (compressor-administered defibrillation groups. All participants completed one minute of chest compressions on a mannequin in a shockable rhythm prior to administration of defibrillation. We measured and compared pauses for defibrillation in both groups. Results: Out of 200 total participants, we analyzed data from 197 defibrillations. Compressor-initiated defibrillation resulted in a significantly lower pre-shock hands-off time (0.57 s; 95% CI: 0.47-0.67 compared to facilitator-initiated defibrillation (1.49 s; 95% CI: 1.35-1.64. Furthermore, compressor-initiated defibrillation resulted in a significantly lower peri-shock hands-off time (2.77 s; 95% CI: 2.58-2.95 compared to facilitator-initiated defibrillation (4.25 s; 95% CI: 4.08-4.43. Conclusion: Assigning the responsibility for shock delivery to the provider performing compressions encourages continuous compressions throughout the charging period and decreases total time spent off the chest. However, as this was a simulation-based study, clinical implementation is necessary to further evaluate these potential benefits. [West J Emerg Med. 2014;15(2:246–250.

  2. Detecting sequence dependent transcriptional pauses from RNA and protein number time series

    Directory of Open Access Journals (Sweden)

    Emmert-Streib Frank

    2012-06-01

    Full Text Available Abstract Background Evidence suggests that in prokaryotes sequence-dependent transcriptional pauses affect the dynamics of transcription and translation, as well as of small genetic circuits. So far, a few pause-prone sequences have been identified from in vitro measurements of transcription elongation kinetics. Results Using a stochastic model of gene expression at the nucleotide and codon levels with realistic parameter values, we investigate three different but related questions and present statistical methods for their analysis. First, we show that information from in vivo RNA and protein temporal numbers is sufficient to discriminate between models with and without a pause site in their coding sequence. Second, we demonstrate that it is possible to separate a large variety of models from each other with pauses of various durations and locations in the template by means of a hierarchical clustering and a random forest classifier. Third, we introduce an approximate likelihood function that allows to estimate the location of a pause site. Conclusions This method can aid in detecting unknown pause-prone sequences from temporal measurements of RNA and protein numbers at a genome-wide scale and thus elucidate possible roles that these sequences play in the dynamics of genetic networks and phenotype.

  3. Detecting sequence dependent transcriptional pauses from RNA and protein number time series.

    Science.gov (United States)

    Emmert-Streib, Frank; Häkkinen, Antti; Ribeiro, Andre S

    2012-06-28

    Evidence suggests that in prokaryotes sequence-dependent transcriptional pauses affect the dynamics of transcription and translation, as well as of small genetic circuits. So far, a few pause-prone sequences have been identified from in vitro measurements of transcription elongation kinetics. Using a stochastic model of gene expression at the nucleotide and codon levels with realistic parameter values, we investigate three different but related questions and present statistical methods for their analysis. First, we show that information from in vivo RNA and protein temporal numbers is sufficient to discriminate between models with and without a pause site in their coding sequence. Second, we demonstrate that it is possible to separate a large variety of models from each other with pauses of various durations and locations in the template by means of a hierarchical clustering and a random forest classifier. Third, we introduce an approximate likelihood function that allows to estimate the location of a pause site. This method can aid in detecting unknown pause-prone sequences from temporal measurements of RNA and protein numbers at a genome-wide scale and thus elucidate possible roles that these sequences play in the dynamics of genetic networks and phenotype.

  4. Replication pauses of the wild-type and mutant mitochondrial DNA polymerase gamma: a simulation study.

    Directory of Open Access Journals (Sweden)

    Zhuo Song

    2011-11-01

    Full Text Available The activity of polymerase γ is complicated, involving both correct and incorrect DNA polymerization events, exonuclease activity, and the disassociation of the polymerase:DNA complex. Pausing of pol-γ might increase the chance of deletion and depletion of mitochondrial DNA. We have developed a stochastic simulation of pol-γ that models its activities on the level of individual nucleotides for the replication of mtDNA. This method gives us insights into the pausing of two pol-γ variants: the A467T substitution that causes PEO and Alpers syndrome, and the exonuclease deficient pol-γ (exo(- in premature aging mouse models. To measure the pausing, we analyzed simulation results for the longest time for the polymerase to move forward one nucleotide along the DNA strand. Our model of the exo(- polymerase had extremely long pauses, with a 30 to 300-fold increase in the time required for the longest single forward step compared to the wild-type, while the naturally occurring A467T variant showed at most a doubling in the length of the pauses compared to the wild-type. We identified the cause of these differences in the polymerase pausing time to be the number of disassociations occurring in each forward step of the polymerase.

  5. Replication pauses of the wild-type and mutant mitochondrial DNA polymerase gamma: a simulation study.

    Science.gov (United States)

    Song, Zhuo; Cao, Yang; Samuels, David C

    2011-11-01

    The activity of polymerase γ is complicated, involving both correct and incorrect DNA polymerization events, exonuclease activity, and the disassociation of the polymerase:DNA complex. Pausing of pol-γ might increase the chance of deletion and depletion of mitochondrial DNA. We have developed a stochastic simulation of pol-γ that models its activities on the level of individual nucleotides for the replication of mtDNA. This method gives us insights into the pausing of two pol-γ variants: the A467T substitution that causes PEO and Alpers syndrome, and the exonuclease deficient pol-γ (exo(-)) in premature aging mouse models. To measure the pausing, we analyzed simulation results for the longest time for the polymerase to move forward one nucleotide along the DNA strand. Our model of the exo(-) polymerase had extremely long pauses, with a 30 to 300-fold increase in the time required for the longest single forward step compared to the wild-type, while the naturally occurring A467T variant showed at most a doubling in the length of the pauses compared to the wild-type. We identified the cause of these differences in the polymerase pausing time to be the number of disassociations occurring in each forward step of the polymerase.

  6. How long is too long? How pause features after requests affect the perceived willingness of affirmative answers

    DEFF Research Database (Denmark)

    Kohtz, Lea Susan; Niebuhr, Oliver

    2017-01-01

    A perception experiment involving 28 German listeners is presented. It investigates – for sequences of request, pause, and affirmative answer – the effect of pause duration on the answerer's perceived willingness to comply with the request. Replicating earlier results on American English, perceiv......) on perceived willingness judgments. The overall results picture is discussed with respect to the origin of the "tolerance threshold", the status of breathing in speech, and the function of pauses in communication....

  7. Transcriptional pausing coordinates folding of the aptamer domain and the expression platform of a riboswitch.

    Science.gov (United States)

    Perdrizet, George A; Artsimovitch, Irina; Furman, Ran; Sosnick, Tobin R; Pan, Tao

    2012-02-28

    Riboswitches are cis-acting elements that regulate gene expression by affecting transcriptional termination or translational initiation in response to binding of a metabolite. A typical riboswitch is made of an upstream aptamer domain and a downstream expression platform. Both domains participate in the folding and structural rearrangement in the absence or presence of its cognate metabolite. RNA polymerase pausing is a fundamental property of transcription that can influence RNA folding. Here we show that pausing plays an important role in the folding and conformational rearrangement of the Escherichia coli btuB riboswitch during transcription by the E. coli RNA polymerase. This riboswitch consists of an approximately 200 nucleotide, coenzyme B12 binding aptamer domain and an approximately 40 nucleotide expression platform that controls the ribosome access for translational initiation. We found that transcriptional pauses at strategic locations facilitate folding and structural rearrangement of the full-length riboswitch, but have minimal effect on the folding of the isolated aptamer domain. Pausing at these regulatory sites blocks the formation of alternate structures and plays a chaperoning role that couples folding of the aptamer domain and the expression platform. Pausing at strategic locations may be a general mechanism for coordinated folding and conformational rearrangements of riboswitch structures that underlie their response to environmental cues.

  8. The history of research on the filled pause as evidence of the written language bias in linguistics (Linell, 1982).

    Science.gov (United States)

    O'Connell, Daniel C; Kowal, Sabine

    2004-11-01

    Erard's (2004) publication in the New York Times of a journalistic history of the filled pause serves as the occasion for this critical review of the past half-century of research on the filled pause. Historically, the various phonetic realizations or instantiations of the filled pause have been presented with an odd recurrent admixture of the interjection ah. In addition, the filled pause has been consistently associated with both hesitation and disfluency. The present authors hold that such a mandatory association of the filled pause with disfluency is the product of The written language bias in linguistics [Linell, 1982] and disregards much cogent evidence to the contrary. The implicit prescriptivism of well formedness--a demand derived from literacy--must be rejected; literate well formedness is not a necessary or even typical property of spontaneous spoken discourse; its structures and functions--including those of the filled pause--are very different from those of written language The recent work of Clark and Fox Tree (2002) holds promise for moving the status of the filled pause not only toward that of a conventional word, but also toward its status as an interjection. This latter development is also being fostered by lexicographers. Nonetheless, in view of ongoing research regarding the disparate privileges of occurrence and functions of filled pauses in comparison with interjections, the present authors are reluctant to categorize the filled pause as an interjection.

  9. The Effects of Computer-assisted Pronunciation Readings on ESL Learners’ Use of Pausing, Stress, Intonation, and Overall Comprehensibility

    Directory of Open Access Journals (Sweden)

    Mark Tanner

    2001-10-01

    Full Text Available With research showing the benefits of pronunciation instruction aimed at suprasegmentals (Derwing, Munro, & Wiebe, 1997, 1998; Derwing & Rossiter, 2003; Hahn, 2004; McNerney and Mendelsohn, 1992, more materials are needed to provide learners opportunities for self-directed practice. A 13-week experimental study was performed with 75 ESL learners divided into control and treatment groups. The treatment group was exposed to 11 weeks of self-directed computer-assisted practice using Cued Pronunciation Readings (CPRs. In the quasi-experimental pre-test/post-test design, speech perception and production samples were collected at Time 1 (week one of the study and Time 2 (week 13. Researchers analyzed the treatment’s effect on the learners’ perception and production of key suprasegmental features (pausing, word stress, and sentence-final intonation, and the learners’ level of perceived comprehensibility. Results from the statistical tests revealed that the treatment had a significant effect on learners’ perception of pausing and word stress and controlled production of stress, even with limited time spent practicing CPRs in a self-directed environment.

  10. Pausing of RNA polymerase II regulates mammalian developmental potential through control of signaling networks.

    Science.gov (United States)

    Williams, Lucy H; Fromm, George; Gokey, Nolan G; Henriques, Telmo; Muse, Ginger W; Burkholder, Adam; Fargo, David C; Hu, Guang; Adelman, Karen

    2015-04-16

    The remarkable capacity for pluripotency and self-renewal in embryonic stem cells (ESCs) requires a finely tuned transcriptional circuitry wherein the pathways and genes that initiate differentiation are suppressed, but poised to respond rapidly to developmental signals. To elucidate transcriptional control in mouse ESCs in the naive, ground state, we defined the distribution of engaged RNA polymerase II (Pol II) at high resolution. We find that promoter-proximal pausing of Pol II is most enriched at genes regulating cell cycle and signal transduction and not, as expected, at developmental or bivalent genes. Accordingly, ablation of the primary pause-inducing factor NELF does not increase expression of lineage markers, but instead causes proliferation defects, embryonic lethality, and dysregulation of ESC signaling pathways. Indeed, ESCs lacking NELF have dramatically attenuated FGF/ERK activity, rendering them resistant to differentiation. This work thus uncovers a key role for NELF-mediated pausing in establishing the responsiveness of stem cells to developmental cues.

  11. Pol II Docking and Pausing at Growth and Stress Genes in C. elegans

    Directory of Open Access Journals (Sweden)

    Colin S. Maxwell

    2014-02-01

    Full Text Available Fluctuations in nutrient availability profoundly impact gene expression. Previous work revealed postrecruitment regulation of RNA polymerase II (Pol II during starvation and recovery in Caenorhabditis elegans, suggesting that promoter-proximal pausing promotes rapid response to feeding. To test this hypothesis, we measured Pol II elongation genome wide by two complementary approaches and analyzed elongation in conjunction with Pol II binding and expression. We confirmed bona fide pausing during starvation and also discovered Pol II docking. Pausing occurs at active stress-response genes that become downregulated in response to feeding. In contrast, “docked” Pol II accumulates without initiating upstream of inactive growth genes that become rapidly upregulated upon feeding. Beyond differences in function and expression, these two sets of genes have different core promoter motifs, suggesting alternative transcriptional machinery. Our work suggests that growth and stress genes are both regulated postrecruitment during starvation but at initiation and elongation, respectively, coordinating gene expression with nutrient availability.

  12. Clues cue the smooze: rhyme, pausing and prediction help children learn new words from storybooks

    Directory of Open Access Journals (Sweden)

    Kirsten eRead

    2014-02-01

    Full Text Available Rhyme, which is ubiquitous in the language experiences of young children, may be especially facilitative to vocabulary learning because of how it can support active predictions about upcoming words. In two experiments, we tested whether rhyme, when used to help children anticipate new words would make those words easier to learn. Two- to 4-year-old children heard rhyming stanzas naming novel monsters under three conditions: A non-rhyme condition in which novel monster names appeared as unrhymed elements within a rhymed stanza, a non-predictive rhyme condition in which the novel names were the rhymed element in the first line of a stanza, and a predictive rhyme condition in which the monster name came as the rhymed element in the last line of the stanza after a description of the features that distinguished him. In tests of retention and identification children showed greatest novel name learning in the predictive rhyme condition in both between-subjects (Experiment 1 and within-subjects (Experiment 2 comparisons. Additionally, when parents acted as the storybook readers in Experiment 2, many of them distinctly paused before target words in the predictive rhyme condition and for their children a stronger predictive rhyme advantage surfaced. Thus rhyme is not only facilitative for learning, but when the novel vocabulary is specifically in a position where it is predictable from the rhymes, it is most accessible.

  13. An Investigation of the Effects of Different Types of Activities during Pauses in a Segmented Instructional Animation

    Science.gov (United States)

    Cheon, Jongpil; Chung, Sungwon; Crooks, Steven M.; Song, Jaeki; Kim, Jeakyeong

    2014-01-01

    Since the complex and transient information in instructional animations requires more cognitive resources, the segmenting principle has been proposed to reduce cognitive overload by providing smaller chunks with pauses between segments. This study examined the effects of different types of activities during pauses in a segmented animation. Four…

  14. An Investigation of the Effects of Different Types of Activities during Pauses in a Segmented Instructional Animation

    Science.gov (United States)

    Cheon, Jongpil; Chung, Sungwon; Crooks, Steven M.; Song, Jaeki; Kim, Jeakyeong

    2014-01-01

    Since the complex and transient information in instructional animations requires more cognitive resources, the segmenting principle has been proposed to reduce cognitive overload by providing smaller chunks with pauses between segments. This study examined the effects of different types of activities during pauses in a segmented animation. Four…

  15. Pause Time Patterns in Writing Narrative and Expository Texts by Children and Adults

    NARCIS (Netherlands)

    Hell, J.G. van; Verhoeven, L.T.W.; Beijsterveldt, E.M. van

    2008-01-01

    How do beginning and skilled writers compose a text in the course of time? To gain insight into the temporal aspects of planning and translating activities during writing, this article examined writing in real time and analyzed pause time patterns in writing in relation to linguistic characteristics

  16. Writing profiles: the effect of the writing mode on pausing and revision patterns of experienced writers

    NARCIS (Netherlands)

    Van Waes, Luuk; Schellens, Peter Jan

    2003-01-01

    We investigated how writing processes are affected by physical aspects of the task environment, specifically the use of a word processor, with respect to patterns of pausing and revision. Consistent with the tradition of cognitive writing research, the writing processes of experienced writers were e

  17. An Exploratory Study of Pauses in Computer-Assisted EFL Writing

    Science.gov (United States)

    Xu, Cuiqin; Ding, Yanren

    2014-01-01

    The advance of computer input log and screen-recording programs over the last two decades has greatly facilitated research into the writing process in real time. Using Inputlog 4.0 and Camtasia 6.0 to record the writing process of 24 Chinese EFL writers in an argumentative task, this study explored L2 writers' pausing patterns in…

  18. Modified pause schemes and working days for more volume flexibility in manufactering

    NARCIS (Netherlands)

    Rhijn, G.; Looze, M. de; Bosch, T.

    2005-01-01

    The effects of two measures to increase the volume flexibility, namely the introduction of an alternating pause scheme and the elongation of the working day, were evaluated in two manufacturing companies. Both measures led to an increase in volume output of about 16% at relatively low costs. The

  19. Comparison of Pausing Behavior in Children Who Stutter and Children Who Have Asperger Syndrome

    Science.gov (United States)

    Beltrame, Jessica Monique; Viera, Renata Alves Torello; Tamanaha, Ana Carina; Arcuri, Claudia Fassin; Osborn, Ellen; Perissinoto, Jacy; Schiefer, Ana Maria

    2011-01-01

    Purpose: The objective of this research was to compare the number and types of grammatical and non-grammatical silent pauses presented by stutterers and subjects with Asperger syndrome in their narratives. Method: Ten children who stutter and four participants with Asperger syndrome (mean ages of both groups 10 years) were assessed at the Speech…

  20. Cues-Pause-Point Language Training: Teaching Echolalics Functional Use of Their Verbal Labeling Repertoires.

    Science.gov (United States)

    McMorrow, Martin J.; And Others

    1987-01-01

    A cues-pause-point procedure was used to train two severely retarded females to remain quiet before, during, and briefly after the presentation of questions and then to verbalize on the basis of environmental cues whose labels represented the correct responses. Echolalia was rapidly replaced by correct responding on the trained stimuli. (Author/JW)

  1. Impact of Typical Aging and Parkinson's Disease on the Relationship among Breath Pausing, Syntax, and Punctuation

    Science.gov (United States)

    Huber, Jessica E.; Darling, Meghan; Francis, Elaine J.; Zhang, Dabao

    2012-01-01

    Purpose: The present study examines the impact of typical aging and Parkinson's disease (PD) on the relationship among breath pausing, syntax, and punctuation. Method: Thirty young adults, 25 typically aging older adults, and 15 individuals with PD participated. Fifteen participants were age- and sex-matched to the individuals with PD.…

  2. Execution and pauses in writing narratives: processing time, cognitive effort and typing skill.

    Science.gov (United States)

    Alves, Rui Alexandre; Castro, São Luís; Olive, Thierry

    2008-12-01

    At the behavioural level, the activity of a writer can be described as periods of typing separated by pauses. Although some studies have been concerned with the functions of pauses, few have investigated motor execution periods. Precise estimates of the distribution of writing processes, and their cognitive demands, across periods of typing and pauses are lacking. Furthermore, it is uncertain how typing skill affects these aspects of writing. We addressed these issues, selecting writers of low and high typing skill who performed dictation and composition tasks. The occurrences of writing processes were assessed through directed verbalization, and their cognitive demands were measured through interference in reaction times (IRT). Before writing a narrative, 34 undergraduates learned to categorize examples of introspective thoughts as different types of activities related to writing (planning, translating, or revising). Then, while writing, they responded to random auditory probes, and reported their ongoing activity according to the learned categories. Convergent with previous findings, translating was most often reported, and revising and planning had fewer occurrences. Translating was mostly activated during motor execution, whereas revising and planning were mainly activated during pauses. However, none of the writing processes can be characterized as being typical of pauses, since translating was activated to a similar extent as the other two processes. Regarding cognitive demands, revising is likely to be the most demanding process in narrative writing. Typing skill had an impact on IRTs of motor execution. The demands of execution were greater in the low than in the high typing skill group, but these greater demands did not affect the strategy of writing processes activation. Nevertheless, low typing skill had a detrimental impact on text quality.

  3. Profiling Speech and Pausing in Amyotrophic Lateral Sclerosis (ALS and Frontotemporal Dementia (FTD.

    Directory of Open Access Journals (Sweden)

    Yana Yunusova

    Full Text Available This study examines reading aloud in patients with amyotrophic lateral sclerosis (ALS and those with frontotemporal dementia (FTD in order to determine whether differences in patterns of speaking and pausing exist between patients with primary motor vs. primary cognitive-linguistic deficits, and in contrast to healthy controls.136 participants were included in the study: 33 controls, 85 patients with ALS, and 18 patients with either the behavioural variant of FTD (FTD-BV or progressive nonfluent aphasia (FTD-PNFA. Participants with ALS were further divided into 4 non-overlapping subgroups--mild, respiratory, bulbar (with oral-motor deficit and bulbar-respiratory--based on the presence and severity of motor bulbar or respiratory signs. All participants read a passage aloud. Custom-made software was used to perform speech and pause analyses, and this provided measures of speaking and articulatory rates, duration of speech, and number and duration of pauses. These measures were statistically compared in different subgroups of patients.The results revealed clear differences between patient groups and healthy controls on the passage reading task. A speech-based motor function measure (i.e., articulatory rate was able to distinguish patients with bulbar ALS or FTD-PNFA from those with respiratory ALS or FTD-BV. Distinguishing the disordered groups proved challenging based on the pausing measures.This study demonstrated the use of speech measures in the identification of those with an oral-motor deficit, and showed the usefulness of performing a relatively simple reading test to assess speech versus pause behaviors across the ALS-FTD disease continuum. The findings also suggest that motor speech assessment should be performed as part of the diagnostic workup for patients with FTD.

  4. Profiling Speech and Pausing in Amyotrophic Lateral Sclerosis (ALS) and Frontotemporal Dementia (FTD)

    Science.gov (United States)

    Yunusova, Yana; Graham, Naida L.; Shellikeri, Sanjana; Phuong, Kent; Kulkarni, Madhura; Rochon, Elizabeth; Tang-Wai, David F.; Chow, Tiffany W.; Black, Sandra E.; Zinman, Lorne H.; Green, Jordan R.

    2016-01-01

    Objective This study examines reading aloud in patients with amyotrophic lateral sclerosis (ALS) and those with frontotemporal dementia (FTD) in order to determine whether differences in patterns of speaking and pausing exist between patients with primary motor vs. primary cognitive-linguistic deficits, and in contrast to healthy controls. Design 136 participants were included in the study: 33 controls, 85 patients with ALS, and 18 patients with either the behavioural variant of FTD (FTD-BV) or progressive nonfluent aphasia (FTD-PNFA). Participants with ALS were further divided into 4 non-overlapping subgroups—mild, respiratory, bulbar (with oral-motor deficit) and bulbar-respiratory—based on the presence and severity of motor bulbar or respiratory signs. All participants read a passage aloud. Custom-made software was used to perform speech and pause analyses, and this provided measures of speaking and articulatory rates, duration of speech, and number and duration of pauses. These measures were statistically compared in different subgroups of patients. Results The results revealed clear differences between patient groups and healthy controls on the passage reading task. A speech-based motor function measure (i.e., articulatory rate) was able to distinguish patients with bulbar ALS or FTD-PNFA from those with respiratory ALS or FTD-BV. Distinguishing the disordered groups proved challenging based on the pausing measures. Conclusions and Relevance This study demonstrated the use of speech measures in the identification of those with an oral-motor deficit, and showed the usefulness of performing a relatively simple reading test to assess speech versus pause behaviors across the ALS—FTD disease continuum. The findings also suggest that motor speech assessment should be performed as part of the diagnostic workup for patients with FTD. PMID:26789001

  5. The effect of pause time upon the communicative interactions of young people who use augmentative and alternative communication.

    Science.gov (United States)

    Mathis, Hilary; Sutherland, Dean; McAuliffe, Megan

    2011-10-01

    This study investigated the effect of variation in partner-initiated pause time on the expressive communication of young people who use Augmentative and Alternative Communication (AAC). Eight participants aged 8;11-20;08 years (mean 16;02 years) participated in the study. Three pause time conditions (2, 10, and 45 seconds) were trialled during a scripted shared storybook reading task. A total of 27 turn opportunities were provided for participants during the task. Participant interactions were analysed for the percentage of responses made to a turn opportunity, mean length of utterance in words (MLU), percentage of assertive conversational acts made, and the modes of communication used. Findings indicated that participants were more likely to respond to a turn opportunity when their communication partner provided a longer pause time. Additionally, a longer pause time resulted in longer MLUs. Participants did not use more assertive conversational acts and continued to use a variety of communication modes when provided with a longer pause time. Results indicate that increasing pause time is an effective strategy to support the development of expressive communication for young people who use AAC. This suggests the need for professionals providing AAC services to encourage communication partners to provide extended pauses during interactions.

  6. Calcium Imaging Reveals Coordinated Simple Spike Pauses in Populations of Cerebellar Purkinje Cells

    Directory of Open Access Journals (Sweden)

    Jorge E. Ramirez

    2016-12-01

    Full Text Available The brain’s control of movement is thought to involve coordinated activity between cerebellar Purkinje cells. The results reported here demonstrate that somatic Ca2+ imaging is a faithful reporter of Na+-dependent “simple spike” pauses and enables us to optically record changes in firing rates in populations of Purkinje cells in brain slices and in vivo. This simultaneous calcium imaging of populations of Purkinje cells reveals a striking spatial organization of pauses in Purkinje cell activity between neighboring cells. The source of this organization is shown to be the presynaptic gamma-Aminobutyric acid producing (GABAergic network, and blocking ionotropic gamma-Aminobutyric acid receptor (GABAARs abolishes the synchrony. These data suggest that presynaptic interneurons synchronize (inactivity between neighboring Purkinje cells, and thereby maximize their effect on downstream targets in the deep cerebellar nuclei.

  7. RNA polymerase II pausing downstream of core histone genes is different from genes producing polyadenylated transcripts.

    Directory of Open Access Journals (Sweden)

    Krishanpal Anamika

    Full Text Available Recent genome-wide chromatin immunoprecipitation coupled high throughput sequencing (ChIP-seq analyses performed in various eukaryotic organisms, analysed RNA Polymerase II (Pol II pausing around the transcription start sites of genes. In this study we have further investigated genome-wide binding of Pol II downstream of the 3' end of the annotated genes (EAGs by ChIP-seq in human cells. At almost all expressed genes we observed Pol II occupancy downstream of the EAGs suggesting that Pol II pausing 3' from the transcription units is a rather common phenomenon. Downstream of EAGs Pol II transcripts can also be detected by global run-on and sequencing, suggesting the presence of functionally active Pol II. Based on Pol II occupancy downstream of EAGs we could distinguish distinct clusters of Pol II pause patterns. On core histone genes, coding for non-polyadenylated transcripts, Pol II occupancy is quickly dropping after the EAG. In contrast, on genes, whose transcripts undergo polyA tail addition [poly(A(+], Pol II occupancy downstream of the EAGs can be detected up to 4-6 kb. Inhibition of polyadenylation significantly increased Pol II occupancy downstream of EAGs at poly(A(+ genes, but not at the EAGs of core histone genes. The differential genome-wide Pol II occupancy profiles 3' of the EAGs have also been confirmed in mouse embryonic stem (mES cells, indicating that Pol II pauses genome-wide downstream of the EAGs in mammalian cells. Moreover, in mES cells the sharp drop of Pol II signal at the EAG of core histone genes seems to be independent of the phosphorylation status of the C-terminal domain of the large subunit of Pol II. Thus, our study uncovers a potential link between different mRNA 3' end processing mechanisms and consequent Pol II transcription termination processes.

  8. Scalability Performance of MANET Routing Protocols with Reference to Variable Pause Time

    Directory of Open Access Journals (Sweden)

    Asha Ambhaikar

    2010-12-01

    Full Text Available As mobile networking continues to experience increasing popularity, the need to connect large numbers of wireless devices will become more prevalent. Many recent proposals for ad hoc routing have certain characteristics. A mobile ad hoc network is a collection of autonomous mobile nodes that communicate with each other over wireless links. Such networks does play important role in civilian and military settings, being useful for providing communication support where no fixed infrastructure exists or the deployment of a fixed infrastructure is possible. It is a crucial part in the performance evaluation of MANET to select suitable mobility model and routing protocols. Therefore, a number of routing protocols as well as mobility models have been proposed for ad hoc wireless networks based on different scenarios. In this paper, we study and compare the performance of the two reactive routing protocols AODV and DSR with reference to varying Pause Time. For experimental purposes, we have considered increasing Pause Time from 5 sec to 40 sec and illustrate the performance of the routing protocol across Packet Delivery Ratio parameter. Our simulation result shows that both AODV & DSR is performing equally good until the Pause Time cross a certain limit.

  9. Balloon Dilatation of Pediatric Subglottic Laryngeal Stenosis during the Artificial Apneic Pause: Experience in 5 Children

    Directory of Open Access Journals (Sweden)

    J. Lisý

    2014-01-01

    Full Text Available Introduction. Balloon dilatation is a method of choice for treatment of laryngeal stenosis in children. The aim of procedure in apneic pause is to avoid new insertion of tracheostomy cannula. Patients and Methods. The authors performed balloon dilatation of subglottic laryngeal strictures (SGS in 5 children (3 girls and 2 boys without tracheotomy. Two of them with traumatic and inflammatory SGS had a tracheal cannula removed in the past. The other 3 children with postintubation SGS had never had a tracheostomy before. The need for tracheostomy due to worsening stridor was imminent for all of them. Results. The total of seven laryngeal dilatations by balloon esophagoplasty catheter in apneic pause was performed in the 5 children. The procedure averted the need for tracheostomy placement in 4 of them (80%. Failure of dilatation in girl with traumatic stenosis and concomitant severe obstructive lung disease led to repeated tracheostomy. Conclusion. Balloon dilatation of laryngeal stricture could be done in the absence of tracheostomy in apneic pause. Dilatation averted threatening tracheostomy in all except one case. Early complication after the procedure seems to be a negative prognostic factor for the outcome of balloon dilatation.

  10. Putting a Pause in Pain, A personal journey for this teen | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... please turn JavaScript on. Feature: Pain Management Putting a Pause in Pain, A personal journey for this teen Winter 2017 Table ... Northern Kentucky with an extra confidence and bounce. A fan of Chilean poet Pablo Neruda, she's working ...

  11. Tachy-Brady Arrhythmias: The Critical Role of Adenosine-induced Sino-Atrial Conduction Block in Post-Tachycardia Pauses

    Science.gov (United States)

    Lou, Qing; Glukhov, Alexey V.; Hansen, Brian; Hage, Lori; Vargas-Pinto, Pedro; Billman, George E.; Carnes, Cynthia A.; Fedorov, Vadim V.

    2012-01-01

    Background In patients with sinoatrial nodal (SAN) dysfunction, atrial pauses lasting several seconds may follow rapid atrial pacing or paroxysmal tachycardia (tachy-brady arrhythmias). Clinical studies suggest that adenosine may play an important role in SAN dysfunction, but the mechanism remains unclear. Objective To define the mechanism of SAN dysfunction induced by the combination of adenosine and tachycardia. Methods We studied the mechanism of SAN dysfunction produced by a combination of adenosine and rapid atrial pacing in isolated coronary-perfused canine atrial preparations using high-resolution optical mapping (n=9). Sinus cycle length (SCL) and sinoatrial conduction time (SACT) were measured during adenosine (1–100μM) and 1μM DPCPX (A1 receptor antagonist, n=7) perfusion. Sinoatrial node recovery time was measured after one minute of “slow” pacing (3.3Hz) or tachypacing (7–9Hz). Results Adenosine significantly increased SCL (477±62 vs. 778±114 ms, p<0.01), and SACT during sinus rhythm (41±11 vs. 86±16 ms, p<0.01) dose-dependently. Adenosine dramatically affected SACT of the first SAN beat after tachypacing (41±5 vs. 221±98ms, p<0.01). Moreover, at high concentrations of adenosine (10–100μM), termination of tachypacing or atrial flutter/fibrillation produced atrial pauses of 4.2±3.4 seconds (n=5) due to conduction block between the SAN and atria, despite a stable SAN intrinsic rate. Conduction block was preferentially related to depressed excitability in SAN conduction pathways. Adenosine-induced changes were reversible upon washout or DPCPX treatment. Conclusions These data directly demonstrate that adenosine contributes to post-tachycardia atrial pauses through SAN exit block rather than slowed pacemaker automaticity. Thus, these data suggest an important modulatory role of adenosine in tachy-brady syndrome. PMID:22985657

  12. "Pause-2-Play": a pilot schoolbased obesity prevention program "Pause-2-Play": um programa piloto escolar de prevenção de obesidade

    Directory of Open Access Journals (Sweden)

    Gregory Killough

    2010-09-01

    Full Text Available OBJECTIVES: "Pause-2-Play" is an obesity prevention program targeting screen-related sedentary behaviours and increasing physical activity among elementary school students. The program consisted of a Behavioural Modification Curriculum and a Health Promoting Afterschool Program. This pilot study reports program feasibility, practicability, and impact. METHODS: the 12-week pilot program was implemented with 32 grade five and six students. Program feasibility and practicability were assessed using a qualitative approach. Intervention effects were assessed by comparing pre-post changes in BMI, body composition, fitness scores, screen time, and cognitive variables related to screening viewing behaviours. RESULTS: "Pause-2-Play" was perceived as a useful, fun program with numerous benefits including: children trying new snacks, feeling fitter and better about one's own body shape, and becoming more aware of a healthy lifestyle. The intervention resulted in a statistically significant reduction in percent body fat and an increase in fat-free mass index in overweight children; a decrease in waist circumference and an increase in fat-free mass index were observed in normal weight children. The intervention also statistically improved fitness scores in both normal weight and overweight children. CONCLUSIONS: "Pause-2-Play" was feasible, practical, and favourably changed body composition and fitness level.OBJETIVOS: "Pause-2-Play" é um programa de prevenção da obesidade direcionado aos comportamentos sedentários relacionados ao uso de monitores de computador e televisores, visando promover a atividade física entre estudantes de escolas de educação básica. O programa trata-se de um currículo de modificação comportamental e um programa extracurricular de promoção de saúde. Este estudo-piloto relata sobre a viabilidade, praticidade e impacto do programa. MÉTODOS: o programa de doze semanas foi implementado com 32 alunos escolares do quinto e

  13. Transcriptional regulation: effects of promoter proximal pausing on speed, synchrony and reliability.

    Directory of Open Access Journals (Sweden)

    Alistair N Boettiger

    2011-05-01

    Full Text Available Recent whole genome polymerase binding assays in the Drosophila embryo have shown that a substantial proportion of uninduced genes have pre-assembled RNA polymerase-II transcription initiation complex (PIC bound to their promoters. These constitute a subset of promoter proximally paused genes for which mRNA elongation instead of promoter access is regulated. This difference can be described as a rearrangement of the regulatory topology to control the downstream transcriptional process of elongation rather than the upstream transcriptional initiation event. It has been shown experimentally that genes with the former mode of regulation tend to induce faster and more synchronously, and that promoter-proximal pausing is observed mainly in metazoans, in accord with a posited impact on synchrony. However, it has not been shown whether or not it is the change in the regulated step per se that is causal. We investigate this question by proposing and analyzing a continuous-time Markov chain model of PIC assembly regulated at one of two steps: initial polymerase association with DNA, or release from a paused, transcribing state. Our analysis demonstrates that, over a wide range of physical parameters, increased speed and synchrony are functional consequences of elongation control. Further, we make new predictions about the effect of elongation regulation on the consistent control of total transcript number between cells. We also identify which elements in the transcription induction pathway are most sensitive to molecular noise and thus possibly the most evolutionarily constrained. Our methods produce symbolic expressions for quantities of interest with reasonable computational effort and they can be used to explore the interplay between interaction topology and molecular noise in a broader class of biochemical networks. We provide general-purpose code implementing these methods.

  14. Effects of active pause pattern of surface electromyographic activity among subjects performing monotonous tasks: A systematic review.

    Science.gov (United States)

    Januario, Leticia Bergamin; Moreira, Roberta de Fátima Carreira; Cid, Marina Machado; Samani, Afshin; Madeleine, Pascal; Oliveira, Ana Beatriz

    2016-10-01

    Active pauses have shown potentially beneficial effects to increase the variability of the electrical activation pattern of muscles. However, there is a lack of consensus as to how to design and implement those pauses and the processing methods of surface electromyography (EMG) data when evaluating low-level monotonous tasks. The aim of this systematic review was to synthesize the evidences regarding the way which active pauses have been applied, and the methods used to investigate the related EMG changes. PubMed-MEDLINE, Embase, Web of Science, Lilacs, Ebsco, and Scopus databases were searched. Two authors independently extracted data from the primary studies. The methodological quality was assessed using a list from van der Windt et al. (2000), and the level of evidence was synthesized through GRADE. The ISEK guideline for reporting EMG data was also applied as a checklist. Fifteen studies were included - 14 with high methodological quality. In general, active pauses were able to change the level of EMG activity in monotonous tasks. The level of evidence through GRADE was very low for all EMG processing methods, except RMS which was low. A vast heterogeneity concerning the methods applied to analyze EMG data contributed to decrease the quality of evidence synthesis, and the findings need to be carefully considered. The GRADE approach and the ISEK guideline contributed to identify important flaws in the literature. Future studies investigating active pauses in longitudinal studies and following the standard for recording and reporting EMG data care are warranted.

  15. Analog self-powered harvester achieving switching pause control to increase harvested energy

    Science.gov (United States)

    Makihara, Kanjuro; Asahina, Kei

    2017-05-01

    In this paper, we propose a self-powered analog controller circuit to increase the efficiency of electrical energy harvesting from vibrational energy using piezoelectric materials. Although the existing synchronized switch harvesting on inductor (SSHI) method is designed to produce efficient harvesting, its switching operation generates a vibration-suppression effect that reduces the harvested levels of electrical energy. To solve this problem, the authors proposed—in a previous paper—a switching method that takes this vibration-suppression effect into account. This method temporarily pauses the switching operation, allowing the recovery of the mechanical displacement and, therefore, of the piezoelectric voltage. In this paper, we propose a self-powered analog circuit to implement this switching control method. Self-powered vibration harvesting is achieved in this study by attaching a newly designed circuit to an existing analog controller for SSHI. This circuit aims to effectively implement the aforementioned new switching control strategy, where switching is paused in some vibration peaks, in order to allow motion recovery and a consequent increase in the harvested energy. Harvesting experiments performed using the proposed circuit reveal that the proposed method can increase the energy stored in the storage capacitor by a factor of 8.5 relative to the conventional SSHI circuit. This proposed technique is useful to increase the harvested energy especially for piezoelectric systems having large coupling factor.

  16. A Pause-then-Cancel model of stopping: evidence from basal ganglia neurophysiology.

    Science.gov (United States)

    Schmidt, Robert; Berke, Joshua D

    2017-04-19

    Many studies have implicated the basal ganglia in the suppression of action impulses ('stopping'). Here, we discuss recent neurophysiological evidence that distinct hypothesized processes involved in action preparation and cancellation can be mapped onto distinct basal ganglia cell types and pathways. We examine how movement-related activity in the striatum is related to a 'Go' process and how going may be modulated by brief epochs of beta oscillations. We then describe how, rather than a unitary 'Stop' process, there appear to be separate, complementary 'Pause' and 'Cancel' mechanisms. We discuss the implications of these stopping subprocesses for the interpretation of the stop-signal reaction time-in particular, some activity that seems too slow to causally contribute to stopping when assuming a single Stop processes may actually be fast enough under a Pause-then-Cancel model. Finally, we suggest that combining complementary neural mechanisms that emphasize speed or accuracy respectively may serve more generally to optimize speed-accuracy trade-offs.This article is part of the themed issue 'Movement suppression: brain mechanisms for stopping and stillness'.

  17. Manipulation of KLF4 Expression Generates iPSCs Paused at Successive Stages of Reprogramming

    Directory of Open Access Journals (Sweden)

    Ken Nishimura

    2014-11-01

    Full Text Available The detailed mechanism of reprogramming somatic cells into induced pluripotent stem cells (iPSCs remains largely unknown. Partially reprogrammed iPSCs are informative and useful for understanding the mechanism of reprogramming but remain technically difficult to generate in a predictable and reproducible manner. Using replication-defective and persistent Sendai virus (SeVdp vectors, we analyzed the effect of decreasing the expression levels of OCT4, SOX2, KLF4, and c-MYC and found that low KLF4 expression reproducibly gives rise to a homogeneous population of partially reprogrammed iPSCs. Upregulation of KLF4 allows these cells to resume reprogramming, indicating that they are paused iPSCs that remain on the path toward pluripotency. Paused iPSCs with different KLF4 expression levels remain at distinct intermediate stages of reprogramming. This SeVdp-based stage-specific reprogramming system (3S reprogramming system is applicable for both mouse and human somatic cells and will facilitate the mechanistic analysis of reprogramming.

  18. Elongation Factor P Interactions with the Ribosome Are Independent of Pausing.

    Science.gov (United States)

    Tollerson, Rodney; Witzky, Anne; Ibba, Michael

    2017-08-01

    Bacterial elongation factor P (EF-P) plays a pivotal role in the translation of polyproline motifs. To stimulate peptide bond formation, EF-P must enter the ribosome via an empty E-site. Using fluorescence-based single-molecule tracking, Mohapatra et al. (S. Mohapatra, H. Choi, X. Ge, S. Sanyal, and J. C. Weisshaar, mBio 8:e00300-17, 2017, https://doi.org/10.1128/mBio.00300-17) monitored the cellular distribution of EF-P and quantified the frequency of association between EF-P and the ribosome under various conditions. Findings from the study showed that EF-P has a localization pattern that is strikingly similar to that of ribosomes. Intriguingly, EF-P was seen to bind ribosomes more frequently than the estimated number of pausing events, indicating that E-site vacancies occur even when ribosomes are not paused. The study provides new insights into the mechanism of EF-P-dependent peptide bond formation and the intricacies of translation elongation. Copyright © 2017 Tollerson et al.

  19. Recent pause in the growth rate of atmospheric CO2 due to enhanced terrestrial carbon uptake

    Science.gov (United States)

    Keenan, Trevor F.; Prentice, I. Colin; Canadell, Josep G.; Williams, Christopher A.; Wang, Han; Raupach, Michael; Collatz, G. James

    2016-11-01

    Terrestrial ecosystems play a significant role in the global carbon cycle and offset a large fraction of anthropogenic CO2 emissions. The terrestrial carbon sink is increasing, yet the mechanisms responsible for its enhancement, and implications for the growth rate of atmospheric CO2, remain unclear. Here using global carbon budget estimates, ground, atmospheric and satellite observations, and multiple global vegetation models, we report a recent pause in the growth rate of atmospheric CO2, and a decline in the fraction of anthropogenic emissions that remain in the atmosphere, despite increasing anthropogenic emissions. We attribute the observed decline to increases in the terrestrial sink during the past decade, associated with the effects of rising atmospheric CO2 on vegetation and the slowdown in the rate of warming on global respiration. The pause in the atmospheric CO2 growth rate provides further evidence of the roles of CO2 fertilization and warming-induced respiration, and highlights the need to protect both existing carbon stocks and regions, where the sink is growing rapidly.

  20. Using mechanical force to probe the mechanism of pausing and arrest during continuous elongation by Escherichia coli RNA polymerase

    Science.gov (United States)

    Forde, Nancy R.; Izhaky, David; Woodcock, Glenna R.; Wuite, Gijs J. L.; Bustamante, Carlos

    2002-09-01

    Escherichia coli RNA polymerase translocates along the DNA discontinuously during the elongation phase of transcription, spending proportionally more time at some template positions, known as pause and arrest sites, than at others. Current models of elongation suggest that the enzyme backtracks at these locations, but the dynamics are unresolved. Here, we study the role of lateral displacement in pausing and arrest by applying force to individually transcribing molecules. We find that an assisting mechanical force does not alter the translocation rate of the enzyme, but does reduce the efficiency of both pausing and arrest. Moreover, arrested molecules cannot be rescued by force, suggesting that arrest occurs by a bipartite mechanism: the enzyme backtracks along the DNA followed by a conformational change of the ternary complex (RNA polymerase, DNA and transcript), which cannot be reversed mechanically.

  1. The effect of filled pauses on the processing of the surface form and the establishment of causal connections during the comprehension of spoken expository discourse.

    Science.gov (United States)

    Cevasco, Jazmín; van den Broek, Paul

    2016-05-01

    The purpose of this study was to examine the effect of filled pauses (uh) on the verification of words and the establishment of causal connections during the comprehension of spoken expository discourse. With this aim, we asked Spanish-speaking students to listen to excerpts of interviews with writers, and to perform a word-verification task and a question-answering task on causal connectivity. There were two versions of the excerpts: filled pause present and filled pause absent. Results indicated that filled pauses increased verification times for words that preceded them, but did not make a difference on response times to questions on causal connectivity. The results suggest that, as signals of delay, filled pauses create a break with surface information, but they do not have the same effect on the establishment of meaningful connections.

  2. Ventral tegmental area GABA projections pause accumbal cholinergic interneurons to enhance associative learning.

    Science.gov (United States)

    Brown, Matthew T C; Tan, Kelly R; O'Connor, Eoin C; Nikonenko, Irina; Muller, Dominique; Lüscher, Christian

    2012-12-20

    The ventral tegmental area (VTA) and nucleus accumbens (NAc) are essential for learning about environmental stimuli associated with motivationally relevant outcomes. The task of signalling such events, both rewarding and aversive, from the VTA to the NAc has largely been ascribed to dopamine neurons. The VTA also contains GABA (γ-aminobutyric acid)-releasing neurons, which provide local inhibition and also project to the NAc. However, the cellular targets and functional importance of this long-range inhibitory projection have not been ascertained. Here we show that GABA-releasing neurons of the VTA that project to the NAc (VTA GABA projection neurons) inhibit accumbal cholinergic interneurons (CINs) to enhance stimulus-outcome learning. Combining optogenetics with structural imaging and electrophysiology, we found that VTA GABA projection neurons selectively target NAc CINs, forming multiple symmetrical synaptic contacts that generated inhibitory postsynaptic currents. This is remarkable considering that CINs represent a very small population of all accumbal neurons, and provide the primary source of cholinergic tone in the NAc. Brief activation of this projection was sufficient to halt the spontaneous activity of NAc CINs, resembling the pause recorded in animals learning stimulus-outcome associations. Indeed, we found that forcing CINs to pause in behaving mice enhanced discrimination of a motivationally important stimulus that had been associated with an aversive outcome. Our results demonstrate that VTA GABA projection neurons, through their selective targeting of accumbal CINs, provide a novel route through which the VTA communicates saliency to the NAc. VTA GABA projection neurons thus emerge as orchestrators of dopaminergic and cholinergic modulation in the NAc.

  3. An Investigation of Read Speech of Arabic Students Learning Turkish as a Second Language in Terms of Stress and Pause

    Science.gov (United States)

    Derman, Serdar; Bardakçi, Mehmet; Öztürk, Mustafa Serkan

    2017-01-01

    Suprasegmental features are essential in conveying meaning; however, they are one of the neglected topics in teaching Turkish as a foreign/second language. This paper aims to examine read speech by Arabic students learning Turkish as a second language and describe their read speech in terms of stress and pause. Within this framework, 34 Syrian…

  4. A Diagnostic Marker to Discriminate Childhood Apraxia of Speech from Speech Delay: IV. the Pause Marker Index

    Science.gov (United States)

    Shriberg, Lawrence D.; Strand, Edythe A.; Fourakis, Marios; Jakielski, Kathy J.; Hall, Sheryl D.; Karlsson, Heather B.; Mabie, Heather L.; McSweeny, Jane L.; Tilkens, Christie M.; Wilson, David L.

    2017-01-01

    Purpose: Three previous articles provided rationale, methods, and several forms of validity support for a diagnostic marker of childhood apraxia of speech (CAS), termed the pause marker (PM). Goals of the present article were to assess the validity and stability of the PM Index (PMI) to scale CAS severity. Method: PM scores and speech, prosody,…

  5. Interventions for Echolalic Behaviour for Children with Autism: A Review of Verbal Prompts and the Cues Pause Point Procedure.

    Science.gov (United States)

    Kavon, Nicole M.; McLaughlin, T. F.

    1995-01-01

    This paper examines behavior interventions for echolalic behavior in children with autism, including verbal prompting (focusing on the echolalic behavior itself) and the cues-pause-point procedure (which employs the child's prerequisite skills to teach correct verbal responses). A review of the literature indicated that both techniques were…

  6. Speech and Pause Characteristics Associated with Voluntary Rate Reduction in Parkinson’s disease and Multiple Sclerosis

    Science.gov (United States)

    Tjaden, Kris; Wilding, Greg

    2011-01-01

    The primary purpose of this study was to investigate how speakers with Parkinson’s disease (PD) and Multiple Sclerosis (MS) accomplish voluntary reductions in speech rate. A group of talkers with no history of neurological disease was included for comparison. This study was motivated by the idea that knowledge of how speakers with dysarthria voluntarily accomplish a reduced speech rate would contribute toward a descriptive model of speaking rate change in dysarthria. Such a model has the potential to assist in identifying rate control strategies to receive focus in clinical treatment programs and also would advance understanding of global speech timing in dysarthria. All speakers read a passage in Habitual and Slow conditions. Speech rate, articulation rate, pause duration, and pause frequency were measured. All speaker groups adjusted articulation time as well as pause time to reduce overall speech rate. Group differences in how voluntary rate reduction was accomplished were primarily one of quantity or degree. Overall, a slower-than-normal rate was associated with a reduced articulation rate, shorter speech runs that included fewer syllables, and longer more frequent pauses. Taken together, these results suggest that existing skills or strategies used by patients should be emphasized in dysarthria training programs focusing on rate reduction. Results further suggest that a model of voluntary speech rate reduction based on neurologically normal speech shows promise as being applicable for mild to moderate dysarthria. PMID:21767851

  7. Ethnic classification in primary dental care and dental health services research: time to pause for thought.

    Science.gov (United States)

    Buck, D J; Malik, S; Murphy, N; Patel, V; Singh, S; Syed, B; Vora, N

    2001-04-01

    'Ethnicity' is an important concept in dental health services research and in enabling general dental practitioners to gain insight into their patients values and expectations. Since more health services research is being undertaken in primary dental care settings it is becoming an important issue for dental professionals and researchers in primary care to be aware of. Ethnicity is thought to be related to dental health inequalities and access and is often used as a stratifying variable in many dental studies. The meaning and use of the term however differs among researchers and among the public. It is clear that researchers and professionals need to pause for thought when considering what this often bandied about term actually means and the impact of different definitions. This is illustrated using examples from the authors' own research and published papers in the medical and dental literature. There is also much debate about whether ethnicity--however defined--is an important predictor of differences in dental health in itself or is merely a marker for other factors such as social deprivation or the impact of 'place' on dental health. While the jury on this debate is out we suggest guidelines on the reporting of ethnicity should be outlined in the dental literature--perhaps updating those published in 1996 in the British Medical Journal.

  8. Getting from how to why: a pause for reflection on professional life.

    Science.gov (United States)

    McEntyre, M C

    1997-12-01

    In the course of institutional life, many may lose their sense of purpose. The daily demands of both medicine and teaching--small defeats, time pressures, bureaucratic obstacles, and chronic overload--can erode the sense of purpose and clarity of desire that infuse work with spirit and energy. One antidote for this drained state is time for renewal--not long periods of rest and relaxation, valuable though these may be, but rather a "particular kind of stopping . . . the pause for a poem." The author describes how stopping in the middle of the day to read and reflect on a poem can defamiliarize the familiar, giving the reader a fresh outlook on the ordinary day. She describes how poetry also can awaken a sense of play, a childlike openness and sense of curiosity, and a renewed awareness of feelings. To honor feeling can provide a needed corrective to the conventionalized response that has become thoughtless or bloodless or tired. The kind of play poems engage readers in can also provide a connection to the sacred, restoring the wider vision and deeper purposes without which the practice of medicine might diminish to something less lifegiving for both patient and physician than it ought to be. In her discussion of the restorative power of poetry, the author quotes several poems in full and invites readers to consider the fresh perspectives they offer.

  9. Filled pause refinement based on the pronunciation probability for lecture speech.

    Science.gov (United States)

    Long, Yan-Hua; Ye, Hong

    2015-01-01

    Nowadays, although automatic speech recognition has become quite proficient in recognizing or transcribing well-prepared fluent speech, the transcription of speech that contains many disfluencies remains problematic, such as spontaneous conversational and lecture speech. Filled pauses (FPs) are the most frequently occurring disfluencies in this type of speech. Most recent studies have shown that FPs are widely believed to increase the error rates for state-of-the-art speech transcription, primarily because most FPs are not well annotated or provided in training data transcriptions and because of the similarities in acoustic characteristics between FPs and some common non-content words. To enhance the speech transcription system, we propose a new automatic refinement approach to detect FPs in British English lecture speech transcription. This approach combines the pronunciation probabilities for each word in the dictionary and acoustic language model scores for FP refinement through a modified speech recognition forced-alignment framework. We evaluate the proposed approach on the Reith Lectures speech transcription task, in which only imperfect training transcriptions are available. Successful results are achieved for both the development and evaluation datasets. Acoustic models trained on different styles of speech genres have been investigated with respect to FP refinement. To further validate the effectiveness of the proposed approach, speech transcription performance has also been examined using systems built on training data transcriptions with and without FP refinement.

  10. Genome-wide chromatin occupancy analysis reveals a role for ASH2 in transcriptional pausing.

    Science.gov (United States)

    Pérez-Lluch, Sílvia; Blanco, Enrique; Carbonell, Albert; Raha, Debasish; Snyder, Michael; Serras, Florenci; Corominas, Montserrat

    2011-06-01

    An important mechanism for gene regulation involves chromatin changes via histone modification. One such modification is histone H3 lysine 4 trimethylation (H3K4me3), which requires histone methyltranferase complexes (HMT) containing the trithorax-group (trxG) protein ASH2. Mutations in ash2 cause a variety of pattern formation defects in the Drosophila wing. We have identified genome-wide binding of ASH2 in wing imaginal discs using chromatin immunoprecipitation combined with sequencing (ChIP-Seq). Our results show that genes with functions in development and transcriptional regulation are activated by ASH2 via H3K4 trimethylation in nearby nucleosomes. We have characterized the occupancy of phosphorylated forms of RNA Polymerase II and histone marks associated with activation and repression of transcription. ASH2 occupancy correlates with phosphorylated forms of RNA Polymerase II and histone activating marks in expressed genes. Additionally, RNA Polymerase II phosphorylation on serine 5 and H3K4me3 are reduced in ash2 mutants in comparison to wild-type flies. Finally, we have identified specific motifs associated with ASH2 binding in genes that are differentially expressed in ash2 mutants. Our data suggest that recruitment of the ASH2-containing HMT complexes is context specific and points to a function of ASH2 and H3K4me3 in transcriptional pausing control.

  11. Performance Evaluation of Aodv&DSR with Varying Pause Time & Node Density Over TCP&CBR Connections in Vanet

    CERN Document Server

    Paul, Bijan; Bikas, Md Abu Naser

    2012-01-01

    Vehicular ad hoc network is formed by cars which are called nodes; allow them to communicate with one another without using any fixed road side unit. It has some unique characteristics which make it different from other ad hoc network as well as difficult to define any exact mobility model and routing protocols because of their high mobility and changing mobility pattern. Hence performance of routing protocols can vary with the various parameters such as speed, pause time, node density and traffic scenarios. In this research paper, the performance of two on-demand routing protocols AODV & DSR has been analyzed by means of packet delivery ratio, loss packet ratio & average end-to-end delay with varying pause time and node density under TCP & CBR connection.

  12. Performance Evaluation of AODV & DSR with Varying Pause Time & Speed Time Over TCP & CBR Connections in VANET

    CERN Document Server

    Paul, Bijan; Bikas, Md Abu Naser

    2012-01-01

    VANET (Vehicular Ad-hoc Network) is a new technology which has taken enormous attention in the recent years. Vehicular ad hoc network is formed by cars which are called nodes; allow them to communicate with one another without using any fixed road side unit. It has some unique characteristics which make it different from other ad hoc network as well as difficult to define any exact mobility model and routing protocols because of their high mobility and changing mobility pattern. Hence performance of routing protocols can vary with the various parameters such as speed, pause time, node density and traffic scenarios. In this research paper, the performance of two on-demand routing protocols AODV & DSR has been analyzed by means of packet delivery ratio, loss packet ratio & average end-to-end delay with varying pause time, speed time and node density under TCP & CBR connection.

  13. Pausing and activating thread state upon pin assertion by external logic monitoring polling loop exit time condition

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Dong; Giampapa, Mark; Heidelberger, Philip; Ohmacht, Martin; Satterfield, David L; Steinmacher-Burow, Burkhard; Sugavanam, Krishnan

    2013-05-21

    A system and method for enhancing performance of a computer which includes a computer system including a data storage device. The computer system includes a program stored in the data storage device and steps of the program are executed by a processer. The processor processes instructions from the program. A wait state in the processor waits for receiving specified data. A thread in the processor has a pause state wherein the processor waits for specified data. A pin in the processor initiates a return to an active state from the pause state for the thread. A logic circuit is external to the processor, and the logic circuit is configured to detect a specified condition. The pin initiates a return to the active state of the thread when the specified condition is detected using the logic circuit.

  14. Adolescent girls in Denmark use oral contraceptives at an increasingly young age, and with more pauses and shifts

    DEFF Research Database (Denmark)

    Løkkegaard, Ellen; Nielsen, Anne Kristine

    2014-01-01

    , adolescent girls have more pauses and shifts between types of hormonal contraceptives. Since 2010 there has been a shift toward use of second generation oral contraceptives away from third and fourth generation contraceptives. CONCLUSION: Adolescent girls tend to initiate their use of oral contraceptives...... at a younger age than the older cohorts do. Furthermore, they have more pauses and shift between products more frequently than older cohorts. The type of oral contraceptive used has shifted since 2010 towards older products with second generation progestins. FUNDING: The study was funded by salaries from North......INTRODUCTION: Use of hormonal contraceptives for birth control is commonplace in the Western World. In Europe, there is considerable variety in the frequency of use of hormonal contraceptives and in the age at which these contraceptives are initiated. The purpose of the present study...

  15. Performance Evaluation of AODV and DSR with Varying Pause Time and Speed Time Over TCP and CBR Connections in VANET

    Directory of Open Access Journals (Sweden)

    Bijan Paul

    2012-01-01

    Full Text Available VANET (Vehicular Ad-hoc Network is a new technology which has taken enormous attention in the recent years. Vehicular ad hoc network is formed by cars which are called nodes; allow them to communicate with one another without using any fixed road side unit. It has some unique characteristics which make it different from other ad-hoc network as well as difficult to define any exact mobility model and routing protocols because of their high mobility and changing mobility pattern. Hence performance of routing protocols can vary with the various parameters such as speed, pause time, node density and traffic scenarios. In this research paper, the performance of two on-demand routing protocols AODV and DSR has been analyzed by means of packet delivery ratio, loss packet ratio average end-to-end delay with varying pause time, speed time and node density under TCP and CBR connection.

  16. Guanosine tetraphosphate as a global regulator of bacterial RNA synthesis: a model involving RNA polymerase pausing and queuing.

    Science.gov (United States)

    Bremer, H; Ehrenberg, M

    1995-05-17

    A recently reported comparison of stable RNA (rRNA, tRNA) and mRNA synthesis rates in ppGpp-synthesizing and ppGpp-deficient (delta relA delta spoT) bacteria has suggested that ppGpp inhibits transcription initiation from stable RNA promoters, as well as synthesis of (bulk) mRNA. Inhibition of stable RNA synthesis occurs mainly during slow growth of bacteria when cytoplasmic levels of ppGpp are high. In contrast, inhibition of mRNA occurs mainly during fast growth when ppGpp levels are low, and it is associated with a partial inactivation of RNA polymerase. To explain these observations it has been proposed that ppGpp causes transcriptional pausing and queuing during the synthesis of mRNA. Polymerase queuing requires high rates of transcription initiation in addition to polymerase pausing, and therefore high concentrations of free RNA polymerase. These conditions are found in fast growing bacteria. Furthermore, the RNA polymerase queues lead to a promoter blocking when RNA polymerase molecules stack up from the pause site back to the (mRNA) promoter. This occurs most frequently at pause sites close to the promoter. Blocking of mRNA promoters diverts RNA polymerase to stable RNA promoters. In this manner ppGpp could indirectly stimulate synthesis of stable RNA at high growth rates. In the present work a mathematical analysis, based on the theory of queuing, is presented and applied to the global control of transcription in bacteria. This model predicts the in vivo distribution of RNA polymerase over stable RNA and mRNA genes for both ppGpp-synthesizing and ppGpp-deficient bacteria in response to different environmental conditions. It also shows how small changes in basal ppGpp concentrations can produce large changes in the rate of stable RNA synthesis.

  17. Dwell-Time Distribution, Long Pausing and Arrest of Single-Ribosome Translation through the mRNA Duplex

    Directory of Open Access Journals (Sweden)

    Ping Xie

    2015-10-01

    Full Text Available Proteins in the cell are synthesized by a ribosome translating the genetic information encoded on the single-stranded messenger RNA (mRNA. It has been shown that the ribosome can also translate through the duplex region of the mRNA by unwinding the duplex. Here, based on our proposed model of the ribosome translation through the mRNA duplex we study theoretically the distribution of dwell times of the ribosome translation through the mRNA duplex under the effect of a pulling force externally applied to the ends of the mRNA to unzip the duplex. We provide quantitative explanations of the available single molecule experimental data on the distribution of dwell times with both short and long durations, on rescuing of the long paused ribosomes by raising the pulling force to unzip the duplex, on translational arrests induced by the mRNA duplex and Shine-Dalgarno(SD-like sequence in the mRNA. The functional consequences of the pauses or arrests caused by the mRNA duplex and the SD sequence are discussed and compared with those obtained from other types of pausing, such as those induced by “hungry” codons or interactions of specific sequences in the nascent chain with the ribosomal exit tunnel.

  18. TbRGG2 facilitates kinetoplastid RNA editing initiation and progression past intrinsic pause sites.

    Science.gov (United States)

    Ammerman, Michelle L; Presnyak, Vladimir; Fisk, John C; Foda, Bardees M; Read, Laurie K

    2010-11-01

    TbRGG2 is an essential kinetoplastid RNA editing accessory factor that acts specifically on pan-edited RNAs. To understand the mechanism of TbRGG2 action, we undertook an in-depth analysis of edited RNA populations in TbRGG2 knockdown cells and an in vitro examination of the biochemical activities of the protein. We demonstrate that TbRGG2 down-regulation more severely impacts editing at the 5' ends of pan-edited RNAs than at their 3' ends. The initiation of editing is reduced to some extent in TbRGG2 knockdown cells. In addition, TbRGG2 plays a post-initiation role as editing becomes stalled in TbRGG2-depleted cells, resulting in an overall decrease in the 3' to 5' progression of editing. Detailed analyses of edited RNAs from wild-type and TbRGG2-depleted cells reveal that TbRGG2 facilitates progression of editing past intrinsic pause sites that often correspond to the 3' ends of cognate guide RNAs (gRNAs). In addition, noncanonically edited junction regions are either absent or significantly shortened in TbRGG2-depleted cells, consistent with impaired gRNA transitions. Sequence analysis further suggests that TbRGG2 facilitates complete utilization of certain gRNAs. In vitro RNA annealing and in vivo RNA unwinding assays demonstrate that TbRGG2 can modulate RNA-RNA interactions. Collectively, these data are consistent with a model in which TbRGG2 facilitates initiation and 3' to 5' progression of editing through its ability to affect gRNA utilization, both during the transition between specific gRNAs and during usage of certain gRNAs.

  19. Effect of growth hormone on steroid concentrations and mRNA expression of their receptor, and selected egg-specific protein genes in the chicken oviduct during pause in laying induced by fasting.

    Science.gov (United States)

    Socha, J K; Sechman, A; Mika, M; Hrabia, A

    2017-10-01

    This study was undertaken to examine the effect of growth hormone (GH) treatment during pause in laying on (1) the concentration of steroids in blood plasma and oviduct tissues, (2) the expression of mRNA of steroid receptors, and (3) the mRNA expression of selected egg-specific proteins in the chicken oviduct. A pause in egg laying was induced by food deprivation for 5 d, followed by feeding every other day, and then feeding daily from Day 10 onward. Birds were divided into three groups: control (n = 18) fed ad libitum, subjected to pause in laying (n = 18), and subjected to pause in laying and injected every day with 200 μg/kg BW of chicken GH (chGH; n = 18). The oviduct was isolated from hens of each group on Days 6 (when the oviduct was regressed), 13 (during oviduct recrudescence), and 17 or 20 (rejuvenated oviduct) of the experiment. Fasting caused a decrease in plasma concentrations of progesterone (P4), testosterone, and estradiol on Day 6 and a reduction in tissue concentrations of these steroids on Days 6 and 13. Fasting also caused an increased relative expression of estrogen receptor α and β (ERα, ERβ) and progesterone receptor (PR) in the magnum and shell gland on Day 6, increased ERα and PR in the magnum on Days 13 and 17 or 20, and increased androgen receptor (AR) mRNA in the magnum on Days 6 and 13 and in the shell gland on Day 13. A fasting-induced elevation in ovocalyxin-36 mRNA expression on Day 6 and a decrease in avidin mRNA on Days 6 and 13 and in ovocleidin-116 on Day 13 were also observed (P avidin in the magnum on Day 6, and ERα in the shell gland on Day 13. The gene expression of ovalbumin on Days 6 and 13, ovocalyxin-36 and ovocleidin-116 on Day 6 was decreased in chGH-treated chickens. In contrast, the expression of ovalbumin on Day 17 or 20 was increased (P egg proteins indicate that GH might be the regulator of the secretory activity of the hen oviduct. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Effect of preceding inspiratory speed and end-inspiratory pause on forced expiratory manoeuvre in healthy subjects and chronic obstructive pulmonary disease patients.

    Science.gov (United States)

    Boni, Enrico; Chiari, Stefania; Trigiani, Marco; Gatta, Diego; Pini, Laura; Tantucci, Claudio

    2009-01-01

    Lower peak expiratory flow (PEF) and forced expiratory volume in 1 s (FEV(1)) have been consistently found after slow inspiration with end-inspiratory pause (EIP). It was the aim of this study to establish the respective influence of the speed of preceding inspiration (SPI) and EIP on the parameters obtained from the following expiratory forced vital capacity (FVC) manoeuvre. In 8 healthy subjects and 12 patients with chronic obstructive pulmonary disease (COPD), a number of inspirations with different SPI and EIP were performed. In the subsequent FVC manoeuvre, maximal expiratory flows, including PEF, and maximal expired volumes at different times, including FEV(1), were measured. For each FVC manoeuvre, peak expiratory time, expired volume at PEF (as % of FVC), flow limitation by the negative expiratory pressure technique and FVC were checked to be sure of achieving a similar expiratory effort and starting inflation lung volume. The highest values of PEF and FEV(1) were found in normal subjects and COPD patients after fastest SPI without EIP (p 2 s) without EIP were followed by lower PEF in COPD patients (p COPD patients (p COPD patients, unless SPI is too slow (inspiratory time >2 s), while any EIP decreases these indices in all individuals. (c) 2009 S. Karger AG, Basel.

  1. Mutational Pressure in Zika Virus: Local ADAR-Editing Areas Associated with Pauses in Translation and Replication

    Science.gov (United States)

    Khrustalev, Vladislav V.; Khrustaleva, Tatyana A.; Sharma, Nitin; Giri, Rajanish

    2017-01-01

    Zika virus (ZIKV) spread led to the recent medical health emergency of international concern. Understanding the variations in virus system is of utmost need. Using available complete sequences of ZIKV we estimated directions of mutational pressure along the length of consensus sequences of three lineages of the virus. Results showed that guanine usage is growing in ZIKV RNA plus strand due to adenine to guanine transitions, while adenine usage is growing due to cytosine to adenine transversions. Especially high levels of guanine have been found in two-fold degenerated sites of certain areas of RNA plus strand with high amount of secondary structure. The usage of cytosine in two-fold degenerated sites shows direct dependence on the amount of secondary structure in 52% (consensus sequence of East African ZIKV lineage)—32% (consensus sequence of epidemic strains) of the length of RNA minus strand. These facts are the evidences of ADAR-editing of both strands of ZIKV genome during pauses in replication. RNA plus strand can also be edited by ADAR during pauses in translation caused by the appearance of groups of rare codons. According to our results, RNA minus strand of epidemic ZIKV strain has lower number of points in which polymerase can be stalled (allowing ADAR-editing) compared to other strains. The data on preferable directions of mutational pressure in epidemic ZIKV strain is useful for future vaccine development and understanding the evolution of new strains. PMID:28275585

  2. Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.

    Science.gov (United States)

    Sydow, Jasmin F; Brueckner, Florian; Cheung, Alan C M; Damsma, Gerke E; Dengl, Stefan; Lehmann, Elisabeth; Vassylyev, Dmitry; Cramer, Patrick

    2009-06-26

    We show that RNA polymerase (Pol) II prevents erroneous transcription in vitro with different strategies that depend on the type of DNARNA base mismatch. Certain mismatches are efficiently formed but impair RNA extension. Other mismatches allow for RNA extension but are inefficiently formed and efficiently proofread by RNA cleavage. X-ray analysis reveals that a TU mismatch impairs RNA extension by forming a wobble base pair at the Pol II active center that dissociates the catalytic metal ion and misaligns the RNA 3' end. The mismatch can also stabilize a paused state of Pol II with a frayed RNA 3' nucleotide. The frayed nucleotide binds in the Pol II pore either parallel or perpendicular to the DNA-RNA hybrid axis (fraying sites I and II, respectively) and overlaps the nucleoside triphosphate (NTP) site, explaining how it halts transcription during proofreading, before backtracking and RNA cleavage.

  3. GSK3β is involved in the relief of mitochondria pausing in a Tau-dependent manner.

    Directory of Open Access Journals (Sweden)

    María Llorens-Martín

    Full Text Available Mitochondrial trafficking deficits have been implicated in the pathogenesis of several neurological diseases, including Alzheimer's disease (AD. The Ser/Thre kinase GSK3β is believed to play a fundamental role in AD pathogenesis. Given that GSK3β substrates include Tau protein, here we studied the impact of GSK3β on mitochondrial trafficking and its dependence on Tau protein. Overexpression of GSK3β in neurons resulted in an increase in motile mitochondria, whereas a decrease in the activity of this kinase produced an increase in mitochondria pausing. These effects were dependent on Tau proteins, as Tau (-/- neurons did not respond to distinct GSK3β levels. Furthermore, differences in GSK3β expression did not affect other parameters like mitochondria velocity or mitochondria run length. We conclude that GSK3B activity regulates mitochondrial axonal trafficking largely in a Tau-dependent manner.

  4. The Impact of Promoting Transcription on Early Text Production: Effects on Bursts and Pauses, Levels of Written Language, and Writing Performance

    Science.gov (United States)

    Alves, Rui A.; Limpo, Teresa; Fidalgo, Raquel; Carvalhais, Lénia; Pereira, Luísa Álvares; Castro, São Luís

    2016-01-01

    Writing development seems heavily dependent upon the automatization of transcription. This study aimed to further investigate the link between transcription and writing by examining the effects of promoting handwriting and spelling skills on a comprehensive set of writing measures (viz., bursts and pauses, levels of written language, and writing…

  5. A Diagnostic Marker to Discriminate Childhood Apraxia of Speech From Speech Delay: III. Theoretical Coherence of the Pause Marker with Speech Processing Deficits in Childhood Apraxia of Speech.

    Science.gov (United States)

    Shriberg, Lawrence D; Strand, Edythe A; Fourakis, Marios; Jakielski, Kathy J; Hall, Sheryl D; Karlsson, Heather B; Mabie, Heather L; McSweeny, Jane L; Tilkens, Christie M; Wilson, David L

    2017-04-14

    Previous articles in this supplement described rationale for and development of the pause marker (PM), a diagnostic marker of childhood apraxia of speech (CAS), and studies supporting its validity and reliability. The present article assesses the theoretical coherence of the PM with speech processing deficits in CAS. PM and other scores were obtained for 264 participants in 6 groups: CAS in idiopathic, neurogenetic, and complex neurodevelopmental disorders; adult-onset apraxia of speech (AAS) consequent to stroke and primary progressive apraxia of speech; and idiopathic speech delay. Participants with CAS and AAS had significantly lower scores than typically speaking reference participants and speech delay controls on measures posited to assess representational and transcoding processes. Representational deficits differed between CAS and AAS groups, with support for both underspecified linguistic representations and memory/access deficits in CAS, but for only the latter in AAS. CAS-AAS similarities in the age-sex standardized percentages of occurrence of the most frequent type of inappropriate pauses (abrupt) and significant differences in the standardized occurrence of appropriate pauses were consistent with speech processing findings. Results support the hypotheses of core representational and transcoding speech processing deficits in CAS and theoretical coherence of the PM's pause-speech elements with these deficits.

  6. Postreinforcement Pause Duration Varies within a Session and with a Variable Response Requirement but Not as a Function of Prior Revolutions

    Science.gov (United States)

    Belke, Terry W.

    2011-01-01

    The current study examined the variables that influence postreinforcement pause (PRP) duration in rats when wheel running serves as the reinforcing consequence. The relationship between revolutions and PRP duration when revolutions were manipulated within a session and the effect of changing the response requirement from fixed to variable on PRP…

  7. Speech and pause characteristics in multiple sclerosis: A preliminary study of speakers with high and low neuropsychological test performance

    Science.gov (United States)

    FEENAUGHTY, LYNDA; TJADEN, KRIS; BENEDICT, RALPH H.B.; WEINSTOCK-GUTTMAN, BIANCA

    2017-01-01

    This preliminary study investigated how cognitive-linguistic status in multiple sclerosis (MS) is reflected in two speech tasks (i.e. oral reading, narrative) that differ in cognitive-linguistic demand. Twenty individuals with MS were selected to comprise High and Low performance groups based on clinical tests of executive function and information processing speed and efficiency. Ten healthy controls were included for comparison. Speech samples were audio-recorded and measures of global speech timing were obtained. Results indicated predicted differences in global speech timing (i.e. speech rate and pause characteristics) for speech tasks differing in cognitive-linguistic demand, but the magnitude of these task-related differences was similar for all speaker groups. Findings suggest that assumptions concerning the cognitive-linguistic demands of reading aloud as compared to spontaneous speech may need to be re-considered for individuals with cognitive impairment. Qualitative trends suggest that additional studies investigating the association between cognitive-linguistic and speech motor variables in MS are warranted. PMID:23294227

  8. Replication fork progression is paused in two large chromosomal zones flanking the DNA replication origin in Escherichia coli.

    Science.gov (United States)

    Akiyama, Masahiro Tatsumi; Oshima, Taku; Chumsakul, Onuma; Ishikawa, Shu; Maki, Hisaji

    2016-08-01

    Although the speed of nascent DNA synthesis at individual replication forks is relatively uniform in bacterial cells, the dynamics of replication fork progression on the chromosome are hampered by a variety of natural impediments. Genome replication dynamics can be directly measured from an exponentially growing cell population by sequencing newly synthesized DNA strands that were specifically pulse-labeled with the thymidine analogue 5-bromo-2'-deoxyuridine (BrdU). However, a short pulse labeling with BrdU is impracticable for bacteria because of poor incorporation of BrdU into the cells, and thus, the genomewide dynamics of bacterial DNA replication remain undetermined. Using a new thymidine-requiring Escherichia coli strain, eCOMB, and high-throughput sequencing, we succeeded in determining the genomewide replication profile in bacterial cells. We also found that fork progression is paused in two ~200-kb chromosomal zones that flank the replication origin in the growing cells. This origin-proximal obstruction to fork progression was overcome by an increased thymidine concentration in the culture medium and enhanced by inhibition of transcription. These indicate that DNA replication near the origin is sensitive to the impediments to fork progression, namely a scarcity of the DNA precursor deoxythymidine triphosphate and probable conflicts between replication and transcription machineries.

  9. Effects of Breath Training Pattern "End-Inspiratory Pause" on Respiratory Mechanics and Arterial Blood Gas of Patients with COPD

    Institute of Scientific and Technical Information of China (English)

    梁永杰; 蔡映云

    2002-01-01

    Objective:In order to explore the mechanism of Chinese traditional breath training, theeffects of end-inspiratory pause breathing (EIPB) on the respiratory mechanics and arterial blood gas werestudied in patients with chronic obstructive pulmonary disease (COPD). Methods: Ten patients in steadystage participating in the study had a breath training of regulating the respiration rhythm as to having apause between the deep and slow inspiration and the slow expiration. Effect of the training was observed byvisual feedback from the screen of the respiratory inductive plethysmograph. The dynamic change of par-tial pressure of oxygen saturation in blood (SpO2) was recorded with sphygmo-oximeter, the pulmonarymechanics and EIPB were determined with spirometer, and the data of arterial blood gases in tranquilizedbreathing and EIPB were analysed. Results: After EIPB training, SpO2 increased progressively, PaO2 in-creased and PaCO2 decreased, and the PaO2 increment was greater than the PaCO2 decrement. Further-more, the tidal volume increased and the frequency of respiration decreased significantly, both inspirationtime and expiration time were prolonged. There was no significant change in both mean inspiration flowrate (VT/Ti) and expiration flow rate (VT/Te). The baselines in spirogram during EIPB training had noraise. Conclusion: EIPB could decrease the ratio of the dead space and tidal volume (VD/VT), cause in-crease of PaO2 more than the decrease of PaCO2, suggesting that this training could improve both the func-tion of ventilation and gaseous exchange in the lung. EIPB training might be a breathing training patternfor rehabilitation of patients with COPD.

  10. P-TEFb, the super elongation complex and mediator regulate a subset of non-paused genes during early Drosophila embryo development.

    Directory of Open Access Journals (Sweden)

    Olle Dahlberg

    2015-02-01

    Full Text Available Positive Transcription Elongation Factor b (P-TEFb is a kinase consisting of Cdk9 and Cyclin T that releases RNA Polymerase II (Pol II into active elongation. It can assemble into a larger Super Elongation Complex (SEC consisting of additional elongation factors. Here, we use a miRNA-based approach to knock down the maternal contribution of P-TEFb and SEC components in early Drosophila embryos. P-TEFb or SEC depletion results in loss of cells from the embryo posterior and in cellularization defects. Interestingly, the expression of many patterning genes containing promoter-proximal paused Pol II is relatively normal in P-TEFb embryos. Instead, P-TEFb and SEC are required for expression of some non-paused, rapidly transcribed genes in pre-cellular embryos, including the cellularization gene Serendipity-α. We also demonstrate that another P-TEFb regulated gene, terminus, has an essential function in embryo development. Similar morphological and gene expression phenotypes were observed upon knock down of Mediator subunits, providing in vivo evidence that P-TEFb, the SEC and Mediator collaborate in transcription control. Surprisingly, P-TEFb depletion does not affect the ratio of Pol II at the promoter versus the 3' end, despite affecting global Pol II Ser2 phosphorylation levels. Instead, Pol II occupancy is reduced at P-TEFb down-regulated genes. We conclude that a subset of non-paused, pre-cellular genes are among the most susceptible to reduced P-TEFb, SEC and Mediator levels in Drosophila embryos.

  11. On the Rhythm of Chinese Poetry of the Syllable Pause System%论音顿体系的汉语诗歌节奏

    Institute of Scientific and Technical Information of China (English)

    孙则鸣

    2013-01-01

    Given that the rhythm of some Chinese new metrical poems is not so beautiful, this paper traces back to the origin of western music rhythm and meter system and finds that Chinese poetry has a typical syllable-pause system rhythm rather than a sound foot system rhythm. However, "the theory of neat pauses”and“the theory of foot symmetry“of Chinese new poetry are influenced by the Western foot theory, because of which, the beauty of the rhythm of some poems is not so obvious. Chinese poetry must revert to syllable-pause system, in order to per⁃fectly realize the beautiful rhythm of Chinese poetry. The creation of poems in Chinese syllable-pause system forms a specific pattern, which can serve as a reference for writers.%  鉴于部分格律体新诗作品节奏美并不强的现实,本文追溯了西方音顿体系节奏和音步体系节奏的本源,发现汉语诗歌是典型的音顿体系节奏而不是音步体系节奏,而我国新诗格律的“顿数整齐论”和“音步对称论”是受西方音步理论影响而形成的,因而导致了部分作品节奏美不强;汉语诗歌必须回归音顿体系的正轨,才能完备地实现汉语诗歌节奏美。汉语音顿体系诗歌在创作中形成了具体形式法度,可供创作者借鉴。

  12. Alterations in apoptotic markers and egg-specific protein gene expression in the chicken oviduct during pause in laying induced by tamoxifen.

    Science.gov (United States)

    Socha, Joanna K; Hrabia, Anna

    2017-09-21

    The aim of this study was to examine the cell apoptosis, gene expression and activity of caspases 2, 3, 8 and 9, and the mRNA expression of selected egg-specific proteins in the chicken oviduct during pause in egg laying induced by tamoxifen (TMX) treatment. The experiment was carried out on Hy-Line Brown laying hens. The control birds were treated subcutaneously with vehicle (ethanol) and the experimental ones with TMX at a dose of 6 mg/kg of body weight. Hens were treated daily until a pause in egg laying occurred and sacrificed on Day 7 of the experiment. Within the oviductal wall, the highest number of apoptotic cells (TUNEL-positive) was found in the luminal epithelium and the lowest in the stroma. The administration of TMX increased the percentage of apoptotic cells in the magnum, isthmus, and shell gland as well as immunoreactivity for caspases 3 and 9. Real-time PCR analysis revealed the segment-dependent mRNA expression of caspases 2, 3, 8 and 9. Treatment of hens with TMX elevated the level of caspase-2 transcript in the infundibulum, caspases 2, 3 and 8 in the isthmus, and caspase-9 in the shell gland (P avidin and ovocleidin-116 mRNAs was decreased (P egg-specific proteins after TMX treatment suggest that there is a relationship between estrogen action and the expression of these genes. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Tethering sigma70 to RNA polymerase reveals high in vivo activity of sigma factors and sigma70-dependent pausing at promoter-distal locations.

    Science.gov (United States)

    Mooney, Rachel Anne; Landick, Robert

    2003-11-15

    Bacterial sigma factors compete for binding to RNA polymerase (RNAP) to control promoter selection, and in some cases interact with RNAP to regulate at least the early stages of transcript elongation. However, the effective concentration of sigmas in vivo, and the extent to which sigma can regulate transcript elongation generally, are unknown. We report that tethering sigma70 to all RNAP molecules via genetic fusion of rpoD to rpoC (encoding sigma70 and RNAP's beta' subunit, respectively) yields viable Escherichia coli strains in which alternative sigma-factor function is not impaired. beta'::sigma70 RNAP transcribed DNA normally in vitro, but allowed sigma70-dependent pausing at extended -10-like sequences anywhere in a transcriptional unit. Based on measurement of the effective concentration of tethered sigma70, we conclude that the effective concentration of sigma70 in E. coli (i.e., its thermodynamic activity) is close to its bulk concentration. At this level, sigma70 would be a bona fide elongation factor able to direct transcriptional pausing even after its release from RNAP during promoter escape.

  14. Genome-wide analysis of KAP1, the 7SK snRNP complex, and RNA polymerase II

    Directory of Open Access Journals (Sweden)

    Ryan P. McNamara

    2016-03-01

    Full Text Available The transition of RNA polymerase II (Pol II from transcription initiation into productive elongation in eukaryotic cells is regulated by the P-TEFb kinase, which phosphorylates the C-terminal domain of paused Pol II at promoter-proximal regions. Our recent study found that P-TEFb (in an inhibited state bound to the 7SK snRNP complex interacts with the KAP1/TRIM28 transcriptional regulator, and that KAP1 and the 7SK snRNP co-occupy most gene promoters containing paused Pol II. Here we provide a detailed experimental description and analysis of the ChIP-seq datasets that have been deposited into Gene Expression Omnibus (GEO: GS72622, so that independent groups can replicate and expand upon these findings. We propose these datasets would provide valuable information for researchers studying mechanisms of transcriptional regulation including Pol II pausing and pause release.

  15. The requirement for pre-TCR during thymic differentiation enforces a developmental pause that is essential for V-DJβ rearrangement.

    Directory of Open Access Journals (Sweden)

    Karen S Hathcock

    Full Text Available T cell development occurs in the thymus and is critically dependent on productive TCRβ rearrangement and pre-TCR expression in DN3 cells. The requirement for pre-TCR expression results in the arrest of thymocytes at the DN3 stage (β checkpoint, which is uniquely permissive for V-DJβ recombination; only cells expressing pre-TCR survive and develop beyond the DN3 stage. In addition, the requirement for TCRβ rearrangement and pre-TCR expression enforces suppression of TCRβ rearrangement on a second allele, allelic exclusion, thus ensuring that each T cell expresses only a single TCRβ product. However, it is not known whether pre-TCR expression is essential for allelic exclusion or alternatively if allelic exclusion is enforced by developmental changes that can occur in the absence of pre-TCR. We asked if thymocytes that were differentiated without pre-TCR expression, and therefore without pause at the β checkpoint, would suppress all V-DJβ rearrangement. We previously reported that premature CD28 signaling in murine CD4(-CD8(- (DN thymocytes supports differentiation of CD4(+CD8(+ (DP cells in the absence of pre-TCR expression. The present study uses this model to define requirements for TCRβ rearrangement and allelic exclusion. We demonstrate that if cells exit the DN3 developmental stage before TCRβ rearrangement occurs, V-DJβ rearrangement never occurs, even in DP cells that are permissive for D-Jβ and TCRα rearrangement. These results demonstrate that pre-TCR expression is not essential for thymic differentiation to DP cells or for V-DJβ suppression. However, the requirement for pre-TCR signals and the exclusion of alternative stimuli such as CD28 enforce a developmental "pause" in early DN3 cells that is essential for productive TCRβ rearrangement to occur.

  16. 从双语词汇通达的角度看二语输出中的停顿现象%An Analysis of the Pause in Second Language Oral Production --Based on Bilingual Lexical Access Mechanism

    Institute of Scientific and Technical Information of China (English)

    陈曦

    2012-01-01

    停顿现象经常出现在二语学习者的口语输出中,停顿的频率越高,时长越长,口语表达的流畅性则越低,交流也会受到阻碍。本文从心理语言学中双语词汇通达的角度讨论了二语输出中的停顿现象,分析发现停顿源于在概念表征层面对母语和二语词汇层的同时激活,母语词汇层参与了目标词的选择竞争。为了减少母语在口语输出中的干扰。二语学习者应该充分利用一些学习技巧以增强二语的激活,同时加强对母语的抑制。%The frequency and length of pause have become one of the essential measurements of oral fluency,which influences the process of oral communication. This paper aims to analyze the pause in second language oral produc- tion based on bilingual lexical access theory in psychological linguistics. It is found that the pause results from the simultaneous activation of lexical presentations in the two languages and that the first language participates in the se- lection process. In order to improve oral fluency, second language learners should learn to strengthen the activation of the second language and the inhibition of the first language.

  17. 从双语词汇通达的角度看二语输出中的停顿现象%An Analysis of Pause in Second Language Oral Production Based on Bilingual Lexical Access Mechanism

    Institute of Scientific and Technical Information of China (English)

    陈曦

    2012-01-01

    停顿现象经常出现在二语学习者的口语输出中,停顿的频率越高,时长越长,口语表达的流畅性则越低,交流也会受到阻碍。从心理语言学中双语词汇通达的角度讨论二语输出中的停顿现象,分析发现停顿源于在概念表征层面对母语和二语词汇层的同时激活,母语词汇层参与了目标词的选择竞争。为了减少母语在口语输出中的干扰,二语学习者应该充分利用一些学习技巧以增强二语的激活,同时加强对母语的抑制。%The frequency and length of pause have become one of the essential measurements of oral fluency, which influences the process of oral communication. Pause in second language oral production was analyzed based on bilingual lexieal access theo- ry in psychological linguistics. It was found that pause is resulted from the simultaneous activation of lexical presentations in two languages, and that tile first language participates in the selection process. In order to improve oral fluency, second language learners should learn to strengthen the activation of the second language and the inhibition of the first language.

  18. Telomerase is essential to alleviate pif1-induced replication stress at telomeres

    NARCIS (Netherlands)

    Chang, Michael; Luke, Brian; Kraft, Claudine; Li, Zhijian; Peter, Matthias; Lingner, Joachim; Rothstein, Rodney

    2009-01-01

    Pif1, an evolutionarily conserved helicase, negatively regulates telomere length by removing telomerase from chromosome ends. Pif1 has also been implicated in DNA replication processes such as Okazaki fragment maturation and replication fork pausing. We find that overexpression of Saccharomyces cerv

  19. A numerical method for analysis of in vitro time-dependent inhibition data. Part 1. Theoretical considerations.

    Science.gov (United States)

    Nagar, Swati; Jones, Jeffrey P; Korzekwa, Ken

    2014-09-01

    Inhibition of cytochromes P450 by time-dependent inhibitors (TDI) is a major cause of clinical drug-drug interactions. It is often difficult to predict in vivo drug interactions based on in vitro TDI data. In part 1 of these manuscripts, we describe a numerical method that can directly estimate TDI parameters for a number of kinetic schemes. Datasets were simulated for Michaelis-Menten (MM) and several atypical kinetic schemes. Ordinary differential equations were solved directly to parameterize kinetic constants. For MM kinetics, much better estimates of KI can be obtained with the numerical method, and even IC50 shift data can provide meaningful estimates of TDI kinetic parameters. The standard replot method can be modified to fit non-MM data, but normal experimental error precludes this approach. Non-MM kinetic schemes can be easily incorporated into the numerical method, and the numerical method consistently predicts the correct model at errors of 10% or less. Quasi-irreversible inactivation and partial inactivation can be modeled easily with the numerical method. The utility of the numerical method for the analyses of experimental TDI data is provided in our companion manuscript in this issue of Drug Metabolism and Disposition (Korzekwa et al., 2014b).

  20. Gdown1 Associates Efficiently with RNA Polymerase II after Promoter Clearance and Displaces TFIIF during Transcript Elongation

    Science.gov (United States)

    DeLaney, Elizabeth

    2016-01-01

    Pausing during the earliest stage of transcript elongation by RNA polymerase II (Pol II) is a nearly universal control point in metazoan gene expression. The substoichiometric Pol II subunit Gdown1 facilitates promoter proximal pausing in vitro in extract-based transcription reactions, out-competes the initiation/elongation factor TFIIF for binding to free Pol II and co-localizes with paused Pol II in vivo. However, we have shown that Gdown1 cannot functionally associate with the Pol II preinitiation complex (PIC), which contains TFIIF. In the present study, we determined at what point after initiation Gdown1 can associate with Pol II and how rapidly this competition with TFIIF occurs. We show that, as with the PIC, Gdown1 cannot functionally load into open complexes or complexes engaged in abortive synthesis of very short RNAs. Gdown1 can load into early elongation complexes (EECs) with 5–9 nt RNAs, but efficient association with EECs does not take place until the point at which the upstream segment of the long initial transcription bubble reanneals. Tests of EECs assembled on a series of promoter variants confirm that this bubble collapse transition, and not transcript length, modulates Gdown1 functional affinity. Gdown1 displaces TFIIF effectively from all complexes downstream of the collapse transition, but this displacement is surprisingly slow: complete loss of TFIIF stimulation of elongation requires 5 min of incubation with Gdown1. The relatively slow functional loading of Gdown1 in the presence of TFIIF suggests that Gdown1 works in promoter-proximal pausing by locking in the paused state after elongation is already antagonized by other factors, including DSIF, NELF and possibly the first downstream nucleosome. PMID:27716820

  1. Stochastic kinetics of a single headed motor protein: dwell time distribution of KIF1A

    CERN Document Server

    Garai, Ashok

    2010-01-01

    KIF1A, a processive single headed kinesin superfamily motor, hydrolyzes Adenosine triphosphate (ATP) to move along a filamentous track called microtubule. The stochastic movement of KIF1A on the track is characterized by an alternating sequence of pause and translocation. The sum of the durations of pause and the following translocation defines the dwell time at the binding site on the microtubule. Using the NOSC model (Nishinari et. al. PRL, {\\bf 95}, 118101 (2005)), which captures the Brownian ratchet mechanism of individual KIF1A along with its biochemical cycle, we systematically derive an analytical expression for the dwell time distribution. In principle, our theoretical prediction can be tested by carrying out single-molecule experiments with adequate spatio-temporal resolution.

  2. RNAP II processivity is a limiting step for HIV-1 transcription independent of orientation to and activity of endogenous neighboring promoters.

    Science.gov (United States)

    Kaczmarek Michaels, Katarzyna; Wolschendorf, Frank; Schiralli Lester, Gillian M; Natarajan, Malini; Kutsch, Olaf; Henderson, Andrew J

    2015-12-01

    Since HIV-1 has a propensity to integrate into actively expressed genes, transcriptional interference from neighboring host promoters has been proposed to contribute to the establishment and maintenance HIV-1 latency. To gain insights into how endogenous promoters influence HIV-1 transcription we utilized a set of inducible T cell lines and characterized whether there were correlations between expression of endogenous genes, provirus and long terminal repeat architecture. We show that neighboring promoters are active but have minimal impact on HIV-1 transcription, in particular, expression of the endogenous gene did not prevent expression of HIV-1 following induction of latent provirus. We also demonstrate that releasing paused RNAP II by diminishing negative elongation factor (NELF) is sufficient to reactivate transcriptionally repressed HIV-1 provirus regardless of the integration site and orientation of the provirus suggesting that NELF-mediated RNAP II pausing is a common mechanism of maintaining HIV-1 latency.

  3. A Pause for China's Cement Industry

    Institute of Scientific and Technical Information of China (English)

    Li Zhen

    2009-01-01

    @@ Cement industry suffers excess productionWith the advent of global financial crisis,the Chinese government has laid out a stimulus package on infrastructure construction.Driven by the investment spree,China's cement makers are flocking to expand output capacity,which is now leading the industry into a much-higher-thanneeded state.

  4. Audible punctuation: performative pause in Homeric prosody

    NARCIS (Netherlands)

    Blankenborg, R.J.J.

    2015-01-01

    The association between physical proximity and relationship formation as a classic finding in psychological science. In the current dissertation, this classic association was examined in an entirely different and surprisingly understudied setting: the school classroom. We examined whether and how ph

  5. Euthanasia, letting die and the pause.

    Science.gov (United States)

    Gillett, G

    1988-01-01

    There is a marked disparity between medical intuitions and philosophical argument about euthanasia. In this paper I argue that the following objections can be raised. First, medical intuitions are against it and this is an area in which judgement and sensitivity are required in that death is a unique and complex process and the patient has many needs including the need to know that others have not discounted his or her worth. Also, part of the moral constitution of a good doctor is a devotion to the protection and preservation of life whatever reasons are produced to dissuade her. Finally, we do not know what the final events of a person's life might hold. PMID:3392719

  6. A time to pause and ponder

    DEFF Research Database (Denmark)

    Daugbjerg, Peer; Spencer, Christopher

    2017-01-01

    to the ‘Reflective Learning and Teaching for Thinking’ TIG @ ETEN 2016 (https://www.ucviden.dk/portal/da/activities/preservice-teachers-working-with-narrative-inquiry(03a5e643-2d4f-4408-9abb-897ad31cbc6c).html) Frankl V., 2014: Man's search for meaning, Beacon Press. Spencer, C. (2015): “Teacher Educator, Go Measure...

  7. A Pause in the Impatience of Things

    DEFF Research Database (Denmark)

    du Gay, Paul

    2017-01-01

    of bureaucracy’s inherent “dark side.” In this reading, formality, precision, efficiency, and speed, taken together, allow bureaucracy to subordinate everyday life to the diktats of instrumental rationalization. On the other, Weber is viewed as a misguided celebrant of bureaucracy because he pays too much......This chapter argues that “speed,” or lack thereof, lies at the heart of much that has been written about bureaucracy generally, and about Max Weber’s theory of bureaucracy in particular. On the one hand, within sociology and social theory, Weber is regarded as one of the chief critics...... attention to formal rationality and not enough to its inherent dysfunctions. Here, innovation, flexibility, and speed are on the side of the post-bureaucratic organization. This chapter interrogates these contrasting stories about bureaucracy and suggests a more complex account of the relationship between...

  8. Audible punctuation: performative pause in Homeric prosody

    NARCIS (Netherlands)

    Blankenborg, R.J.J.

    2015-01-01

    The association between physical proximity and relationship formation as a classic finding in psychological science. In the current dissertation, this classic association was examined in an entirely different and surprisingly understudied setting: the school classroom. We examined whether and how

  9. Rad53-Mediated Regulation of Rrm3 and Pif1 DNA Helicases Contributes to Prevention of Aberrant Fork Transitions under Replication Stress

    Directory of Open Access Journals (Sweden)

    Silvia Emma Rossi

    2015-10-01

    Full Text Available Replication stress activates the Mec1ATR and Rad53 kinases. Rad53 phosphorylates nuclear pores to counteract gene gating, thus preventing aberrant transitions at forks approaching transcribed genes. Here, we show that Rrm3 and Pif1, DNA helicases assisting fork progression across pausing sites, are detrimental in rad53 mutants experiencing replication stress. Rrm3 and Pif1 ablations rescue cell lethality, chromosome fragmentation, replisome-fork dissociation, fork reversal, and processing in rad53 cells. Through phosphorylation, Rad53 regulates Rrm3 and Pif1; phospho-mimicking rrm3 mutants ameliorate rad53 phenotypes following replication stress without affecting replication across pausing elements under normal conditions. Hence, the Mec1-Rad53 axis protects fork stability by regulating nuclear pores and DNA helicases. We propose that following replication stress, forks stall in an asymmetric conformation by inhibiting Rrm3 and Pif1, thus impeding lagging strand extension and preventing fork reversal; conversely, under unperturbed conditions, the peculiar conformation of forks encountering pausing sites would depend on active Rrm3 and Pif1.

  10. Glucagon-like peptide-1 (GLP-1) reduces mortality and improves lung function in a model of experimental obstructive lung disease in female mice.

    Science.gov (United States)

    Viby, Niels-Erik; Isidor, Marie S; Buggeskov, Katrine B; Poulsen, Steen S; Hansen, Jacob B; Kissow, Hannelouise

    2013-12-01

    The incretin hormone glucagon-like peptide-1 (GLP-1) is an important insulin secretagogue and GLP-1 analogs are used for the treatment of type 2 diabetes. GLP-1 displays antiinflammatory and surfactant-releasing effects. Thus, we hypothesize that treatment with GLP-1 analogs will improve pulmonary function in a mouse model of obstructive lung disease. Female mice were sensitized with injected ovalbumin and treated with GLP-1 receptor (GLP-1R) agonists. Exacerbation was induced with inhalations of ovalbumin and lipopolysaccharide. Lung function was evaluated with a measurement of enhanced pause in a whole-body plethysmograph. mRNA levels of GLP-1R, surfactants (SFTPs), and a number of inflammatory markers were measured. GLP-1R was highly expressed in lung tissue. Mice treated with GLP-1R agonists had a noticeably better clinical appearance than the control group. Enhanced pause increased dramatically at day 17 in all control mice, but the increase was significantly less in the groups of GLP-1R agonist-treated mice (P agonist-treated mice (P agonist treatment. These results show that GLP-1R agonists have potential therapeutic potential in the treatment of obstructive pulmonary diseases, such as chronic obstructive pulmonary disease, by decreasing the severity of acute exacerbations. The mechanism of action does not seem to be the modulation of inflammation and SFTP expression.

  11. RNA Polymerase II Regulates Topoisomerase 1 Activity to Favor Efficient Transcription.

    Science.gov (United States)

    Baranello, Laura; Wojtowicz, Damian; Cui, Kairong; Devaiah, Ballachanda N; Chung, Hye-Jung; Chan-Salis, Ka Yim; Guha, Rajarshi; Wilson, Kelli; Zhang, Xiaohu; Zhang, Hongliang; Piotrowski, Jason; Thomas, Craig J; Singer, Dinah S; Pugh, B Franklin; Pommier, Yves; Przytycka, Teresa M; Kouzine, Fedor; Lewis, Brian A; Zhao, Keji; Levens, David

    2016-04-01

    We report a mechanism through which the transcription machinery directly controls topoisomerase 1 (TOP1) activity to adjust DNA topology throughout the transcription cycle. By comparing TOP1 occupancy using chromatin immunoprecipitation sequencing (ChIP-seq) versus TOP1 activity using topoisomerase 1 sequencing (TOP1-seq), a method reported here to map catalytically engaged TOP1, TOP1 bound at promoters was discovered to become fully active only after pause-release. This transition coupled the phosphorylation of the carboxyl-terminal-domain (CTD) of RNA polymerase II (RNAPII) with stimulation of TOP1 above its basal rate, enhancing its processivity. TOP1 stimulation is strongly dependent on the kinase activity of BRD4, a protein that phosphorylates Ser2-CTD and regulates RNAPII pause-release. Thus the coordinated action of BRD4 and TOP1 overcame the torsional stress opposing transcription as RNAPII commenced elongation but preserved negative supercoiling that assists promoter melting at start sites. This nexus between transcription and DNA topology promises to elicit new strategies to intercept pathological gene expression.

  12. Advanced Quantitative Robust Control Engineering: New Solutions for Automatic Loop-Shaping for SISO and MIMO Systems. Part 1: SISO Systems

    Science.gov (United States)

    2009-09-24

    and MIMO Systems.Part 1: SISO Systems. if (mark < 320) & (w(k) >= w_ref) y = uph (20*log10(bdb_a), 20*log10(bdb_b)); if mod > min(y...8217Title’,title(’All bounds intersection’)); disp(’Bounds calculation finished.’); disp(’ ’); pause(2); % UPH Function necessary to determine how...function y = uph (bdb_a, bdb_b) n = length(bdb_a(1,:)); m = length(bdb_a(:,1)); ph = 0:-5:-180; for i=1:m bdba(i

  13. Pause, Breathe, Smile: A Mixed-Methods Study of Student Well-Being Following Participation in an Eight-Week, Locally Developed Mindfulness Program in Three New Zealand Schools

    Science.gov (United States)

    Bernay, Ross; Graham, Esther; Devcich, Daniel A.; Rix, Grant; Rubie-Davies, Christine M.

    2016-01-01

    Children today face increasingly high stress levels, impacting their well-being. Schools can play a crucial role in teaching social and emotional skills; therefore there is a need to identify effective interventions. This mixed-methods study of 124 elementary school students from three New Zealand schools aimed to (1) assess if children…

  14. Clinical Observation on Ningxinanshen Decoction for 67 Female Meno-pause with Insomnia%宁心安神汤治疗女性更年期失眠67例临床观察

    Institute of Scientific and Technical Information of China (English)

    韩丽娟; 王思明; 李胜前

    2014-01-01

    OBJECTIVE To study the clinical effect of Ningxinanshen Decoction for female menopause with in-somnia ,and to provide a new way for clinical treatment.METHODS 133 cases of female menopause with insomnia were randomly divided into treatment group and control group by oral Ningxinanshen Decoction and estazolam .After the course of 30 days,both groups was evaluated with clinical efficacy and ADR.RESULTS Both groups had the similar effect (P>0.05) and could decreace the psce score (P<0.05),however,the mcideaces of ADR in treat-ment group reduced significantly than that in control group.CONCLUSION Ningxinanshen Decoction for treatment of menopause with insomnia is safe and effective ,and indeed a better choice for clinical use.%目的:观察宁心安神汤治疗女性更年期失眠的疗效,为临床治疗提供新方法。方法将133例更年期失眠症患者随机分为治疗组和对照组,分别口服宁心安神汤和艾司唑仑片,两组疗程均为30天,1个疗程结束后进行疗效和不良反应评价。结果两组临床疗效相近( P>0.05),均能降低PSQI积分( P<0.05),但治疗组不良反应率显著低于对照组。结论宁心安神汤安全有效,是治疗女性更年期失眠的更优选择。

  15. Annual Precise Time and Time Interval (PTTI) Applications and Planning Meeting (24th) Held in McLean, VA on December 1-3, 1992

    Science.gov (United States)

    1993-06-01

    APIIR AMPMFERS IOUTPUTS MONITOR FODA POWER INTERFACE F SUPPLY •’l -CAiBLE 9 AND FODA AND COMPUTERMOTR TO FTS MONII)R AND CONTROL Figure 1. Block...Deviation of Low TCD Optical Fiber RANGEs -51 dBV STATUSt PAUSED A.MATH 9201 FODA DSS15 2W RMS=15 -80 dB CV) e..o.............o. ...o~ o...FORMATS, available from the Range Commanders Council, White Sands Missile Range, New Mexico 88002. 375 INTRODUCTION As part of ER modernization, a

  16. En pause fra den hårde kamp

    DEFF Research Database (Denmark)

    Ekman, Susanne

    2011-01-01

    Virksomheder bruger stadig flere psykologer og coaches, som i praksis yder parterapi mellem medarbejdere og virksomhed. Intimsfæren sniger sig ind i arbejdslivet......Virksomheder bruger stadig flere psykologer og coaches, som i praksis yder parterapi mellem medarbejdere og virksomhed. Intimsfæren sniger sig ind i arbejdslivet...

  17. Pause med trombocytaggregationshaemmere hos kirurgiske patienter med kardiel stent

    DEFF Research Database (Denmark)

    Johansen, Mathias; Afshari, Arash; Kristensen, Billy

    2010-01-01

    Dual antiplatelet therapy with aspirin and clopidogrel is increasingly used for secondary prevention of cardiovascular events in patients with percutaneous coronary intervention. Anesthesiologists and surgeons are faced with the challenge of managing these patients prior to a surgical procedure. ....... Premature discontinuation of antiplatelet therapy constitutes a substantial risk of stent thrombosis, myocardial infarction and death. Continuing therapy increases the risk of bleeding. We provide the latest evidence on this topic for patients awaiting non-cardiac surgery....

  18. Time for a Strategic and Intellectual Pause in Afghanistan

    Science.gov (United States)

    2010-01-01

    difficult to discern how the Hearts-and-Minds enhances government legitimacy. The lavish provision of goods and services, the frenetic activity of...very little popular support, even in the southern region, which is considered their base . To suggest that the Taliban shadow governments compete for...down fleeing insurgents, uncovering their bases and caches, and providing a quick reaction force. In Afghanistan, the narcotics trade has to be

  19. Pausing, Pondering, and Partnering: Communicating in Financially Challenging Times

    Science.gov (United States)

    Gross, Karen

    2009-01-01

    In times of financial distress, the communication strategies of leaders of institutions of higher education are often flawed. This is because the best approaches to helping a campus deal with financial woes are counter-intuitive and require an understanding of money as a language. But bankruptcy law, financial counseling, psychology, and…

  20. Ready, Steady … Pause: Integrating ICT into Shanghai Preschools

    Science.gov (United States)

    Dong, Chuanmei; Newman, Linda

    2016-01-01

    Western research over the last decade has shown that early childhood (EC) teachers' perspectives on the role of Information and Communication Technologies (ICT) in the early years strongly shape young children's experiences in educational settings and affect the integration of ICT into the classroom. The research in China is scant however. This…

  1. En pause fra den hårde kamp

    DEFF Research Database (Denmark)

    Ekman, Susanne

    2011-01-01

    Virksomheder bruger stadig flere psykologer og coaches, som i praksis yder parterapi mellem medarbejdere og virksomhed. Intimsfæren sniger sig ind i arbejdslivet. Arbejdet svinger mellem hektisk selvrealisering og akutte pauser pga. stress og sammenbrud...

  2. Expression and characterization of rice putative PAUSED gene

    Institute of Scientific and Technical Information of China (English)

    Chengguo Yao; Liangfa Ge; Wei Li; Botao Zhao; Chaoqun Li; Kangcheng Ruan; Hongxuan Lin; Youxin Jin

    2008-01-01

    In Arab idopsis, PA USED ( PSD ) encodes the ortholog of loslp/ exportin-t, which mediates the nuclear export of transfer RNA (tRNA) in yeast and mammals. However, in monocot plants such as rice, knowledge of the corresponding ortholog is limited, and its effects on growth development and productivity remain unknown. In this study, we verified a rice transfer-DNA insertional mutantpsd line and analyzed its phenotypes;the mutant displayed severe morphological defects including retarded development and low fertility compared with wild-type rice. Examining intronless tRNA-Tyr and intron-containing pre-tRNA-Ala expression levels in cytoplasmic and nuclear fraction with Northern blot analysis between wild -type and mutant leaf tissue suggested that rice PSD might be involved in tRNA export from the nucleus to the cytoplasm.Additionally, reverse transcription-polymerase chain reaction analysis revealed that PSD transcript was expressed throughout normal rice plant development, and subcellular localization assays showed that rice PSD protein was present in both the nucleus and cytoplasm. In summary, our data implied that the putative PSD gene might be indispensable for normal rice development and its function might be the same as that ofArabidopsis PSD.

  3. CHD1 regulates cell fate determination by activation of differentiation-induced genes

    DEFF Research Database (Denmark)

    Baumgart, Simon J; Najafova, Zeynab; Hossan, Tareq

    2017-01-01

    . Furthermore, we observed that CHD1-dependent genes are mainly induced during osteoblast differentiation and are characterized by higher levels of CHD1 occupancy around the TSS. Interestingly, CHD1 depletion resulted in increased pausing of RNA Polymerase II (RNAPII) and decreased H2A.Z occupancy close......The coordinated temporal and spatial activation of gene expression is essential for proper stem cell differentiation. The Chromodomain Helicase DNA-binding protein 1 (CHD1) is a chromatin remodeler closely associated with transcription and nucleosome turnover downstream of the transcriptional start...... to the TSS, but not at enhancer regions. These findings reveal a novel role for CHD1 during osteoblast differentiation and provide further insights into the intricacies of epigenetic regulatory mechanisms controlling cell fate determination....

  4. Mouse cofactor of BRCA1 (Cobra1 is required for early embryogenesis.

    Directory of Open Access Journals (Sweden)

    Asma Amleh

    Full Text Available BACKGROUND: Negative elongation factor (NELF is a four-subunit protein complex conserved from Drosophila to humans. In vitro biochemical and tissue culture-based studies have demonstrated an important role of NELF in controlling RNA polymerase II (Pol II pausing in transcription. However, the physiological significance of NELF function is not clear due to the lack of any genetic systems for studying NELF. PRINCIPAL FINDINGS: Here we show that disruption of the mouse B subunit of NELF (NELF-B, also known as cofactor of BRCA1 (Cobra1, causes inner cell mass (ICM deficiency and embryonic lethality at the time of implantation. Consistent with the phenotype of the Cobra1 knockout (KO embryos, knockdown of Cobra1 in mouse embryonic stem cells (ESCs reduces the efficiency of colony formation and increases spontaneous differentiation. Cobra1-depleted ESCs maintain normal levels of Oct4, Nanog, and Sox2, master regulators of pluripotency in ESCs. However, knockdown of Cobra1 leads to precocious expression of developmental regulators including lymphoid enhancer-binding factor 1 (Lef1. Chromatin immunoprecipitation (ChIP indicates that Cobra1 binds to the Lef1 promoter and modulates the abundance of promoter-bound RNA polymerase. CONCLUSIONS: Cobra1 is essential for early embryogenesis. Our findings also indicate that Cobra1 helps maintain the undifferentiated state of mESCs by preventing unscheduled expression of developmental genes.

  5. Is rapid automatized naming related to reading and mathematics for the same reason(s)? A follow-up study from kindergarten to Grade 1.

    Science.gov (United States)

    Georgiou, George K; Tziraki, Niki; Manolitsis, George; Fella, Argyro

    2013-07-01

    We examined (a) what rapid automatized naming (RAN) components (articulation time and/or pause time) predict reading and mathematics ability and (b) what processing skills involved in RAN (speed of processing, response inhibition, working memory, and/or phonological awareness) may explain its relationship with reading and mathematics. A sample of 72 children were followed from the beginning of kindergarten until the end of Grade 1 and were assessed on measures of RAN, general cognitive ability, speed of processing, attention, working memory, phonological awareness, reading, and mathematics. The results indicated that pause time was the critical component in both the RAN-reading and RAN-mathematics relationships and that it shared most of its predictive variance in reading and mathematics with speed of processing and working memory. Our findings further suggested that, unlike the relationship between RAN and reading fluency in Grade 1, there is nothing in the RAN task that is uniquely related to math. Copyright © 2013 Elsevier Inc. All rights reserved.

  6. A Function for the hnRNP A1/A2 Proteins in Transcription Elongation.

    Directory of Open Access Journals (Sweden)

    Bruno Lemieux

    Full Text Available The hnRNP A1 and A2 proteins regulate processes such as alternative pre-mRNA splicing and mRNA stability. Here, we report that a reduction in the levels of hnRNP A1 and A2 by RNA interference or their cytoplasmic retention by osmotic stress drastically increases the transcription of a reporter gene. Based on previous work, we propose that this effect may be linked to a decrease in the activity of the transcription elongation factor P-TEFb. Consistent with this hypothesis, the transcription of the reporter gene was stimulated when the catalytic component of P-TEFb, CDK9, was inhibited with DRB. While low levels of A1/A2 stimulated the association of RNA polymerase II with the reporter gene, they also increased the association of CDK9 with the repressor 7SK RNA, and compromised the recovery of promoter-distal transcription on the Kitlg gene after the release of pausing. Transcriptome analysis revealed that more than 50% of the genes whose expression was affected by the siRNA-mediated depletion of A1/A2 were also affected by DRB. RNA polymerase II-chromatin immunoprecipitation assays on DRB-treated and A1/A2-depleted cells identified a common set of repressed genes displaying increased occupancy of polymerases at promoter-proximal locations, consistent with pausing. Overall, our results suggest that lowering the levels of hnRNP A1/A2 elicits defective transcription elongation on a fraction of P-TEFb-dependent genes, hence favoring the transcription of P-TEFb-independent genes.

  7. Safety and efficacy of combination therapy of interferon-alpha2 + JAK1-2 Inhibitor in the philadelphia-negative chronic myeloproliferative neoplasms. Preliminary results from the danish combi-trial-an open label, single arm, non-randomized multicenter phase II study

    DEFF Research Database (Denmark)

    Mikkelsen, S. U.; Kjaer, L.; Skov, V.

    2015-01-01

    .4 weeks (range, 3.4 weeks-43.3 weeks). Twenty-seven pts were previously treated with IFNa2 (n=18 intolerant, n=5 unresponsive, n=4 both). Three pts were treatment-naive. Twenty-seven pts (90%) remained on CT; 3 pts discontinued treatment due to an AE. One patient died from transformation to AML shortly......, necessitating pausing medication for > 2 weeks. Eleven SAEs requiring hospitalization were recorded in 9 pts: pneumonia (n=3), fever (n=2), lipotymia, hematemesis, phlebitis, herpes zoster, angina pectoris and arterial hypertension, 1 patient each. Conclusion: CT with IFNa2 and ruxolitinib is highly efficacious...

  8. Genetic suppression reveals DNA repair-independent antagonism between BRCA1 and COBRA1 in mammary gland development.

    Science.gov (United States)

    Nair, Sreejith J; Zhang, Xiaowen; Chiang, Huai-Chin; Jahid, Md Jamiul; Wang, Yao; Garza, Paula; April, Craig; Salathia, Neeraj; Banerjee, Tapahsama; Alenazi, Fahad S; Ruan, Jianhua; Fan, Jian-Bing; Parvin, Jeffrey D; Jin, Victor X; Hu, Yanfen; Li, Rong

    2016-03-04

    The breast cancer susceptibility gene BRCA1 is well known for its function in double-strand break (DSB) DNA repair. While BRCA1 is also implicated in transcriptional regulation, the physiological significance remains unclear. COBRA1 (also known as NELF-B) is a BRCA1-binding protein that regulates RNA polymerase II (RNAPII) pausing and transcription elongation. Here we interrogate functional interaction between BRCA1 and COBRA1 during mouse mammary gland development. Tissue-specific deletion of Cobra1 reduces mammary epithelial compartments and blocks ductal morphogenesis, alveologenesis and lactogenesis, demonstrating a pivotal role of COBRA1 in adult tissue development. Remarkably, these developmental deficiencies due to Cobra1 knockout are largely rescued by additional loss of full-length Brca1. Furthermore, Brca1/Cobra1 double knockout restores developmental transcription at puberty, alters luminal epithelial homoeostasis, yet remains deficient in homologous recombination-based DSB repair. Thus our genetic suppression analysis uncovers a previously unappreciated, DNA repair-independent function of BRCA1 in antagonizing COBRA1-dependent transcription programme during mammary gland development.

  9. Reference: 45 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ntity specification. The floral phenotypes of hua1-1 hua2-1 paused mutants resemble...ntity genes, LEAFY and APETALA1. The developmental defects caused by paused mutatio...to perianth organs in the hua1-1 hua2-1 background, which is partially defective in reproductive organ ide... those of mutations in the floral homeotic gene AGAMOUS. Moreover, paused-5 enhances the mutant phenotypes of two floral meristem ide

  10. Kinetics studies on triacontanyl palmitate: a urease inhibitor.

    Science.gov (United States)

    Lodhi, Muhammad Arif; Abbasi, Muhammad Athar; Choudhary, Muhammad Iqbal; Ahmad, Viqar Uddin

    2007-07-10

    The mechanism of inhibition of jack bean and Bacillus pasteurii ureases was investigated by triacontanyl palmitate (1) which is a long-chain fatty ester and has been isolated from Symplocos racemosa Roxb. Lineweaver-Burk, Dixon plots, and their secondary replots showed that 1 is a non-competitive inhibitor of these enzymes. K(i) values were found to be 60.03 +/- 1.72 and 88.23 +/- 0.31 microM against jack bean and B. pasteurii ureases, respectively.

  11. Detailed analysis of food-reinforced operant lever pressing distinguishes effects of a cannabinoid CB1 inverse agonist and dopamine D1 and D2 antagonists.

    Science.gov (United States)

    McLaughlin, P J; Winston, K M; Swezey, L A; Vemuri, V K; Makriyannis, A; Salamone, J D

    2010-07-01

    Overt similarities exist between the effects of systemic cannabinoid CB1 inverse agonists and dopamine (DA) antagonists on appetitive behavior. The present set of studies was undertaken to apply a fine-grained analysis of food-reinforced operant lever pressing in rats in order to compare the pattern of effects produced by administration of the CB1 inverse agonist AM 251 and those induced by the DA D1 antagonist SKF 83566, and the D2 antagonist raclopride. Three groups of rats were trained on a fixed-ratio 5 (FR5) schedule and administered these compounds over a range of doses expected to suppress responding. All three drugs produced a dose-related suppression of total lever pressing. In addition to main effects of dose, regression analyses were performed to determine which of several response timing- and rate-related variables correlated most strongly with overall responding in each group. It was found that total session time spent pausing from responding was significantly better at predicting responding in the AM 251 group, while both DA antagonists produced significantly stronger regression coefficients (versus AM 251) from fast responding measures. These results suggest that, while several similarities exist, CB1, D1, and D2 antagonists are not identical in their pattern of suppression of food-maintained lever pressing.

  12. The Aversive Agent Lithium Chloride Suppresses Phasic Dopamine Release Through Central GLP-1 Receptors

    Science.gov (United States)

    Fortin, Samantha M; Chartoff, Elena H; Roitman, Mitchell F

    2016-01-01

    Unconditioned rewarding stimuli evoke phasic increases in dopamine concentration in the nucleus accumbens (NAc) while discrete aversive stimuli elicit pauses in dopamine neuron firing and reductions in NAc dopamine concentration. The unconditioned effects of more prolonged aversive states on dopamine release dynamics are not well understood and are investigated here using the malaise-inducing agent lithium chloride (LiCl). We used fast-scan cyclic voltammetry to measure phasic increases in NAc dopamine resulting from electrical stimulation of dopamine cell bodies in the ventral tegmental area (VTA). Systemic LiCl injection reduced electrically evoked dopamine release in the NAc of both anesthetized and awake rats. As some behavioral effects of LiCl appear to be mediated through glucagon-like peptide-1 receptor (GLP-1R) activation, we hypothesized that the suppression of phasic dopamine by LiCl is GLP-1R dependent. Indeed, peripheral pretreatment with the GLP-1R antagonist exendin-9 (Ex-9) potently attenuated the LiCl-induced suppression of dopamine. Pretreatment with Ex-9 did not, however, affect the suppression of phasic dopamine release by the kappa-opioid receptor agonist, salvinorin A, supporting a selective effect of GLP-1R stimulation in LiCl-induced dopamine suppression. By delivering Ex-9 to either the lateral or fourth ventricle, we highlight a population of central GLP-1 receptors rostral to the hindbrain that are involved in the LiCl-mediated suppression of NAc dopamine release. PMID:26211731

  13. Mechanical stretch triggers rapid epithelial cell division through Piezo1.

    Science.gov (United States)

    Gudipaty, S A; Lindblom, J; Loftus, P D; Redd, M J; Edes, K; Davey, C F; Krishnegowda, V; Rosenblatt, J

    2017-03-02

    Despite acting as a barrier for the organs they encase, epithelial cells turn over at some of the fastest rates in the body. However, epithelial cell division must be tightly linked to cell death to preserve barrier function and prevent tumour formation. How does the number of dying cells match those dividing to maintain constant numbers? When epithelial cells become too crowded, they activate the stretch-activated channel Piezo1 to trigger extrusion of cells that later die. However, it is unclear how epithelial cell division is controlled to balance cell death at the steady state. Here we show that mammalian epithelial cell division occurs in regions of low cell density where cells are stretched. By experimentally stretching epithelia, we find that mechanical stretch itself rapidly stimulates cell division through activation of the Piezo1 channel. To stimulate cell division, stretch triggers cells that are paused in early G2 phase to activate calcium-dependent phosphorylation of ERK1/2, thereby activating the cyclin B transcription that is necessary to drive cells into mitosis. Although both epithelial cell division and cell extrusion require Piezo1 at the steady state, the type of mechanical force controls the outcome: stretch induces cell division, whereas crowding induces extrusion. How Piezo1-dependent calcium transients activate two opposing processes may depend on where and how Piezo1 is activated, as it accumulates in different subcellular sites with increasing cell density. In sparse epithelial regions in which cells divide, Piezo1 localizes to the plasma membrane and cytoplasm, whereas in dense regions in which cells extrude, it forms large cytoplasmic aggregates. Because Piezo1 senses both mechanical crowding and stretch, it may act as a homeostatic sensor to control epithelial cell numbers, triggering extrusion and apoptosis in crowded regions and cell division in sparse regions.

  14. Educación para hacer las paces y la transformación pacífica de los conflictos: un análisis filosófico Educació per fer les paus i la transformació pacífica dels conflictes: una anàlisi filosòfica Peace education and the peaceful transformation of conflicts: a philosophical analysis

    Directory of Open Access Journals (Sweden)

    Sonia París Albert

    2013-04-01

    Full Text Available Estas reflexiones filosóficas harán una breve síntesis de la educación para hacer las paces y la transformación pacífica de los conflictos que venimos trabajando desde hace alrededor de 20 años en nuestro Master Universitario y Doctorado Internacional en Estudios de Paz, Conflictos y Desarrollo de la Universidad Jaume I (Castellón, España. La diversidad y pluralidad de nuestro estudiantado y profesorado, nos ha supuesto una concepción dinámica de las corrientes filosóficas, pedagógicas y de investigación de la paz occidentales, que se han sentido interpeladas por el sufrimiento, las prácticas y las conceptualizaciones de estudiantes y profesorado, principalmente de países empobrecidos. Con estos fundamentos estamos trabajando en un giro epistemológico que supera la dicotomía saber dominante-saberes sometidos, aplicando las teorías críticas, los estudios de postdesarrollo, postcoloniales y la perspectiva de género. Así mismo, todo ello os ha llevado a una interpretación de la transformación de los conflictos en la que la potenciación de las capacidades y el reconocimiento se convierten en ejes fundamentales.Coherents amb les idees expressades en la presentació d'aquest número, aquestes reflexions filosòfiques faran una breu síntesi de l'educació per fer les paus i la transformació pacífica dels conflictes que venim treballant vora 20 anys al nostre Màster Universitari i Doctorat Internacional en Estudis de Pau, Conflictes i Desenvolupament de la Universitat Jaume I (Castelló, Espanya. La diversitat i pluralitat del nostre alumnat i professorat ens ha suposat una concepció dinàmica dels corrents filosòfics, pedagògics i d'investigació de la pau occidentals, que s'han sentit interpel·lats, pel sofriment, les pràctiques i les conceptualitzacions d'alumnat i professorat, principalment de països empobrits. Amb aquest rerefons estem treballant en un gir epistemològic que supera la dicotomia saber dominant

  15. Shrinkage of magnetosphere observed by TC-1 satellite during the high-speed solar wind stream

    Institute of Scientific and Technical Information of China (English)

    LI LiuYuan; CAO JinBin; ZHOU GuoCheng; YANG JunYing; YAN ChunXiao; ZHANG TieLong; H. REME; I. DANDOURAS; C. M. CARR

    2008-01-01

    During the interval 06:14-07:30 UT on August 24, 2005, since the Earth's magneto-pause was suddenly compressed by the persistent high-speed solar wind stream with the southward component of the interplanetary magnetic field (IMF), the magnetopause moved Inward for about 3.1 RE. Meanwhile, TC-1 satellite shifted from northern plasma sheet to the northern lobe/mantle region, although it kept Inward flying during the Interval 06:00-07:30UT. The shift of TC-1 from the plasma sheet to the lobe/mantle is caused by the simultaneous inward displacements of the plasma sheet and near-Earth lobe/mantle region, and their inward movement velocity is larger than the inward motion velocity of TC-1. The Joint inward dis-placements of the magnetopause, the lobe/mantle region and the plasma sheet indicate that the whole magnetosphere shrinks inward due to the magnetospheric compression by the high-speed solar wind stream, and the magnetospheric ions are attached to the magnetic field lines (i.e. 'frozen' in magnetic field) and move inward in the shrinking process of magnetosphere. The large shrinkage of magne-tosphere indicates that the near-Earth magnetotail compression caused by the strong solar wind dynamic pressure is much larger than its thickening caused by the southward component of the IMF, and the locations of magnetospheric regions with different plasmas vary remarkably with the variation of the solar wind dynamic pressure.

  16. The impact of language co-activation on L1 and L2 speech fluency.

    Science.gov (United States)

    Bergmann, Christopher; Sprenger, Simone A; Schmid, Monika S

    2015-10-01

    Fluent speech depends on the availability of well-established linguistic knowledge and routines for speech planning and articulation. A lack of speech fluency in late second-language (L2) learners may point to a deficiency of these representations, due to incomplete acquisition. Experiments on bilingual language processing have shown, however, that there are strong reasons to believe that multilingual speakers experience co-activation of the languages they speak. We have studied to what degree language co-activation affects fluency in the speech of bilinguals, comparing a monolingual German control group with two bilingual groups: 1) first-language (L1) attriters, who have fully acquired German before emigrating to an L2 English environment, and 2) immersed L2 learners of German (L1: English). We have analysed the temporal fluency and the incidence of disfluency markers (pauses, repetitions and self-corrections) in spontaneous film retellings. Our findings show that learners to speak more slowly than controls and attriters. Also, on each count, the speech of at least one of the bilingual groups contains more disfluency markers than the retellings of the control group. Generally speaking, both bilingual groups-learners and attriters-are equally (dis)fluent and significantly more disfluent than the monolingual speakers. Given that the L1 attriters are unaffected by incomplete acquisition, we interpret these findings as evidence for language competition during speech production.

  17. MTF-1-mediated repression of the zinc transporter Zip10 is alleviated by zinc restriction.

    Directory of Open Access Journals (Sweden)

    Louis A Lichten

    Full Text Available The regulation of cellular zinc uptake is a key process in the overall mechanism governing mammalian zinc homeostasis and how zinc participates in cellular functions. We analyzed the zinc transporters of the Zip family in both the brain and liver of zinc-deficient animals and found a large, significant increase in Zip10 expression. Additionally, Zip10 expression decreased in response to zinc repletion. Moreover, isolated mouse hepatocytes, AML12 hepatocytes, and Neuro 2A cells also respond differentially to zinc availability in vitro. Measurement of Zip10 hnRNA and actinomycin D inhibition studies indicate that Zip10 was transcriptionally regulated by zinc deficiency. Through luciferase promoter constructs and ChIP analysis, binding of MTF-1 to a metal response element located 17 bp downstream of the transcription start site was shown to be necessary for zinc-induced repression of Zip10. Furthermore, zinc-activated MTF-1 causes down-regulation of Zip10 transcription by physically blocking Pol II movement through the gene. Lastly, ZIP10 is localized to the plasma membrane of hepatocytes and neuro 2A cells. Collectively, these results reveal a novel repressive role for MTF-1 in the regulation of the Zip10 zinc transporter expression by pausing Pol II transcription. ZIP10 may have roles in control of zinc homeostasis in specific sites particularly those of the brain and liver. Within that context ZIP10 may act as an important survival mechanism during periods of zinc inadequacy.

  18. Language-independent talker-specificity in first-language and second-language speech production by bilingual talkers: L1 speaking rate predicts L2 speaking rate.

    Science.gov (United States)

    Bradlow, Ann R; Kim, Midam; Blasingame, Michael

    2017-02-01

    Second-language (L2) speech is consistently slower than first-language (L1) speech, and L1 speaking rate varies within- and across-talkers depending on many individual, situational, linguistic, and sociolinguistic factors. It is asked whether speaking rate is also determined by a language-independent talker-specific trait such that, across a group of bilinguals, L1 speaking rate significantly predicts L2 speaking rate. Two measurements of speaking rate were automatically extracted from recordings of read and spontaneous speech by English monolinguals (n = 27) and bilinguals from ten L1 backgrounds (n = 86): speech rate (syllables/second), and articulation rate (syllables/second excluding silent pauses). Replicating prior work, L2 speaking rates were significantly slower than L1 speaking rates both across-groups (monolinguals' L1 English vs bilinguals' L2 English), and across L1 and L2 within bilinguals. Critically, within the bilingual group, L1 speaking rate significantly predicted L2 speaking rate, suggesting that a significant portion of inter-talker variation in L2 speech is derived from inter-talker variation in L1 speech, and that individual variability in L2 spoken language production may be best understood within the context of individual variability in L1 spoken language production.

  19. Pauses and Intonational Phrasing: ERP Studies in 5-Month-Old German Infants and Adults

    Science.gov (United States)

    Mannel, Claudia; Friederici, Angela D.

    2009-01-01

    In language learning, infants are faced with the challenge of decomposing continuous speech into relevant units, such as syntactic clauses and words. Within the framework of prosodic bootstrapping, behavioral studies suggest infants approach this segmentation problem by relying on prosodic information, especially on acoustically marked…

  20. Acute ischemic heart disease and interventional cardiology: a time for pause

    Directory of Open Access Journals (Sweden)

    Brophy James M

    2006-10-01

    Full Text Available Abstract Background A major change has occurred in the last few years in the therapeutic approach to patients presenting with all forms of acute coronary syndromes. Whether or not these patients present initially to tertiary cardiac care centers, they are now routinely referred for early coronary angiography and increasingly undergo percutaneous revascularization. This practice is driven primarily by the angiographic image and technical feasibility. Concomitantly, there has been a decline in expectant or ischemia-guided medical management based on specific clinical presentation, response to initial treatment, and results of noninvasive stratification. This 'tertiarization' of acute coronary care has been fuelled by the increasing sophistication of the cardiac armamentarium, the peer-reviewed publication of clinical studies purporting to show the superiority of invasive cardiac interventions, and predominantly supporting (non-peer-reviewed editorials, newsletters, and opinion pieces. Discussion This review presents another perspective, based on a critical reexamination of the evidence. The topics addressed are: reperfusion treatment of ST-elevation myocardial infarction; the indications for invasive intervention following thrombolysis; the role of invasive management in non-ST-elevation myocardial infarction and unstable angina; and cost-effectiveness and real world considerations. A few cases encountered in recent practice in community and tertiary hospitals are presented for illustrative purposes The numerous and far-reaching scientific, economic, and philosophical implications that are a consequence of this marked change in clinical practice as well as healthcare, decisional and conflict of interest issues are explored. Summary The weight of evidence does not support the contemporary unfocused broad use of invasive interventional procedures across the spectrum of acute coronary clinical presentations. Excessive and unselective recourse to these procedures has deleterious implications for the organization of cardiac health care and undesirable economic, scientific and intellectual consequences. It is suggested that there is need for a new equilibrium based on more refined clinical risk stratification in the treatment of patients who present with acute coronary syndromes.

  1. Introduction to the contributions of the Symposium "Practice Research in Discussion: a pause for reflection"

    NARCIS (Netherlands)

    Dijkum, van C.; Reijmerink, W.; Wagemakers, A.

    2015-01-01

    In 2011, the Amsterdam University of Applied Science (HvA), the Dutch Organization of Methodology in the Social sciences (NOSMO), and the Alumni Circle Adult Education of Amsterdam University (ACA) organized a symposium about practice-oriented research. An onset to this symposium was that institutio

  2. Press learning: The potential of podcasting through pause, record, play and stop

    Directory of Open Access Journals (Sweden)

    Tara Brabazon

    2016-09-01

    Full Text Available Podcasts are entering their second decade. However, this article does not present a chronological narrative of this history or focus groups exploring their effectiveness. Instead, this paper probes the enlivening capacity of podcasting when inserted into the much wider discourse of sonic media. My research probes the impact on teaching and learning when cutting away four of our five senses to focus on auditory culture, sonic media, hearing and listening. This research shows the value of ‘blind listening,’ cutting away the eyes and visual literacy, to activate more complex modes of learning.

  3. Speech and Pause Characteristics Associated with Voluntary Rate Reduction in Parkinson's Disease and Multiple Sclerosis

    Science.gov (United States)

    Tjaden, Kris; Wilding, Greg

    2011-01-01

    The primary purpose of this study was to investigate how speakers with Parkinson's disease (PD) and Multiple Sclerosis (MS) accomplish voluntary reductions in speech rate. A group of talkers with no history of neurological disease was included for comparison. This study was motivated by the idea that knowledge of how speakers with dysarthria…

  4. Pausing the Classroom Lecture: The Use of Clickers to Facilitate Student Engagement

    Science.gov (United States)

    Dong, Jian-Jie; Hwang, Wu-Yuin; Shadiev, Rustam; Chen, Ginn-Yein

    2017-01-01

    In a big classroom, it is not easy for instructors to be aware of whether or not all students are engaged in the lecture and who has difficulty understanding learning content. One way in which the engagement between instructor/lecturer and students in the classroom is via technology designed to facilitate this. A computer system, making use of…

  5. Pause before a PEG: A feeding tube may not be necessary in every candidate!

    Science.gov (United States)

    Aparanji, Krishna P; Dharmarajan, T S

    2010-07-01

    Percutaneous endoscopic gastrostomies (PEGs) are a means to provide nutrition in older adults incapable of normal adequate nutrient intake. Often decisions to insert a PEG in patients with illness and dementia are made hastily, before exhausting every means of feeding and full evaluation for the potential to regain capacity to feed normally. Further, ethical aspects often cloud such decisions, with data not supporting meaningful long-term improvement in outcomes or quality of life for the recipient of a PEG. Our case illustrates the story of a nursing home resident in whom an organized approach determined a reversible basis for his inability to feed and the potential to avoid tube insertion.

  6. DNA Replication Forks Pause at Silent Origins near the HML Locus in Budding Yeast

    OpenAIRE

    Wang, Yangzhou; Vujcic, Marija; Kowalski, David

    2001-01-01

    Chromosomal replicators in budding yeast contain an autonomously replicating sequence (ARS) that functions in a plasmid, but certain ARSs are silent as replication origins in their natural chromosomal context. In chromosome III, the HML ARS cluster (ARS302-ARS303-ARS320) and ARS301 flank the transcriptionally silent mating-type locus HML, and all of these ARSs are silent as replication origins. ARS301 and ARS302 function in transcriptional silencing mediated by the origin recognition complex ...

  7. Never Say No... How the Brain Interprets the Pregnant Pause in Conversation.

    Directory of Open Access Journals (Sweden)

    Sara Bögels

    Full Text Available In conversation, negative responses to invitations, requests, offers, and the like are more likely to occur with a delay-conversation analysts talk of them as dispreferred. Here we examine the contrastive cognitive load 'yes' and 'no' responses make, either when relatively fast (300 ms after question offset or delayed (1000 ms. Participants heard short dialogues contrasting in speed and valence of response while having their EEG recorded. We found that a fast 'no' evokes an N400-effect relative to a fast 'yes'; however, this contrast disappeared in the delayed responses. 'No' responses, however, elicited a late frontal positivity both if they were fast and if they were delayed. We interpret these results as follows: a fast 'no' evoked an N400 because an immediate response is expected to be positive--this effect disappears as the response time lengthens because now in ordinary conversation the probability of a 'no' has increased. However, regardless of the latency of response, a 'no' response is associated with a late positivity, since a negative response is always dispreferred. Together these results show that negative responses to social actions exact a higher cognitive load, but especially when least expected, in immediate response.

  8. Post-extrasystolic potentiation without a compensatory pause in normal and diseased hearts

    NARCIS (Netherlands)

    Kuijer, P.J.P.; Werf, T. van der; Meijler, F.L.

    1990-01-01

    Variables derived from left ventricular volume were used to study post-extrasystolic potentiation. Left ventriculograms were obtained from 11 healthy individuals and 49 patients with coronary heart disease (30 with a previous myocardial infarction and 19 without any signs of myocardial damage). Post

  9. Yeast genetic analysis reveals the involvement of chromatin reassembly factors in repressing HIV-1 basal transcription.

    Directory of Open Access Journals (Sweden)

    Manuela Vanti

    2009-01-01

    Full Text Available Rebound of HIV viremia after interruption of anti-retroviral therapy is due to the small population of CD4+ T cells that remain latently infected. HIV-1 transcription is the main process controlling post-integration latency. Regulation of HIV-1 transcription takes place at both initiation and elongation levels. Pausing of RNA polymerase II at the 5' end of HIV-1 transcribed region (5'HIV-TR, which is immediately downstream of the transcription start site, plays an important role in the regulation of viral expression. The activation of HIV-1 transcription correlates with the rearrangement of a positioned nucleosome located at this region. These two facts suggest that the 5'HIV-TR contributes to inhibit basal transcription of those HIV-1 proviruses that remain latently inactive. However, little is known about the cell elements mediating the repressive role of the 5'HIV-TR. We performed a genetic analysis of this phenomenon in Saccharomyces cerevisiae after reconstructing a minimal HIV-1 transcriptional system in this yeast. Unexpectedly, we found that the critical role played by the 5'HIV-TR in maintaining low levels of basal transcription in yeast is mediated by FACT, Spt6, and Chd1, proteins so far associated with chromatin assembly and disassembly during ongoing transcription. We confirmed that this group of factors plays a role in HIV-1 postintegration latency in human cells by depleting the corresponding human orthologs with shRNAs, both in HIV latently infected cell populations and in particular single-integration clones, including a latent clone with a provirus integrated in a highly transcribed gene. Our results indicate that chromatin reassembly factors participate in the establishment of the equilibrium between activation and repression of HIV-1 when it integrates into the human genome, and they open the possibility of considering these factors as therapeutic targets of HIV-1 latency.

  10. Codon Optimization to Enhance Expression Yields Insights into Chloroplast Translation1[OPEN

    Science.gov (United States)

    Chan, Hui-Ting; Williams-Carrier, Rosalind; Barkan, Alice

    2016-01-01

    Codon optimization based on psbA genes from 133 plant species eliminated 105 (human clotting factor VIII heavy chain [FVIII HC]) and 59 (polio VIRAL CAPSID PROTEIN1 [VP1]) rare codons; replacement with only the most highly preferred codons decreased transgene expression (77- to 111-fold) when compared with the codon usage hierarchy of the psbA genes. Targeted proteomic quantification by parallel reaction monitoring analysis showed 4.9- to 7.1-fold or 22.5- to 28.1-fold increase in FVIII or VP1 codon-optimized genes when normalized with stable isotope-labeled standard peptides (or housekeeping protein peptides), but quantitation using western blots showed 6.3- to 8-fold or 91- to 125-fold increase of transgene expression from the same batch of materials, due to limitations in quantitative protein transfer, denaturation, solubility, or stability. Parallel reaction monitoring, to our knowledge validated here for the first time for in planta quantitation of biopharmaceuticals, is especially useful for insoluble or multimeric proteins required for oral drug delivery. Northern blots confirmed that the increase of codon-optimized protein synthesis is at the translational level rather than any impact on transcript abundance. Ribosome footprints did not increase proportionately with VP1 translation or even decreased after FVIII codon optimization but is useful in diagnosing additional rate-limiting steps. A major ribosome pause at CTC leucine codons in the native gene of FVIII HC was eliminated upon codon optimization. Ribosome stalls observed at clusters of serine codons in the codon-optimized VP1 gene provide an opportunity for further optimization. In addition to increasing our understanding of chloroplast translation, these new tools should help to advance this concept toward human clinical studies. PMID:27465114

  11. Collaboration of MLLT1/ENL, Polycomb and ATM for transcription and genome integrity.

    Science.gov (United States)

    Ui, Ayako; Yasui, Akira

    2016-04-25

    Polycomb group (PcG) repress, whereas Trithorax group (TrxG) activate transcription for tissue development and cellular proliferation, and misregulation of these factors is often associated with cancer. ENL (MLLT1) and AF9 (MLLT3) are fusion partners of Mixed Lineage Leukemia (MLL), TrxG proteins, and are factors in Super Elongation Complex (SEC). SEC controls transcriptional elongation to release RNA polymerase II, paused around transcription start site. In MLL rearranged leukemia, several components of SEC have been found as MLL-fusion partners and the control of transcriptional elongation is misregulated leading to tumorigenesis in MLL-SEC fused Leukemia. It has been suggested that unexpected collaboration of ENL/AF9-MLL and PcG are involved in tumorigenesis in leukemia. Recently, we found that the collaboration of ENL/AF9 and PcG led to a novel mechanism of transcriptional switch from elongation to repression under ATM-signaling for genome integrity. Activated ATM phosphorylates ENL/AF9 in SEC, and the phosphorylated ENL/AF9 binds BMI1 and RING1B, a heterodimeric E3-ubiquitin-ligase complex in Polycomb Repressive complex 1 (PRC1), and recruits PRC1 at transcriptional elongation sites to rapidly repress transcription. The ENL/AF9 in SEC- and PcG-mediated transcriptional repression promotes DSB repair near transcription sites. The implication of this is that the collaboration of ENL/AF9 in SEC and PcG ensures a rapid response of transcriptional switching from elongation to repression to neighboring genotoxic stresses for DSB repair. Therefore, these results suggested that the collaboration of ENL/AF9 and PcG in transcriptional control is required to maintain genome integrity and may be link to the MLL-ENL/AF9 leukemia.

  12. Numerical study of the coupling between F0 with varied numbers of c-subunits and F1 in an ATP synthase

    Institute of Scientific and Technical Information of China (English)

    Qian Jun; XiePing; Dou Shuo-Xing; Wang Peng-Ye

    2005-01-01

    ATP synthase is a rotary motor which is composed of two portions: the ‘rotor' F0, consisting of a c-ring, and the ‘stator' F1, consisting of an α3β3 hexamer. In different species, the number of c-subunits which form the c-ring is varied from 10 to 14, whereas the α3β3 hexamer is fixed to be 3-fold symmetrical. We have numerically studied the rotational coupling between F0 with varied number of c-subunits and F1. It is found that, for any number of c-subunits,the rotor F0 advances 3 steps per revolution on average, which is determined by the period of F1, whereas the exact angular pausing positions are determined by the period of F0. When the symmetry of the c-ring of F0 is matched with the 3-fold symmetry of F1, the three steps have equivalent sizes. If not matched, the three steps become nonequivalent:both the step size and average dwell time are different for these steps.

  13. The kinesin-13 KLP10A motor regulates oocyte spindle length and affects EB1 binding without altering microtubule growth rates

    Directory of Open Access Journals (Sweden)

    Kevin K. Do

    2014-06-01

    Full Text Available Kinesin-13 motors are unusual in that they do not walk along microtubules, but instead diffuse to the ends, where they remove tubulin dimers, regulating microtubule dynamics. Here we show that Drosophila kinesin-13 klp10A regulates oocyte meiosis I spindle length and is haplo-insufficient – KLP10A, reduced by RNAi or a loss-of-function P element insertion mutant, results in elongated and mispositioned oocyte spindles, and abnormal cortical microtubule asters and aggregates. KLP10A knockdown by RNAi does not significantly affect microtubule growth rates in oocyte spindles, but, unexpectedly, EB1 binding and unbinding are slowed, suggesting a previously unobserved role for kinesin-13 in mediating EB1 binding interactions with microtubules. Kinesin-13 may regulate spindle length both by disassembling subunits from microtubule ends and facilitating EB1 binding to plus ends. We also observe an increased number of paused microtubules in klp10A RNAi knockdown spindles, consistent with a reduced frequency of microtubule catastrophes. Overall, our findings indicate that reduced kinesin-13 decreases microtubule disassembly rates and affects EB1 interactions with microtubules, rather than altering microtubule growth rates, causing spindles to elongate and abnormal cortical microtubule asters and aggregates to form.

  14. Effects of Imagined Interactions and Rehearsal on Speaking Performance

    Science.gov (United States)

    Choi, Charles W.; Honeycutt, James M.; Bodie, Graham D.

    2015-01-01

    Imagined interactions (IIs) constitute a type of social cognition that can reduce fear of communication. Through the mental preparation enabled by IIs, an individual can reduce disfluencies and mitigate the anxiety that arises from a speech. Study 1 indicated that rehearsal influences the reduction of silent pauses but not vocalized pauses. In…

  15. SEGUE 1—A COMPRESSED STAR FORMATION HISTORY BEFORE REIONIZATION

    Energy Technology Data Exchange (ETDEWEB)

    Webster, David; Bland-Hawthorn, Joss [Sydney Institute for Astronomy, School of Physics, University of Sydney, Sydney, NSW 2006 (Australia); Frebel, Anna, E-mail: d.webster@physics.usyd.edu.au [Department of Physics and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)

    2016-02-10

    Segue 1 is the current best candidate for a “first galaxy,” a system that experienced only a single, short burst of star formation and has since remained unchanged. Here we present possible star formation scenarios that can explain Segue 1’s unique metallicity distribution. While the majority of stars in all other ultra-faint dwarfs are within 0.5 dex of the mean [Fe/H] for the galaxy, five of the seven stars in Segue 1 have a spread of Δ[Fe/H]  > 0.8 dex. We show that this distribution of metallicities cannot be explained by a gradual buildup of stars, but instead requires clustered star formation. Chemical tagging allows the separate unresolved delta functions in abundance space to be associated with discrete events in space and time. This provides an opportunity to put the enrichment events into a time sequence and unravel the history of the system. We investigate two possible scenarios for the star formation history of Segue 1 using Fyris Alpha simulations of gas in a 10{sup 7} M{sub ⊙} dark matter halo. The lack of stars with intermediate metallicities −3 < [Fe/H] < −2 can be explained either by a pause in star formation caused by supernova feedback or by the spread of metallicities resulting from one or two supernovae in a low-mass dark matter halo. Either possibility can reproduce the metallicity distribution function (MDF) as well as the other observed elemental abundances. The unusual MDF and the low luminosity of Segue 1 can be explained by it being a first galaxy that originated with M{sub vir} ∼ 10{sup 7}M{sub ⊙} at z ∼ 10.

  16. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  17. Studio 1:1

    Index Scriptorium Estoniae

    2011-01-01

    Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

  18. Shrinkage of magnetosphere observed by TC-1 satellite during the high-speed solar wind stream

    Institute of Scientific and Technical Information of China (English)

    H.; RME; I.; DANDOURAS; C.; M.; CARR

    2008-01-01

    During the interval 06:14―07:30 UT on August 24, 2005, since the Earth’s magneto- pause was suddenly compressed by the persistent high-speed solar wind stream with the southward component of the interplanetary magnetic field (IMF), the magnetopause moved inward for about 3.1 RE. Meanwhile, TC-1 satellite shifted from northern plasma sheet to the northern lobe/mantle region, although it kept inward flying during the interval 06:00―07:30UT. The shift of TC-1 from the plasma sheet to the lobe/mantle is caused by the simultaneous inward displacements of the plasma sheet and near-Earth lobe/mantle region, and their inward movement velocity is larger than the inward motion velocity of TC-1. The joint inward dis-placements of the magnetopause, the lobe/mantle region and the plasma sheet indicate that the whole magnetosphere shrinks inward due to the magnetospheric compression by the high-speed solar wind stream, and the magnetospheric ions are attached to the magnetic field lines (i.e. ‘frozen’ in magnetic field) and move inward in the shrinking process of magnetosphere. The large shrinkage of magne-tosphere indicates that the near-Earth magnetotail compression caused by the strong solar wind dynamic pressure is much larger than its thickening caused by the southward component of the IMF, and the locations of magnetospheric regions with different plasmas vary remarkably with the variation of the solar wind dynamic pressure.

  19. Rapid Synthesis ofMetal-Organic Framework HKUST-1%金属有机框架化合物HKUST-1的快速合成

    Institute of Scientific and Technical Information of China (English)

    游佳勇; 张天永; 刘艳凤; 李彬; 赵振东; 黄俊浩

    2015-01-01

    采用超声波辅助法用一水合醋酸铜、五水合硫酸铜、二水合氯化铜、三水合硝酸铜四种铜盐分别和均苯三酸反应快速制备金属有机框架化合物HKUST-1,探讨了铜盐、三乙胺、超声波作用功率、反应时间、溶剂的配比、加料顺序等因素对HKUST-1产率的影响。结果表明,适宜的反应条件为:醋酸铜8.62 mmol,均苯三酸4.76 mmol,分别溶解于24 mL体积比为111的水、N,N-二甲基甲酰胺、乙醇的混合溶剂中,将两种反应物混合后,添加1 mL三乙胺,在300 W超声功率间歇式(超声2 s,关3 s)作用下反应30 min,可得到产率为99.1%的HKUST-1,所得产物通过XRD、IR进行表征并验证。%Cu(OAc)2·H2O, CuSO4·5H2O, CuCl2·2H2O and Cu(NO3)2·3H2O were individually reacted with benzenetricarboxylic acid under ultrasonication for rapid synthesis of metal-organic framework HKUST-1. The effects of cupric salts, triethylamine, ultrasonic power, reaction time, solvent ratio and reactant addition sequence on the yield of HKUST-1 were investigated. The optimized condition for the preparation of HKUST-1 was found as: Cu(OAc)2·H2O (8.62 mmol) and benzenetricarboxylic acid (4.76 mmol) were firstly individually dissolved in the mixtures of H2O, DMF and ethanol (volume ratio 1:1:1), and the resulted solutions were then mixed together and triethylamine (1 mL) was added. The mixture was then ultrasonicated for 30 min under intermittent ultrasonication(work 2 s, pause 3 s) to generate HKUST-1 with a yield of 99.1%. The samples were characterized by XRD and IR.

  20. HIV-1 frameshift efficiency is primarily determined by the stability of base pairs positioned at the mRNA entrance channel of the ribosome.

    Science.gov (United States)

    Mouzakis, Kathryn D; Lang, Andrew L; Vander Meulen, Kirk A; Easterday, Preston D; Butcher, Samuel E

    2013-02-01

    The human immunodeficiency virus (HIV) requires a programmed -1 ribosomal frameshift for Pol gene expression. The HIV frameshift site consists of a heptanucleotide slippery sequence (UUUUUUA) followed by a spacer region and a downstream RNA stem-loop structure. Here we investigate the role of the RNA structure in promoting the -1 frameshift. The stem-loop was systematically altered to decouple the contributions of local and overall thermodynamic stability towards frameshift efficiency. No correlation between overall stability and frameshift efficiency is observed. In contrast, there is a strong correlation between frameshift efficiency and the local thermodynamic stability of the first 3-4 bp in the stem-loop, which are predicted to reside at the opening of the mRNA entrance channel when the ribosome is paused at the slippery site. Insertion or deletions in the spacer region appear to correspondingly change the identity of the base pairs encountered 8 nt downstream of the slippery site. Finally, the role of the surrounding genomic secondary structure was investigated and found to have a modest impact on frameshift efficiency, consistent with the hypothesis that the genomic secondary structure attenuates frameshifting by affecting the overall rate of translation.

  1. A mutation of the fission yeast EB1 overcomes negative regulation by phosphorylation and stabilizes microtubules

    Energy Technology Data Exchange (ETDEWEB)

    Iimori, Makoto; Ozaki, Kanako [Graduate School of Biostudies, Kyoto University, Kitashirakawa-Oiwake cho, Sakyo ku, Kyoto, 606-8502 (Japan); Chikashige, Yuji [Kobe Advanced ICT Research Center, National Institute of Information and Communications Technology, Kobe, 651-2492 (Japan); Habu, Toshiyuki [Graduate School of Biostudies, Kyoto University, Kitashirakawa-Oiwake cho, Sakyo ku, Kyoto, 606-8502 (Japan); Radiation Biology Center, Kyoto University, Yoshida-Konoe cho, Sakyo ku, Kyoto, 606-8501 (Japan); Hiraoka, Yasushi [Kobe Advanced ICT Research Center, National Institute of Information and Communications Technology, Kobe, 651-2492 (Japan); Graduate School of Frontier Biosciences, Osaka University, 1-3 Yamadaoka, Suita, 565-0871 (Japan); Maki, Takahisa; Hayashi, Ikuko [Graduate School of Nanobioscience, Yokohama City University, Tsurumi, Yokohama, 230-0045 (Japan); Obuse, Chikashi [Graduate School of Life Science, Hokkaido University, Sapporo 001-0021 (Japan); Matsumoto, Tomohiro, E-mail: tmatsumo@house.rbc.kyoto-u.ac.jp [Graduate School of Biostudies, Kyoto University, Kitashirakawa-Oiwake cho, Sakyo ku, Kyoto, 606-8502 (Japan); Radiation Biology Center, Kyoto University, Yoshida-Konoe cho, Sakyo ku, Kyoto, 606-8501 (Japan)

    2012-02-01

    Mal3 is a fission yeast homolog of EB1, a plus-end tracking protein (+ TIP). We have generated a mutation (89R) replacing glutamine with arginine in the calponin homology (CH) domain of Mal3. Analysis of the 89R mutant in vitro has revealed that the mutation confers a higher affinity to microtubules and enhances the intrinsic activity to promote the microtubule-assembly. The mutant Mal3 is no longer a + TIP, but binds strongly the microtubule lattice. Live cell imaging has revealed that while the wild type Mal3 proteins dissociate from the tip of the growing microtubules before the onset of shrinkage, the mutant Mal3 proteins persist on microtubules and reduces a rate of shrinkage after a longer pausing period. Consequently, the mutant Mal3 proteins cause abnormal elongation of microtubules composing the spindle and aster. Mal3 is phosphorylated at a cluster of serine/threonine residues in the linker connecting the CH and EB1-like C-terminal motif domains. The phosphorylation occurs in a microtubule-dependent manner and reduces the affinity of Mal3 to microtubules. We propose that because the 89R mutation is resistant to the effect of phosphorylation, it can associate persistently with microtubules and confers a stronger stability of microtubules likely by reinforcing the cylindrical structure. -- Highlights: Black-Right-Pointing-Pointer We characterize a mutation (mal3-89R) in fission yeast homolog of EB1. Black-Right-Pointing-Pointer The mutation enhances the activity to assemble microtubules. Black-Right-Pointing-Pointer Mal3 is phosphorylated in a microtubule-dependent manner. Black-Right-Pointing-Pointer The phosphorylation negatively regulates the Mal3 activity.

  2. ???????????? ?????? ?????????????????? ???????? 1,2,3-???????? ?? 1?-?????????, ????????? ????????? ??????????????? ??????

    OpenAIRE

    2008-01-01

    ?????????? ?????????? ??????????? ? ???????? ??????? ??????? ????? ???????? 1,2,3-???????? ?? ?????????, ??? ??????????? ?? ???????????? ??????? ??????????????? ??????. ????????? ???? ???????????? ??????? ??????????????? ????(???????)?????? ?? ??????????????? ??????. ?????????? ???????? ??????? ? ?????? ???????? ????? ?????? ???????????????? ???? ?? ?????? ?????????????. ??????????? ???? ???????? ??????? ??????????????? ????(???????)?????? ? ??????????????????? ??-????????? ?????? ?????? (R1C...

  3. Structural Basis for Cooperative Binding of Azoles to CYP2E1 as Interpreted through Guided Molecular Dynamics Simulations

    Science.gov (United States)

    Levy, Joseph W.; Hartman, Jessica H.; Perry, Martin D.; Miller, Grover P.

    2015-01-01

    CYP2E1 metabolizes a wide array of small, hydrophobic molecules, resulting in their detoxification or activation into carcinogens through Michaelis-Menten as well as cooperative mechanisms. Nevertheless, the molecular determinants for CYP2E1 specificity and metabolic efficiency toward these compounds are still unknown. Herein, we employed computational docking studies coupled to Molecular Dynamics simulations to provide a critical perspective for understanding a structural basis for cooperativity observed for an array of azoles from our previous binding and catalytic studies (Hartman, JH et al (2014) Biochem Pharmacol 87, 523-33). The resulting 28 CYP2E1 complexes in this study revealed a common passageway for azoles that included a hydrophobic steric barrier causing a pause in movement toward the active site. The entrance to the active site acted like a second sieve to restrict access to the inner chamber. Collectively, these interactions impacted the final orientation of azoles reaching the active site and hence could explain differences in their biochemical properties observed in our previous studies, such as the consequences of methylation at position 5 of the azole ring. The association of a second azole demonstrated significant differences in interactions stabilizing the bound complex than observed for the first binding event. Intermolecular interactions occurred between the two azoles as well as CYP2E1 residue side chains and backbone and involved both hydrophobic contacts and hydrogen bonds. The relative importance of these interactions depended on the structure of the respective azoles indicating the absence of specific defining criteria for binding unlike the well-characterized dominant role of hydrophobicity in active site binding. Consequently, the structure activity relationships described here and elsewhere are necessary to more accurately identify factors impacting the observation and significance of cooperativity in CYP2E1 binding and catalysis

  4. Agrosearch 1 Vol. 1

    African Journals Online (AJOL)

    Cocoa is sensitive to soil water de?ciency and yields are ... (p<0.1), type of land tenure system used on cocoa farm (p<0.01), price increase of produce. (p<0.01), good harvest ... Social capital status has been reported to be low among cocoa ..... Poverty and The Middle Class: The Nigerian Case National Bureau of. Statistics ...

  5. Budding Yeast Rif1 Controls Genome Integrity by Inhibiting rDNA Replication.

    Science.gov (United States)

    Shyian, Maksym; Mattarocci, Stefano; Albert, Benjamin; Hafner, Lukas; Lezaja, Aleksandra; Costanzo, Michael; Boone, Charlie; Shore, David

    2016-11-01

    The Rif1 protein is a negative regulator of DNA replication initiation in eukaryotes. Here we show that budding yeast Rif1 inhibits DNA replication initiation at the rDNA locus. Absence of Rif1, or disruption of its interaction with PP1/Glc7 phosphatase, leads to more intensive rDNA replication. The effect of Rif1-Glc7 on rDNA replication is similar to that of the Sir2 deacetylase, and the two would appear to act in the same pathway, since the rif1Δ sir2Δ double mutant shows no further increase in rDNA replication. Loss of Rif1-Glc7 activity is also accompanied by an increase in rDNA repeat instability that again is not additive with the effect of sir2Δ. We find, in addition, that the viability of rif1Δ cells is severely compromised in combination with disruption of the MRX or Ctf4-Mms22 complexes, both of which are implicated in stabilization of stalled replication forks. Significantly, we show that removal of the rDNA replication fork barrier (RFB) protein Fob1, alleviation of replisome pausing by deletion of the Tof1/Csm3 complex, or a large deletion of the rDNA repeat array all rescue this synthetic growth defect of rif1Δ cells lacking in addition either MRX or Ctf4-Mms22 activity. These data suggest that the repression of origin activation by Rif1-Glc7 is important to avoid the deleterious accumulation of stalled replication forks at the rDNA RFB, which become lethal when fork stability is compromised. Finally, we show that Rif1-Glc7, unlike Sir2, has an important effect on origin firing outside of the rDNA locus that serves to prevent activation of the DNA replication checkpoint. Our results thus provide insights into a mechanism of replication control within a large repetitive chromosomal domain and its importance for the maintenance of genome stability. These findings may have important implications for metazoans, where large blocks of repetitive sequences are much more common.

  6. Budding Yeast Rif1 Controls Genome Integrity by Inhibiting rDNA Replication.

    Directory of Open Access Journals (Sweden)

    Maksym Shyian

    2016-11-01

    Full Text Available The Rif1 protein is a negative regulator of DNA replication initiation in eukaryotes. Here we show that budding yeast Rif1 inhibits DNA replication initiation at the rDNA locus. Absence of Rif1, or disruption of its interaction with PP1/Glc7 phosphatase, leads to more intensive rDNA replication. The effect of Rif1-Glc7 on rDNA replication is similar to that of the Sir2 deacetylase, and the two would appear to act in the same pathway, since the rif1Δ sir2Δ double mutant shows no further increase in rDNA replication. Loss of Rif1-Glc7 activity is also accompanied by an increase in rDNA repeat instability that again is not additive with the effect of sir2Δ. We find, in addition, that the viability of rif1Δ cells is severely compromised in combination with disruption of the MRX or Ctf4-Mms22 complexes, both of which are implicated in stabilization of stalled replication forks. Significantly, we show that removal of the rDNA replication fork barrier (RFB protein Fob1, alleviation of replisome pausing by deletion of the Tof1/Csm3 complex, or a large deletion of the rDNA repeat array all rescue this synthetic growth defect of rif1Δ cells lacking in addition either MRX or Ctf4-Mms22 activity. These data suggest that the repression of origin activation by Rif1-Glc7 is important to avoid the deleterious accumulation of stalled replication forks at the rDNA RFB, which become lethal when fork stability is compromised. Finally, we show that Rif1-Glc7, unlike Sir2, has an important effect on origin firing outside of the rDNA locus that serves to prevent activation of the DNA replication checkpoint. Our results thus provide insights into a mechanism of replication control within a large repetitive chromosomal domain and its importance for the maintenance of genome stability. These findings may have important implications for metazoans, where large blocks of repetitive sequences are much more common.

  7. H1N1 Influenza

    Science.gov (United States)

    ... Nutrient Shortfall Questionnaire Home Diseases and Conditions H1N1 Influenza H1N1 Influenza Condition Family HealthKids and Teens Share H1N1 ... Contents1. Overview2. Symptoms3. Prevention4. Treatment What is H1N1 influenza?H1N1 influenza (also known as swine flu) is an ...

  8. Prosodic cues enhance rule learning by changing speech segmentation mechanisms

    Directory of Open Access Journals (Sweden)

    Ruth eDe Diego-Balaguer

    2015-09-01

    Full Text Available Prosody has been claimed to have a critical role in the acquisition of grammatical information from speech. The exact mechanisms by which prosodic cues enhance learning are fully unknown. Rules from language often require the extraction of non-adjacent dependencies (e.g. he plays, he sings, he speaks. It has been proposed that pauses enhance learning because they allow computing non-adjacent relations helping word segmentation by removing the need to compute adjacent computations. So far only indirect evidence from behavioral and electrophysiological measures comparing learning effects after exposure to speech with and without pauses support this claim. By recording event-related potentials during the acquisition process of artificial languages with and without pauses between words with embedded non-adjacent rules we provide direct evidence on how the presence of pauses modifies the way speech is processed during learning to enhance segmentation and rule generalisation. The electrophysiological results indicate that pauses as short as 25 ms attenuated the N1 component irrespective of whether learning was possible or not. In addition, a P2 enhancement was present only when learning of non-adjacent dependencies was possible. The overall results support the claim that the simple presence of subtle pauses changed the segmentation mechanism used reflected in an exogenously driven N1 component attenuation and improving segmentation at the behavioral level. This effect can be dissociated from the endogenous P2 enhancement that is observed irrespective of the presence of pauses whenever non-adjacent dependencies are learned.

  9. The effect of the length of to-be-remembered lists and intervening lists on free recall: a reexamination using overt rehearsal.

    Science.gov (United States)

    Ward, Geoff; Tan, Lydia

    2004-11-01

    In 3 experiments, the authors investigated the effects of to-be-remembered (TBR) and intervening list length on free recall to determine whether selective rehearsal could explain the previous finding that recall was affected only by TBR list length. In Experiments 1 (covert rehearsal) and 2 (overt rehearsal), participants saw 5- and 20-word lists and had to recall the list prior to that last presented list. In Experiment 3, either 1 or 2 lists were presented, and recall of TBR list was postcued. Recall proportion decreased with increased TBR list length. Moreover, the authors found extended recency effects when recall was replotted by when words were last rehearsed (Experiments 2 and 3) and an effect of intervening list length when rehearsal was reduced (Experiment 3). ((c) 2004 APA, all rights reserved).

  10. Intermittent motion in desert locusts: behavioural complexity in simple environments.

    Directory of Open Access Journals (Sweden)

    Sepideh Bazazi

    Full Text Available Animals can exhibit complex movement patterns that may be the result of interactions with their environment or may be directly the mechanism by which their behaviour is governed. In order to understand the drivers of these patterns we examine the movement behaviour of individual desert locusts in a homogenous experimental arena with minimal external cues. Locust motion is intermittent and we reveal that as pauses become longer, the probability that a locust changes direction from its previous direction of travel increases. Long pauses (of greater than 100 s can be considered reorientation bouts, while shorter pauses (of less than 6 s appear to act as periods of resting between displacements. We observe power-law behaviour in the distribution of move and pause lengths of over 1.5 orders of magnitude. While Lévy features do exist, locusts' movement patterns are more fully described by considering moves, pauses and turns in combination. Further analysis reveals that these combinations give rise to two behavioural modes that are organized in time: local search behaviour (long exploratory pauses with short moves and relocation behaviour (long displacement moves with shorter resting pauses. These findings offer a new perspective on how complex animal movement patterns emerge in nature.

  11. Encounter rates and swimming behavior of pause-travel and cruise larval fish predators in calm and turbulent laboratory environments

    DEFF Research Database (Denmark)

    MacKenzie, Brian; Kiørboe, Thomas

    1995-01-01

    We observed the feeding and swimming behavior of freely swimming cod (Gadus morhua) and herring (Clupea harengus) larvae in calm and turbulent (epsilon = similar to 7.4 x 10(-8) m(2) s(-3)) laboratory environments at limiting and satiating abundances of Acartia tonsa prey. Attack position rates (...

  12. Effects of erythropoietin on posttraumatic place learning in fimbria-fornix transected rats after a 30-day postoperative pause

    DEFF Research Database (Denmark)

    Malá, Hana; Rodriguez Castro, Maria; Dall Jørgensen, Katrine

    2007-01-01

    constellation in the room was changed. The challenges revealed that, although the EPO-treated lesion group had achieved the same level of task proficiency as the control group, the cognitive mechanisms mediating the task performance in the EPO-treated lesion group (as well as in the saline-treated lesion group......) were dissimilar from those mediating the task in the control group. Both the EPO-treated and the saline-treated lesion group demonstrated an increased dependency on the original cue configuration....

  13. Adolescent girls in Denmark use oral contraceptives at an increasingly young age, and with more pauses and shifts

    DEFF Research Database (Denmark)

    Løkkegaard, Ellen; Nielsen, Anne Kristine

    2014-01-01

    INTRODUCTION: Use of hormonal contraceptives for birth control is commonplace in the Western World. In Europe, there is considerable variety in the frequency of use of hormonal contraceptives and in the age at which these contraceptives are initiated. The purpose of the present study was to descr......INTRODUCTION: Use of hormonal contraceptives for birth control is commonplace in the Western World. In Europe, there is considerable variety in the frequency of use of hormonal contraceptives and in the age at which these contraceptives are initiated. The purpose of the present study...... was to describe the use of hormonal contraceptives among the Danish adolescent female population, focusing on age, period and cohort effects and including types of hormonal contraceptives. MATERIAL AND METHODS: All women aged 14-50 years during the 1995-2012 period were identified through the Central Person...... Register. Furthermore, the National Registry of Medicinal Products Statistics provided information on redeemed prescriptions for hormonal contraceptives characterised by Anatomical-Therapeutic-Chemical (ATC) classification codes. RESULTS: At the age of 17 years, more than 50% of the Danish adolescent...

  14. Structural basis of transcription: Mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA

    OpenAIRE

    Sydow, J.; Brueckner, F.; Cheung, A; Damsma, G.; Dengl, S.; Lehmann, E.; Vassylyev, D.; Cramer, P

    2009-01-01

    We show that RNA polymerase (Pol) II prevents erroneous transcription in vitro with different strategies that depend on the type of DNA,RNA base mismatch. Certain mismatches are efficiently formed but impair RNA extension. Other mismatches allow for RNA extension but are inefficiently formed and efficiently proofread by RNA cleavage. X-ray analysis reveals that a T,U mismatch impairs RNA extension by forming a wobble base pair at the Pol II active center that dissociates the catalytic metal i...

  15. The Effects of Computer-Assisted Pronunciation Readings on ESL Learners' Use of Pausing, Stress, Intonation, and Overall Comprehensibility

    Science.gov (United States)

    Tanner, Mark W.; Landon, Melissa M.

    2009-01-01

    With research showing the benefits of pronunciation instruction aimed at suprasegmentals (Derwing, Munro, & Wiebe, 1997, 1998; Derwing & Rossiter, 2003; Hahn, 2004; McNerney and Mendelsohn, 1992), more materials are needed to provide learners opportunities for self-directed practice. A 13-week experimental study was performed with 75 ESL learners…

  16. Grote botsingen: Wetenschap versus Godsdienst: Grote Conflicten van Copernicus tot Dawkins. College 2. Paus Urbanus VIII contra Galileï

    NARCIS (Netherlands)

    Philipse, H.

    2007-01-01

    These (grote lijn van de volgende 3 colleges): De copernicaanse vernieuwing in de hemelmechanica maakte zowel een nieuwe fysica noodzakelijk als een geheel nieuw Christelijk wereldbeeld; beide werden pas door Newton definitief ontworpen.

  17. Children with Dyslexia Are Slow Writers Because They Pause More Often and Not Because They Are Slow at Handwriting Execution

    Science.gov (United States)

    Sumner, Emma; Connelly, Vincent; Barnett, Anna L.

    2013-01-01

    It is commonly assumed that children with dyslexia are slower at handwriting than other children. However, evidence of slow handwriting in children with dyslexia is very mixed. Thirty-one children with dyslexia, aged 9 years, were compared to both age-matched children and younger spelling-ability matched children. Participants completed an…

  18. Speech and Pause Characteristics in Multiple Sclerosis: A Preliminary Study of Speakers with High and Low Neuropsychological Test Performance

    Science.gov (United States)

    Feenaughty, Lynda; Tjaden, Kris; Benedict, Ralph H. B.; Weinstock-Guttman, Bianca

    2013-01-01

    This preliminary study investigated how cognitive-linguistic status in multiple sclerosis (MS) is reflected in two speech tasks (i.e. oral reading, narrative) that differ in cognitive-linguistic demand. Twenty individuals with MS were selected to comprise High and Low performance groups based on clinical tests of executive function and information…

  19. Grote botsingen: Wetenschap versus Godsdienst: Grote Conflicten van Copernicus tot Dawkins. College 2. Paus Urbanus VIII contra Galileï

    NARCIS (Netherlands)

    Philipse, H.

    2007-01-01

    These (grote lijn van de volgende 3 colleges): De copernicaanse vernieuwing in de hemelmechanica maakte zowel een nieuwe fysica noodzakelijk als een geheel nieuw Christelijk wereldbeeld; beide werden pas door Newton definitief ontworpen.

  20. Decreasing Echolalia of the Instruction "Say" during Echoic Training through Use of the Cues-Pause-Point Procedure

    Science.gov (United States)

    Valentino, Amber L.; Shillingsburg, M. Alice; Conine, Daniel E.; Powell, Nicole M.

    2012-01-01

    Echolalia is common in children with autism and may interfere with the development of functional language. Given the variety of vocal stimuli included in teaching language to children with autism, it is possible that discrimination between instructions and targeted responses may not always occur. Thus, children may engage in very high rates of…

  1. Effects of erythropoietin on posttraumatic place learning in fimbria-fornix transected rats after a 30-day postoperative pause

    DEFF Research Database (Denmark)

    Malá, Hana; Rodriguez Castro, Maria; Dall Jørgensen, Katrine;

    2007-01-01

    Human recombinant erythropoietin (EPO) has been shown to exert neuroprotective effects following both vascular and mechanical brain injury. Previously, we showed that behavioral symptoms associated with mechanical lesions of the hippocampus are nearly abolished due to EPO treatment...

  2. Children with Dyslexia Are Slow Writers Because They Pause More Often and Not Because They Are Slow at Handwriting Execution

    Science.gov (United States)

    Sumner, Emma; Connelly, Vincent; Barnett, Anna L.

    2013-01-01

    It is commonly assumed that children with dyslexia are slower at handwriting than other children. However, evidence of slow handwriting in children with dyslexia is very mixed. Thirty-one children with dyslexia, aged 9 years, were compared to both age-matched children and younger spelling-ability matched children. Participants completed an…

  3. A Cautionary Note on the Thermal Boundary Layer Similarity Scaling for the Turbulent Boundary Layer

    CERN Document Server

    Weyburne, David

    2016-01-01

    Wang and Castillo have developed empirical parameters for scaling the temperature profile of the turbulent boundary layer flowing over a heated wall in the paper X. Wang and L. Castillo, J. Turbul., 4, 1(2003). They presented experimental data plots that showed similarity type behavior when scaled with their new scaling parameters. However, what was actually plotted, and what actually showed similarity type behavior, was not the temperature profile but the defect profile formed by subtracting the temperature in the boundary layer from the temperature in the bulk flow. We show that if the same data and same scaling is replotted as just the scaled temperature profile, similarity is no longer prevalent. This failure to show both defect profile similarity and temperature profile similarity is indicative of false similarity. The nature of this false similarity problem is discussed in detail.

  4. CERN News The Higgs or not the Higgs? Spin will tel... PART 1

    CERN Multimedia

    CERN Visual Media Office; JACQUES FICHET

    2012-01-01

    Following the announcement of the discovery of a new particle made at CERN on July 4, this piece of videonews from CERN explains what is missing to declare that the new boson found at the LHC is actually the Higgs or not and that to finally answer that question precise measurements of the spin of the newly found particle have to be made. Contains interviews to CMS Higgs Searches co-convener, Christopher Paus and theoretician John Ellis.

  5. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  6. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  7. Sequence Classification: 889055 [

    Lifescience Database Archive (English)

    Full Text Available during DNA replication stress, where it forms a replication-pausing complex with Tof1p and is phosphorylated...point protein found at replication forks, required for DNA replication; also required for Rad53p activation

  8. A template-dependent dislocation mechanism potentiates K65R reverse transcriptase mutation development in subtype C variants of HIV-1.

    Directory of Open Access Journals (Sweden)

    Dimitrios Coutsinos

    Full Text Available Numerous studies have suggested that the K65R reverse transcriptase (RT mutation develops more readily in subtype C than subtype B HIV-1. We recently showed that this discrepancy lies partly in the subtype C template coding sequence that predisposes RT to pause at the site of K65R mutagenesis. However, the mechanism underlying this observation and the elevated rates of K65R development remained unknown. Here, we report that DNA synthesis performed with subtype C templates consistently produced more K65R-containing transcripts than subtype B templates, regardless of the subtype-origin of the RT enzymes employed. These findings confirm that the mechanism involved is template-specific and RT-independent. In addition, a pattern of DNA synthesis characteristic of site-specific primer/template slippage and dislocation was only observed with the subtype C sequence. Analysis of RNA secondary structure suggested that the latter was unlikely to impact on K65R development between subtypes and that Streisinger strand slippage during DNA synthesis at the homopolymeric nucleotide stretch of the subtype C K65 region might occur, resulting in misalignment of the primer and template. Consequently, slippage would lead to a deletion of the middle adenine of codon K65 and the production of a -1 frameshift mutation, which upon dislocation and realignment of the primer and template, would lead to development of the K65R mutation. These findings provide additional mechanistic evidence for the facilitated development of the K65R mutation in subtype C HIV-1.

  9. Postextrasystolic sinoatrial exit block in human sick sinus syndrome: demonstration by direct recording of sinus node electrograms.

    Science.gov (United States)

    Asseman, P; Berzin, B; Desry, D; Bauchart, J J; Reade, R; Leroy, O; Poncelet, P; Lekieffre, J; Thery, C

    1991-12-01

    Ten patients with sick sinus syndrome having repetitive sinus node electrograms during long postpacing pauses were studied during programmed atrial stimulation. Sinus node activity was recorded using a percutaneous catheter electrode. A sinus node electrogram was recorded before the return atrial beat in seven patients; it was similar to the sinus node electrogram observed during postpacing pauses and is clearly identified because sinoatrial conduction time was markedly prolonged following the atrial extra beat. Complete sinoatrial exit block occurred in four patients. (1) Sinus node electrograms were thus validated both during postpacing pauses and during programmed atrial stimulation in most patients with sick sinus syndrome. (2) Sinoatrial conduction time was markedly prolonged after one extrasystole, accounting for supracompensatory atrial return cycles. (3) If it were cumulative following multiple extrasystoles, this effect could constitute the electrophysiologic link between an abnormal response during programmed atrial stimulation and the complete sinoatrial block recorded during the pauses that follow rapid atrial pacing.

  10. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    marine water of river Igbokoda in the coastal area of Ondo State, Nigeria. ... humans from contact with sediment was 2.0 μSv.y-1 and 1.2 μSv.y-1 for the fresh and ... affect only a small fraction of the population at any one ... Such pollution.

  11. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    jun N-terminal kinase; hVH, human vaccinia H1 phosphatase; PAC-1, phosphatase of activated cell. 1:MKB .... tumors such as gastric adenocarcinoma, breast cancer, non-small cell ... Activation Pathway for Luteolin-induced Lung. Cancer ...

  12. TRPML1.

    Science.gov (United States)

    Colletti, Grace A; Kiselyov, Kirill

    2011-01-01

    TRPML1 (or mucolipin 1) is the first member of the TRP family of ion channels that was found to function in the lower portions of the endocytic pathway. Mutations in the gene coding for TRPML1 (MCOLN1) cause the lysosomal storage disease mucolipidosis type IV (MLIV). TRPML1 localization in the lysosomes and the similarity of mucolipidosis type IV phenotype to lysosomal storage diseases whose origin has been directly linked to lysosomal dysfunction, suggest that TRPML1 activity drives some vitally important processes within the endocytic machinery. The specific aspect(s) of TRPML1 activity that make it indispensable for the proper function of the endocytic pathway as well as the specific aspect(s) of the endocytic activity that depend on TRPML1 are currently being discussed. Among the candidates are: membrane fusion within the lower portion of the endocytic pathway possibly mediated by Ca(2+) release through TRPML1, or regulation of lysosomal ion homeostasis (pH or Fe content) by TRPML1. In addition to delineating the mechanisms of MLIV pathogenesis, identifying the role of TRPML1 in the endocytic pathway will lead to important developments in our understanding of the endocytic pathway and, due to the neurodegenerative nature of MLIV, of the integrative function of the cell. Moreover, molecular modulators of TRPML1 function may lead to novel approaches to modulating biological processes that depend on the endocytic pathway such as growth factor signaling. The present review will focus on the recent developments in identifying the TRPML1 function.

  13. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Research in Hospitality Management 2011, 1(1): 1–3. Printed in South Africa ... the backdrop of a rapidly evolving industry, the message is of particular significance. Gastronomy is a ... father's restaurant De Echoput. I'm glad that I listened to ...

  14. TRPV1.

    Science.gov (United States)

    Bevan, Stuart; Quallo, Talisia; Andersson, David A

    2014-01-01

    TRPV1 is a well-characterised channel expressed by a subset of peripheral sensory neurons involved in pain sensation and also at a number of other neuronal and non-neuronal sites in the mammalian body. Functionally, TRPV1 acts as a sensor for noxious heat (greater than ~42 °C). It can also be activated by some endogenous lipid-derived molecules, acidic solutions (pH pungent chemicals and food ingredients such as capsaicin, as well as by toxins such as resiniferatoxin and vanillotoxins. Structurally, TRPV1 subunits have six transmembrane (TM) domains with intracellular N- (containing 6 ankyrin-like repeats) and C-termini and a pore region between TM5 and TM6 containing sites that are important for channel activation and ion selectivity. The N- and C- termini have residues and regions that are sites for phosphorylation/dephosphorylation and PI(4,5)P2 binding, which regulate TRPV1 sensitivity and membrane insertion. The channel has several interacting proteins, some of which (e.g. AKAP79/150) are important for TRPV1 phosphorylation. Four TRPV1 subunits form a non-selective, outwardly rectifying ion channel permeable to monovalent and divalent cations with a single-channel conductance of 50-100 pS. TRPV1 channel kinetics reveal multiple open and closed states, and several models for channel activation by voltage, ligand binding and temperature have been proposed. Studies with TRPV1 agonists and antagonists and Trpv1 (-/-) mice have suggested a role for TRPV1 in pain, thermoregulation and osmoregulation, as well as in cough and overactive bladder. TRPV1 antagonists have advanced to clinical trials where findings of drug-induced hyperthermia and loss of heat sensitivity have raised questions about the viability of this therapeutic approach.

  15. Syndecan-1

    DEFF Research Database (Denmark)

    Gonzalez Rodriguez, Erika; Ostrowski, Sisse R; Cardenas, Jessica C

    2017-01-01

    BACKGROUND: Endothelial glycocalyx breakdown elicits syndecan-1 shedding and endotheliopathy of trauma (EoT). We hypothesized that a cutoff syndecan-1 level can identify patients with endothelial dysfunction who would have poorer outcomes. STUDY DESIGN: We conducted a prospective observational st...

  16. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    lesions were not evident in young SHRSP (1-1.5 months of age) before the development of high blood ... the type or classification of the vasculitis (giant cell, periateritis nodosa, etc.) and co-morbidities (lupus, arthritis .... that vasculitic lesions are associated with elevated .... Kempner W, Peschel E, Black-Schaffer B. (1955):.

  17. Alloying effect via comparative studies of ethanol dehydrogenation on Cu(1 1 1), Cu3Pd(1 1 1), and Cu3Pt(1 1 1)

    Science.gov (United States)

    Wu, Ruitao; Wang, Lichang

    2017-06-01

    Ethanol dehydrogenations on Cu(1 1 1), Cu3Pd(1 1 1), and Cu3Pt(1 1 1) were studied using density functional theory with a PBE functional. The α-C-H and β-C-H scissions are endothermic on all surfaces while the O-H scission is exothermic on Cu(1 1 1) and Cu3Pt(1 1 1) but endothermic on Cu3Pd(1 1 1). The ethanol dehydrogenation occurs on Cu(1 1 1) through both α-C-H and O-H scissions but on Cu3Pd(1 1 1) and Cu3Pt(1 1 1) through only α-C-H scission. Furthermore, alloying Pt or Pd with Cu shows an increase in reaction rate at 493 K by more than 3 orders of magnitude, thus illustrating the promise of alloying Pt or Pd in Cu catalysts for ethanol dehydrogenation.

  18. GLP-1

    DEFF Research Database (Denmark)

    Aaboe, Kasper; Krarup, Thure; Madsbad, Sten

    2008-01-01

    Glucagon-like peptide 1 (GLP-1) is a gut-derived incretin hormone with the potential to change diabetes. The physiological effects of GLP-1 are multiple, and many seem to ameliorate the different conditions defining the diverse physiopathology seen in type 2 diabetes. In animal studies, GLP-1...... loss, the ability to preserve functional beta-cell mass and the applicability in other than type 2 diabetes. As such, long-term studies and studies with cardiovascular end-points are needed to confirm the true benefits of these new classes of antidiabetic drugs in the treatment of diabetes mellitus....... and endothelial dysfunction. Enhancing incretin action for therapeutic use includes GLP-1 receptor agonists resistant to degradation (incretin mimetics) and dipeptidyl peptidase (DPP)-4 inhibitors. In clinical trials with type 2 diabetic patients on various oral antidiabetic regimes, both treatment modalities...

  19. TRPA1.

    Science.gov (United States)

    García-Añoveros, J; Nagata, K

    2007-01-01

    The TRPA1 protein has up to 18 N-terminal and presumed cytoplasmic ankyrin repeats followed by the six membrane spanning and single pore-loop domains characteristic of all TRPs. In mice, TRPA1 is almost exclusively expressed in nociceptive neurons of peripheral ganglia and in all the mechanosensory epithelia of inner ear. In nociceptive neurons, TRPA1 mediates the response to the proalgesic bradykinin as well as the response to pungent irritants found in mustards and garlic, and probably also to those found in cinnamon and tear gas. The channel properties of TRPA1 are discussed and compared to those of sensory transducers. TRPA1 is well conserved across the animal kingdom, with likely orthologs from human to nematode, which suggest an ancestral role for this channel, probably in sensation.

  20. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Keywords: Fruits and vegetable intake, Patients with breast cancer, Serum ascorbate. . INTRODUCTION. 1 ... biological systems through the synthesis of hormones, neurotransmitters ... of analysis; serum ascorbate levels were classified as.

  1. ASC-1

    DEFF Research Database (Denmark)

    Jakimoski, Goce; Khajuria, Samant

    2011-01-01

    The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes....... Unfortunately, the use of a block cipher as a building block limits the performance of the authenticated encryption schemes to at most one message block per block cipher evaluation. In this paper, we propose the authenticated encryption scheme ASC-1 (Authenticating Stream Cipher One). Similarly to LEX, ASC-1...... uses leak extraction from diÆerent AES rounds to compute the key material that is XOR-ed with the message to compute the ciphertext. Unlike LEX, the ASC-1 operates in a CFB fashion to compute an authentication tag over the encrypted message. We argue that ASC-1 is secure by reducingits (IND-CCA , INT...

  2. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    2001-02-01

    Feb 1, 2001 ... virtual driving forces are considered: structural adjustments in academic medical centers and academic politics; penetration of ... teaching, research and service is continually queried. In ..... research: from belief to reality.

  3. CHAPTER 1

    African Journals Online (AJOL)

    Dr Olaleye

    Departments of Medical Biochemistry1, Biochemistry2, Anatomy3, University of Benin and Life Sciences4 Texas ... diarrhea, wounds, sore throat and inflamed gums ... This process continued for ... phase II requires one animal per group.

  4. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Research in Hospitality Management 2011, 1(1): 9–17. Printed in ... hospitality industry as well. TripAdvisor is the ... Qatar, Dubai and Abu Dhabi, an industry representative body, .... for the people who invest heavily in a first class hotel and do.

  5. RHM 1(1).indb

    African Journals Online (AJOL)

    mike

    Research in Hospitality Management 2011, 1(1): 25–29. Printed in South Africa ... by which people give meaning to their experiences, especially in new situations. ... managers in this industry also play an important role in the strategic decision ...

  6. 1+1 Gaudin Model

    Directory of Open Access Journals (Sweden)

    Andrei V. Zotov

    2011-07-01

    Full Text Available We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic curve. In sl(2 case we study the equations in detail and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve. We also analyze the 2-site case in its own right and describe its relation to the principal chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  7. 1+1 Gaudin Model

    CERN Document Server

    Zotov, A

    2010-01-01

    We study 1+1 field-generalizations of the rational and elliptic Gaudin models. For sl(N) case we introduce equations of motion and L-A pair with spectral parameter on the Riemann sphere and elliptic cure. In sl(2) case we study the equations in details and find the corresponding Hamiltonian densities. The n-site model describes n interacting Landau-Lifshitz models of magnets. The interaction depends on position of the sites (marked points on the curve). We also analyze the 2-site case in its own right and describe its relation to the principle chiral model. We emphasize that 1+1 version impose a restriction on a choice of flows on the level of the corresponding 0+1 classical mechanics.

  8. Shootin1

    DEFF Research Database (Denmark)

    Toriyama, Michinori; Shimada, Tadayuki; Kim, Ki Bum;

    2006-01-01

    Neurons have the remarkable ability to polarize even in symmetrical in vitro environments. Although recent studies have shown that asymmetric intracellular signals can induce neuronal polarization, it remains unclear how these polarized signals are organized without asymmetric cues. We describe...... a novel protein, named shootin1, that became up-regulated during polarization of hippocampal neurons and began fluctuating accumulation among multiple neurites. Eventually, shootin1 accumulated asymmetrically in a single neurite, which led to axon induction for polarization. Disturbing the asymmetric...... to the growth cones and diffused back to the soma; inhibiting this transport prevented its asymmetric accumulation in neurons. We propose that shootin1 is involved in the generation of internal asymmetric signals required for neuronal polarization....

  9. Osborne 1

    CERN Document Server

    1981-01-01

    The Osborne 1 Released by the Osborne Computer Corporation is considered to be the first true portable, full-featured computer intended for a larger audience than companies. It includes all the components required to be a completely useful and operational computer system. Indeed the Osborne 1 was cost $ 1,795which is now $ 4,773. Another attractive point was that it was sold with several software, which, sold separately, cost almost the same price as the machine. However this computer has some disadvantages like its weight (11 kg) or its tiny screen that could display only a little character per lines and sized the average size of a phone screen . Another problem was that the computer was a bit prone to overheating.

  10. Danida1

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    1996-01-01

    At the request of Danish Ministry of Foreign Affairs, Department TSA.4, electrical testing of possibly damaged cables has been evaluated. This matter concerns three different types of cable, which are10 km 30(36) kV XLPE armoured submarine power cable, 1-phase15 km 30(36) kV XLPE armoured...... underground power cable, 1-phase20 km 10(12) kV XLPE armoured underground power cable, 3-phase.The possible damage of said cables took place during shipment from Denmark to Bangladesh....

  11. Table 1

    African Journals Online (AJOL)

    Fahmy Anwar Shoukry

    2012-02-01

    Feb 1, 2012 ... caneal angles in assessing the fractures of calcaneus and planning treatment has been highlighted. Aim: The ..... 70 manual workers, 25 farmers, 65 office workers, 24 unem- ... ital, or acquired deformity, weakness of the muscle power) were ..... wide ranges probably reduce the utility of calcaneal angles in.

  12. ARTIGO 1

    African Journals Online (AJOL)

    user

    2012-03-22

    Mar 22, 2012 ... selection of populations resistant to pesticides (Yu, 2006;. Yu and McCord .... Extracts from leaves and fruit peels of C. langsdorffii were dissolved .... 75, 125, 250, 500 and 1,000 µg/ml, which were determined in previous tests.

  13. Second-order schedules of token reinforcement: comparisons of performance under fixed-ratio and variable-ratio exchange schedules1

    Science.gov (United States)

    Webbe, Frank M.; Malagodi, E. F.

    1978-01-01

    Rats' lever pressing produced tokens according to a 20-response fixed-ratio schedule. Sequences of token schedules were reinforced under a second-order schedule by presentation of periods when tokens could be exchanged for food pellets. When the exchange period schedule was a six-response fixed ratio, patterns of completing the component token schedules were bivalued, with relatively long and frequent pauses marking the initiation of each new sequence. Altering the exchange period schedule to a six-response variable ratio resulted in sharp reductions in the frequency and duration of these initial pauses, and increases in overall rates of lever pressing. These results are comparable to those ordinarily obtained under simple fixed-ratio and variable-ratio schedules. PMID:16812101

  14. Pentacene on Au(111), Ag(111) and Cu(111): From physisorption to chemisorption

    Science.gov (United States)

    Lu, Meng-Chao; Wang, Rong-Bin; Yang, Ao; Duhm, Steffen

    2016-03-01

    We measured the electronic and the molecular surface structure of pentacene deposited on the (111)-surfaces of coinage metals by means of ultraviolet photoelectron spectroscopy (UPS) and low-energy electron diffraction (LEED). Pentacene is almost flat-lying in monolayers on all three substrates and highly ordered on Au(111) and on Cu(111). On Ag(111), however, weak chemisorption leads to almost disordered monolayers, both, at room temperature and at 78 K. On Cu(111) pentacene is strongly chemisorbed and the lowest unoccupied molecular orbital becomes observable in UPS by a charge transfer from the substrate. On Ag(111) and Cu(111) multilayers adopt a tilted orientation and a high degree of crystallinity. On Au(111), most likely, also in multilayers the molecular short and long axes are parallel to the substrate, leading to a distinctively different electronic structure than on Ag(111) and Cu(111). Overall, it could be demonstrated that the substrate not only determines the geometric and electronic characteristics of molecular monolayer films but also plays a crucial role for multilayer film growth.

  15. 1-Phenylisatin

    Directory of Open Access Journals (Sweden)

    Deepak Shukla

    2011-08-01

    Full Text Available In the title compound, C14H9NO2, the phenyl ring makes a dihedral angle of 50.59 (5° with the mean plane of the isatin fragment. In the crystal, molecules are linked through weak intermolecular C—H...O hydrogen bonds. The crystal structure also exhibits two slipped π–π interactions between the benzene rings of neighbouring molecules [centroid–centroid distance = 3.968 (3 Å, interplanar distance = 3.484 (3 Å and slippage = 1.899 (3 Å], and between the phenyl rings of neighbouring molecules [centroid–centroid distance = 3.968 (3 Å, interplanar distance = 3.638 (3 Å and slippage = 1.584 (3 Å].

  16. Bibliographie1

    OpenAIRE

    2015-01-01

    I. OUVRAGES GÉNÉRAUX A. Droit français B. Droit africain 1°. Droits des pays d’Afrique 2°. Droit de l’O.H.A.D.A. C. Droit comparé en général II. OUVRAGES SPÉCIAUX, THÈSES ET MONOGRAPHIES A. Droit français B. Droit africain 1°. Droits des pays d’Afrique 2°. Droit de l’O.H.A.D.A. C. Droit comparé en général III. RÉPERTOIRES ET OUVRAGES PRATIQUES A. Droit français B. Droit africain C. Droit comparé en général IV. OUVRAGES DE MÉTHODOLOGIE V. ARTICLES ET CHRONIQUES A. Droit français B. Droit afric...

  17. ASC-1

    DEFF Research Database (Denmark)

    Jakimoski, Goce; Khajuria, Samant

    2011-01-01

    The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes. Unfortun......The goal of the modes of operation for authenticated encryption is to achieve faster encryption and message authentication by performing both the encryption and the message authentication in a single pass as opposed to the traditional encrypt-then-mac approach, which requires two passes...... uses leak extraction from diÆerent AES rounds to compute the key material that is XOR-ed with the message to compute the ciphertext. Unlike LEX, the ASC-1 operates in a CFB fashion to compute an authentication tag over the encrypted message. We argue that ASC-1 is secure by reducingits (IND-CCA , INT...

  18. Fengyinzhan 1

    Institute of Scientific and Technical Information of China (English)

    1994-01-01

    Fengyinzhan 1 is a late season indica rice variety with moderate sensitivity to photoperiod. It was from the cross of Qingfengzhan, which is a disease resistant, photopetiod sensitive, late season indica rice variety, and Yinsizhan, which is a photoperiod insensitive, early season indica riCe variety with tenerness and good quality. Its plant area in Guangdong was 33 ha in 1991 and 4,400 ha in 1992.

  19. Mercury(1)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    1.Mercury is the planet closest to the sun.It is thefastest moving planet.And it is the second smallestplanet in our solar system. 2.Mercury is very difficult to see.Its orbit isbetween us and the sun.So,we have to look toward thebright light of the sun to see it.The sunlight usuallyhides Mercury.When we can see it,it appears as a fuzzyball.

  20. Protoexist1

    Science.gov (United States)

    Copete, Antonio; Allen, B.; Hong, J.; Grindlay, J.; Gehrels, N.; Barthelmy, S.; Baker, R.; Apple, J.; Benson, C.; Garson, T.; Krawczynski, H.; McLean, R.; Cook, R.

    2009-01-01

    The ProtoEXIST1 mission, a pathfinder for the EXIST high energy telescope (HET), is slated for a spring 2009 flight out of Ft. Sumner, NM. The ProtoEXIST payload consists of two coded aperture telescopes, each with a 10^ 10^deg field of view and an angular resolution of approximately 10'. One telescope will be outfitted with passive Pb/Sn/Cu rear and side shielding while the other will utilize a rear active CsI anti-coincidence shield and passive side shielding for comparison of background rejection efficiency. The detector plane of each telescope consists of a 8 times 8 large tiled array of 2.04 cm times 2.04 cm CZT detectors, each with thickness of 0.5 cm and a pixilated anode consisting of 2.5 mm pixels. Each detector is read out utilizing the Caltech RADNET ASIC. In total the detector plane of a single telescope measures 16 cm times 16 cm and is sensitive over an energy range of 10 keV up to 500 keV, with an energy resolution of 3.1 keV FWHM at 59 keV. The ProtoEXIST1 flight will validate the use of tiled CZT arrays in flight and pave the way for ProtoEXIST2 which will demonstrate the use of a tiled array of CZT detectors with 0.6 mm pixels.

  1. A 1.5 ns OFF/ON switching-time voltage-mode LVDS driver/receiver pair for asynchronous AER bit-serial chip grid links with up to 40 times event-rate dependent power savings.

    Science.gov (United States)

    Zamarreno-Ramos, Carlos; Kulkarni, Raghavendra; Silva-Martinez, Jose; Serrano-Gotarredona, Teresa; Linares-Barranco, Bernabe

    2013-10-01

    This paper presents a low power fast ON/OFF switchable voltage mode implementation of a driver/receiver pair intended to be used in high speed bit-serial Low Voltage Differential Signaling (LVDS) Address Event Representation (AER) chip grids, where short (like 32-bit) sparse data packages are transmitted. Voltage-Mode drivers require intrinsically half the power of their Current-Mode counterparts and do not require Common-Mode Voltage Control. However, for fast ON/OFF switching a special high-speed voltage regulator is required which needs to be kept ON during data pauses, and hence its power consumption must be minimized, resulting in tight design constraints. A proof-of-concept chip test prototype has been designed and fabricated in low-cost standard 0.35 μ m CMOS. At ± 500 mV voltage swing with 500 Mbps serial bit rate and 32 bit events, current consumption scales from 15.9 mA (7.7 mA for the driver and 8.2 mA for the receiver) at 10 Mevent/s rate to 406 μ A ( 343 μ A for the driver and 62.5 μA for the receiver) for an event rate below 10 Kevent/s, therefore achieving a rate dependent power saving of up to 40 times, while keeping switching times at 1.5 ns. Maximum achievable event rate was 13.7 Meps at 638 Mbps serial bit rate. Additionally, differential voltage swing is tunable, thus allowing further power reductions.

  2. 26 CFR 1.7872-1-1.7872-4 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false 1.7872-1-1.7872-4 Section 1.7872-1-1.7872-4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES General Actuarial Valuations §§ 1.7872-11.7872-4 ...

  3. Main: TEF1BOXATA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 S000311 7-Sep-2000 (last modified) seki tef1 box found in the Arabidops... translational apparatus; EF-1alpha; A1; tef1 box; Arabidopsis (Arabidopsis thaliana) ACAGGGGCATAATGGTAATTTAAA ...

  4. Quiet-time Pc 5 pulsations in the Earth's magnetotail: IMP-8, ISEE-1 and ISEE-3 simultaneous observations

    Directory of Open Access Journals (Sweden)

    D. V. Sarafopoulos

    Full Text Available Quasi-periodic Pc 5 pulsations have been reported inside and just outside the Earth's magnetotail during intervals of low geomagnetic activity. In order to further define their characteristics and spatial extent, we present three case studies of simultaneous magnetic field and plasma observations by IMP-8, ISEE-1 (and ISEE-2 in one case in the Earth's magnetotail and ISEE-3 far upstream of the bow shock, during intervals in which the spacecraft were widely separated. In the first case study, similar pulsations are observed by IMP-8 at the dawn flank of the plasma sheet and by ISEE-1 near the plasma sheet boundary layer (PSBL near midnight local time. In the second case study, simultaneous pulsations are observed by IMP-8 in the dusk magnetosheath and by ISEE-1 and 2 in the dawn plasma sheet. In the third case study, simultaneous pulsations are observed in the north plasma sheet boundary layer and the south plasma sheet. We conclude that the pulsations occur simultaneously throughout much of the nightside magnetosphere and the surrounding magnetosheath, i.e. that they have a global character. Some additional findings are the following: (a the observed pulsations are mixed mode compressional and transverse, where the compressional character is more apparent in the close vicinity of the plane ZGSM=0; (b the compressional pulsations of the magnetic field in the dusk magnetosheath show peaks that coincide (almost one-to-one with similar peaks observed inside the dawn plasma sheet; (c in the second case study the polarization sense of the magnetic field and the recurrent left-hand plasma vortices observed in the dawn plasma sheet are consistent with anti-sunward moving waves on the magneto-pause; (d pulsation amplitudes are weaker in the PSBL(or lobe as compared with those in the magneto-tail's flanks, suggesting a decay with distance from the magnetopause; (e the thickness of the plasma sheet (under extremely quiet

  5. The key role for local base order in the generation of multiple forms of China HIV-1 B'/C intersubtype recombinants

    Directory of Open Access Journals (Sweden)

    Wei Ji-Fu

    2005-10-01

    Full Text Available Abstract Background HIV-1 is a retrovirus with high rate of recombination. Increasing experimental studies in vitro indicated that local hairpin structure of RNA was associated with recombination by favoring RT pausing and promoting strand transfer. A method to estimate the potential to form stem-loop structure by calculating the folding of randomized sequence difference (FORS-D has been used to investigate the relationship between secondary structure and evolutionary pressure in some genome. It showed that gene regions under strong positive "Darwinian" selection were associated with positive FORS-D values. In the present study, the sequences of HIV-1 subtypes B' and C, both of which represent the parent strains of CRF07_BC, CRF08_BC and China URFs, were selected to investigate the relationship between natural recombination and secondary structure by calculating the FORS-D values. Results The apparent higher negative FORS-D value region appeared in the gag-pol gene region (nucleotide 0–3000 of HIV-1 subtypes B' and C. Thirteen (86.7 % of 15 mosaic fragments and 17 (81 % of 21 recombination breakpoints occurred in this higher negative FORS-D region. This strongly suggested that natural recombination did not occur randomly throughout the HIV genome, and that there might be preferred (or hot regions or sites for recombination. The FORS-D analysis of breakpoints showed that most breakpoints of recombinants were located in regions with higher negative FORS-D values (P = 0.0053, and appeared to have a higher negative average FORS-D value than the whole genome (P = 0.0007. The regression analysis also indicated that FORS-D values correlated negatively with breakpoint overlap. Conclusion High negative FORS-D values represent high, base order determined stem-loop potentials and influence mainly the formation of stem-loop structures. Therefore, the present results suggested for the first time that occurrence of natural recombination was associated with

  6. Anticipating and training for the worst-case metabolic scenario: a comment on Del Vecchio, Hirata, and Franchini (2011).

    Science.gov (United States)

    Amtmann, John

    2012-02-01

    Del Vecchio, Hirata, and Franchini (2011) studied the effort: pause ratio of mixed martial arts by analyzing 26 bouts in two separate mixed martial arts events in Sao Paulo, Brazil. They referenced research identifying effort:pause ratios from other combat sports ranging from 10:1 (Brazilian Jiu Jitsu), 2:1 (judo and wrestling), and 1:3/1:4 (taekwondo). The authors identified an effort:pause ratio ranging from 1:2 to 1:4 in the bouts they analyzed, and suggested and described training programs that resemble this ratio. It is important for coaches to anticipate the most challenging metabolic mixed martial arts scenario and to create training programs that mimic that profile. Del Vecchio and associates' research is an important first step in gathering information which can help enhance training programs for injury prevention and performance enhancement.

  7. The effects of the use of piezoelectric motors in a 1.5-Tesla high-field magnetic resonance imaging system (MRI).

    Science.gov (United States)

    Wendt, O; Oellinger, J; Lüth, T C; Felix, R; Boenick, U

    2000-01-01

    This paper presents the results of an experimental investigation with two different rotatory piezomotors in a closed 1.5 Tesla high-field MRI. The focus of the investigation was on testing the functionality of these motors within the MRI and to determining the image interference they caused. To obtain a differentiated estimate of the interference the motors were tested in both the passive (turned off, i.e. without current flow) and active (turned on, i.e. with current flow) state during MRI scanning. Three different types of sequences were used for the test: Spin-Echo (SE), Gradient-Echo (GE) and Echo-Planar Imaging (EPI). A plastic container filled with a gadolinium-manganese solution was used for representation of the artefacts. The motors investigated were placed parallel to the container at predetermined distances during the experiment. The results show that the motors investigated suffered no functional limitations in the magnetic field of the MRI but, depending on the type of motor, the measurement distance and the state of the motor, the motors had different effects on the sequence images. A motor in the off-state placed immediately next to the object to be measured mainly causes artefacts because of its material properties. If, on the other hand, the piezomotor is in the on-state images with strong noise result when the motor is immediately next to the object being measured. The images regain their normal quality when the motor is approximately at a distance of 1 m from the object being investigated. Driving the motor inside the MRI, therefore, is only to be recommended during the pauses in scanning: this delivers artefact-free images if minimal, motor-specific distances are kept to. With regard to the three different types of sequences it was determined that the SE sequence was the least sensitive and the EPI sequence the most sensitive to disturbance. The GE sequence showed only minimal differences to the SE sequence with regard to signal-to-noise ratios

  8. Main: TGA1ANTPR1A [PLACE

    Lifescience Database Archive (English)

    Full Text Available TGA1ANTPR1A S000247 16-Feb-2001 (last modified) seki TGA1a binding site in tobacco ...(N.t.) PR1a gene; as-1-like sequence; Contains two TGACG elements reminiscent of activation sequence-1 (as-1...); See other as-1-like sequences; TGA1a is preferentially expressed in root tip meristems; TGA1a may contrib...ute to the expression of GST isoenzymes, especially in root tip meristems; TGA1a;... as-1; PR1a; xenobiotic stress; root; tip; meristem; tobacco (Nicotiana tabacum) CGTCATCGAGATGACG ...

  9. Tracking of white-tailed deer migration by Global Positioning System

    Science.gov (United States)

    Nelson, M.E.; Mech, L.D.; Frame, P.F.

    2004-01-01

    Based on global positioning system (GPS) radiocollars in northeastern Minnesota, deer migrated 23-45 km in spring during 31-356 h, deviating a maximum 1.6-4.0 km perpendicular from a straight line of travel between their seasonal ranges. They migrated a minimum of 2.1-18.6 km/day over 11-56 h during 2-14 periods of travel. Minimum travel during 1-h intervals averaged 1.5 km/h. Deer paused 1-12 times, averaging 24 h/pause. Deer migrated similar distances in autumn with comparable rates and patterns of travel.

  10. Main: L1DCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1DCPAL1 S000504 15-September-2006 (last modified) kehi L1 element, found in PAL1 p...romoter in carrot (Daucus carota), is a protoplastization (dilution) responsive element; L1 contains Box L-l...ike sequence (ACCTACCC); see also S000492 (BOXL CORE of DC PAL1); L1 Daucus carota (carrot) ATTCACCTACCC ...

  11. 18 CFR 1b.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Definitions. 1b.1 Section 1b.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES RULES RELATING TO INVESTIGATIONS § 1b.1 Definitions. For purposes of this part—...

  12. Highly selective and potent agonists of sphingosine-1-phosphate 1 (S1P1) receptor.

    Science.gov (United States)

    Vachal, Petr; Toth, Leslie M; Hale, Jeffrey J; Yan, Lin; Mills, Sander G; Chrebet, Gary L; Koehane, Carol A; Hajdu, Richard; Milligan, James A; Rosenbach, Mark J; Mandala, Suzanne

    2006-07-15

    Novel series of sphingosine-1-phosphate (S1P) receptor agonists were developed through a systematic SAR aimed to achieve high selectivity for a single member of the S1P family of receptors, S1P1. The optimized structure represents a highly S1P1-selective and efficacious agonist: S1P1/S1P2, S1P1/S1P3, S1P1/S1P4>10,000-fold, S1P1/S1P5>600-fold, while EC50 (S1P1) effect.

  13. Hyper-regulation of pyr-gene expression in Escherichia coli cells with slow ribosomes. Evidence for RNA polymerase pausing in vivo

    DEFF Research Database (Denmark)

    Jensen, Kaj Frank

    1988-01-01

    transcription should terminate or continue into the structural genes. This paper described a study of pyrBI and pyrE gene regulation in cells where the ribosomes move slowly as a result of mutation in rpsL. It appears that expression of the two genes is hyper-regulated by the UTP pool in this type of cells......UTP-modulated attenuation of transcription is involved in regulating the synthesis of pyrimidine nucleotides in Escherichia coli. Thus, expression of two genes, pyrBI and pyrE, was shown to be under this type of control. The genes encode the two subunits of aspartate transcarbamylase and orotate....... Mechanistically this will couple the ribosomes translating a leader peptide gene more tightly to the elongating RNA polymerase. The ribosomes will then be more prone to prevent the folding of the mRNA chains into terminating hairpin structures when RNA polymerase is at the attenuator and has to decide whether...

  14. How to deal with the Poisson-gamma model to forecast patients' recruitment in clinical trials when there are pauses in recruitment dynamic?

    Directory of Open Access Journals (Sweden)

    Nathan Minois

    2017-03-01

    Full Text Available Recruiting patients is a crucial step of a clinical trial. Estimation of the trial duration is a question of paramount interest. Most techniques are based on deterministic models and various ad hoc methods neglecting the variability in the recruitment process. To overpass this difficulty the so-called Poisson-gamma model has been introduced involving, for each centre, a recruitment process modelled by a Poisson process whose rate is assumed constant in time and gamma-distributed. The relevancy of this model has been widely investigated. In practice, rates are rarely constant in time, there are breaks in recruitment (for instance week-ends or holidays. Such information can be collected and included in a model considering piecewise constant rate functions yielding to an inhomogeneous Cox model. The estimation of the trial duration is much more difficult. Three strategies of computation of the expected trial duration are proposed considering all the breaks, considering only large breaks and without considering breaks. The bias of these estimations procedure are assessed by means of simulation studies considering three scenarios of breaks simulation. These strategies yield to estimations with a very small bias. Moreover, the strategy with the best performances in terms of prediction and with the smallest bias is the one which does not take into account of breaks. This result is important as, in practice, collecting breaks data is pretty hard to manage.

  15. 扩展幂级广播方案中的暂停控制%Providing Pause Control for Extended Exponential Broadcasting Scheme

    Institute of Scientific and Technical Information of China (English)

    鄢仁祥; 高远

    2002-01-01

    提出了一种为轮播方案及扩展幂级广播方案(Extended Exponential Broadcasting,EEB)提供暂停控制的技术预缓存技术,该技术通过利用轮播方案和EEB方案的周期性,在客户端增加少量的缓存用于在执行暂停操作时预取部分数据,可以实现实时的暂停和继续操作.与传统的通过开辟额外信道的方法相比,具有资源占用量小,实现简单等特点.

  16. Codon-defined ribosomal pausing in Escherichia coli detected by using the pyrE attenuator to probe the coupling between transcription and translation

    DEFF Research Database (Denmark)

    Bonekamp, Fons; Andersen, Henrik Dalbøge; Christensen, Torkild

    1985-01-01

    This communication describes an assay for the relative translation efficiency of individual codons which makes use of the pyrE attenuator to probe the coupling between transcription and translation at the end of an artificial leader peptide. By cloning of short synthetic DNA fragments the codons ...

  17. The analysis of the basketball coach speech during the moments of game and pause in relation to the performance in competition

    Directory of Open Access Journals (Sweden)

    Jorge Lorenzo

    2013-01-01

    Full Text Available En el ámbito de la competición deportiva profesional, el entrenador es una parte fundamental en la dirección de un equipo y más concretamente en la dirección de partido. Durante la competición, la gestión de los tiempos de pausa y tiempos muertos así como la conducta del entrenador durante los mismos es un aspecto a analizar en el rendimiento deportivo. Es por esto que se hace necesario conocer algunos de los comportamientos que resultan más frecuentes por parte de los entrenadores y que están más relacionados con un rendimiento positivo de sus jugadores. Para ello se ha realizado un estudio de 7 casos de entrenadores expertos en los que se ha observado su comportamiento verbal durante 4 partidos. Se ha centrado en el contenido de la información únicamente a nivel verbal, en su significado. Los datos que se han obtenido en el estudio muestran una mayor cantidad de información elaborada durante las pausas de los partidos y un mayor contenido táctico con respecto a los momentos de juego. Por otro lado, existe una relación entre un mayor número de preguntas y un menor número de instrucciones psicológicas cuando el marcador es adverso, mientras que en el caso de victoria, no existe una relación directa con ninguna categoría. El resto de categorías del discurso no se ven influenciadas directamente por el resultado, por lo que no se puede hablar de una relación directa e inmediata entre las conductas verbales del entrenador durante las pausas y el resultado del partido, salvo en momentos puntuales.

  18. Main: 1OM1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1OM1 トウモロコシ Corn Zea mays L. Casein Kinase Ii, Alpha Chain Name=Ack2; Zea Mays Mole...ELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA corn_1OM1.jpg ...

  19. Main: 1FK1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK1 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK1.jpg ...

  20. Main: L1BOXATPDF1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1BOXATPDF1 S000386 05-November-2005 (last modified) kehi L1 box found in promoter ...of Arabidopsis thaliana (A.t.) PROTODERMAL FACTOR1 (PDF1) gene; Located between -134 and -127; Involved in L...ding motif (Wang et al., 2004); HDZip IV; See also S000371; PDF1; L1 box; L1 layer-specific expression; Shoo

  1. 45 CFR 1220.1-1 - Introduction.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Introduction. 1220.1-1 Section 1220.1-1 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE PAYMENT OF VOLUNTEER LEGAL EXPENSES General § 1220.1-1 Introduction. Section 419 of the Domestic...

  2. 26 CFR 1.72-1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Introduction. 1.72-1 Section 1.72-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Included in Gross Income § 1.72-1 Introduction. (a)...

  3. 26 CFR 1.581-1 - Banks.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Banks. 1.581-1 Section 1.581-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Banking Institutions § 1.581-1 Banks. (a) In order to be a bank as defined in section 581,...

  4. Containment of 0 and 1 in 1(, )

    Indian Academy of Sciences (India)

    Mohsen Alimohammady

    2004-05-01

    Suppose 1(, ) is the space of all absolutely 1-summing operators between two Banach spaces and . We show that if has a copy of 0, then 1(, ) will have a copy of 0, and under some conditions if has a copy of 1 then 1(, ) would have a complemented copy of 1.

  5. Main: 1UD1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UD1 大豆 Soybean Glycine max (L.) Merrill Glycinin G1 Precursor [Contains: Glycinin ...A1a Subunit; Glycinin Bx De Subunit]. Name=Gy1; Glycine Max Molecule: Glycinin G1; Chain: A, B, C; Synonym:

  6. Main: MNF1ZMPPC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MNF1ZMPPC1 S000251 11-Oct-1999 (last modified) kehi MNF1 binding site in maize (Z.m....) Ppc1 (phosphoenolpyruvate carboxylase) gene promoter; Involved in light induction; MNF1; Ppc1; light; leaf; shoot; maize (Zea mays) GTGCCCTT ...

  7. 26 CFR 1.535-1 - Definition.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Definition. 1.535-1 Section 1.535-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Corporations Used to Avoid Income Tax on Shareholders § 1.535-1 Definition. (a)...

  8. Exposure to selective serotonin reuptake inhibitors and the risk of congenital malformations

    DEFF Research Database (Denmark)

    Solem, Espen Victor Jimenez; Andersen, Jon Thor Trærup; Petersen, Morten;

    2012-01-01

    . PARTICIPANTS: Pregnant women in Denmark between 1997 and 2009 and their offspring. PRIMARY OUTCOME MEASURES: For each SSRI, ORs for major congenital malformations were estimated using multivariable logistic regression models for women exposed to an SSRI during the first trimester and for women with paused...... exposure during pregnancy. RESULTS: The authors identified 848¿786 pregnancies; 4183 were exposed to an SSRI throughout the first trimester and 806 pregnancies paused exposure during pregnancy. Risks of congenital malformations of the heart were similar for pregnancies exposed to an SSRI throughout...... the first trimester, adjusted OR 2.01 (95% CI 1.60 to 2.53), and for pregnancies with paused SSRI treatment during pregnancy, adjusted OR 1.85 (95% CI 1.07 to 3.20), p value for difference: 0.94. The authors found similar increased risks of specific congenital malformations of the heart for the individual...

  9. A new route to bicyclo[1.1.1]pentan-1-amine from 1-azido-3-iodobicyclo[1.1.1]pentane.

    Science.gov (United States)

    Goh, Yi Ling; Tam, Eric K W; Bernardo, Paul H; Cheong, Choon Boon; Johannes, Charles W; William, Anthony D; Adsool, Vikrant A

    2014-04-04

    From a medicinal chemistry perspective, bicyclo[1.1.1]pentan-1-amine (1) has served as a unique and important moiety. Synthetically, however, this compound has received little attention, and only one scalable route to this amine has been demonstrated. Reduction of an easily available and potentially versatile intermediate, 1-azido-3-iodobicyclo[1.1.1]pentane (2), can offer both a flexible and scalable alternative to this target. Herein, we describe our scrutiny of this reportedly elusive transformation and report our ensuing success with this endeavor.

  10. Reference: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 Villain P, Clabault G, Mache R, Zhou DX S1F binding site is related to ...but different from the light-responsive GT-1 binding site and differentially represses the spinach rps1 prom

  11. Main: SB1NPABC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SB1NPABC1 S000435 27-Jan-2004 (last modified) kehi Sclareol box1 (SB1) found at -82...7 of a plasma membrane ATP binding cassette (ABC) transporter gene (NpABC1) in N. plumbaginifolia; Mutation ...in SB3 completely abolished sclareolide-mediated expression; See S ; scalareol; diterpene; ABC; transporter; Nicotiana plumbaginifolia (tobacco); CACTAACACAAAGTAA ...

  12. Main: CCA1ATLHCB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CCA1ATLHCB1 S000149 10-May-1998 (last modified) kehi CCA1 binding site; CCA1 protei...n (myb-related transcription factor) interact with two imperfect repeats of AAMAATCT in Lhcb1*3 gene of Arab

  13. 1 CFR 3.1 - Information services.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Information services. 3.1 Section 3.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER GENERAL SERVICES TO THE PUBLIC § 3.1 Information services. Except in cases where the time required would be excessive, information concerning...

  14. USEEIO v1.1 - Matrices

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset provides the basic building blocks for the USEEIO v1.1 model and life cycle results per $1 (2013 USD) demand for all goods and services in the model in...

  15. Angle-resolved photoemission study of Ag(1 1 1)

    Science.gov (United States)

    Edamoto, K.; Miyazaki, E.; Shimokoshi, K.; Kato, H.

    1990-01-01

    The (1 1 1) face of Ag has been studied by angle-resolved photoemission spectroscopy utilizing synchrotron radiation as the excitation source (25 FIRO method. The peak positions thus determined are used to map the dispersion curves along the lang1 1 1rang (Γ-L) direction. The results show general agreement with calculated band structure, so far as the energy levels and symmetries are concerned. However, it is found that the density of state effect is dominant in the spectra obtained in the present photon energy region. The emission from the Ag 5s, p bands is observed to be broadened due to the indirect transition process.

  16. Main: JASE1ATOPR1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available JASE1ATOPR1 S000388 20-Feb-2002 (last modified) uchi JASE1found in promoter of Arab...ed in up-regulation by both senescence and JA; OPR1; senescence; Jasmonic acid; JASE1; JASE2; leaf; Arabidopsis thaliana CGTCAATGAA ... ...idopsis thaliana 12-oxo-phytodienoic acid-10,11-reductase (OPR1) gene; Located between -179 and -170; Involv

  17. APE1/Ref-1: versatility in progress.

    Science.gov (United States)

    Jeon, Byeong Hwa; Irani, Kaikobad

    2009-03-01

    Apurinic/apyrimidinic endonuclease1/redox factor-1 (APE1/Ref-1) is a multifunctional protein involved in base excision DNA repair and in transcriptional regulation of gene expression. Over the past decade and a half, knowledge of the biological functions, interactions, mechanisms of action, and regulation of the protein APE1/Ref-1 has grown exponentially. The multifunctional nature of APE1/Ref-1 is uncovering and has been extensively studied in the cellular response against oxidative stress. Recent evidence shows a biological role of APE1/Ref-1 can be modulated by the different post-translational modification. Because of APE1/Ref-1 importance to genomic stability and cell survival, APE1/Ref-1 is focused as the leading therapeutic target molecule for the oxidative stress condition or pathologic conditions such as cancer. This forum, dedicated to APE1/Ref-1, provides ample testimony that even though we have learned a great deal about APE1/Ref-1 over the past 15-plus years, our knowledge still constitutes the tip of the iceberg when it comes to understanding this versatile protein.

  18. The pattern of exposure to static magnetic field of nurses involved in activities related to contrast administration into patients diagnosed in 1.5 T MRI scanners.

    Science.gov (United States)

    Karpowicz, Jolanta; Gryz, Krzysztof

    2013-06-01

    Static magnetic fields (SMFs) and time-varying electromagnetic fields exposure is necessary to obtain the diagnostic information regarding the structure of patient's tissues, by the use of magnetic resonance imaging (MRI) scanners. A diagnostic procedure may also include the administration of pharmaceuticals called contrast, which are to be applied to a patient during the examination. The nurses involved in administering contrast into a patient during the pause in examination are approaching permanently active magnets of MRI scanners and are exposed to SMF. There were performed measurements of spatial distribution of SMF in the vicinity of MRI magnets and parameters of personal exposure of nurses (i.e. individual exposimetric profiles of variability in time of SMF affecting the nurse who is performing tasks in the vicinity of magnet, characterized by statistical parameters of recorded magnetic flux density affecting the nurse). The SMF exposure in the vicinity of various MRI magnets depends on both magnetic flux density of the main field B 0 (applicable to a patient) and the construction of the scanner, but the most important factor determining the workers' exposure is the work practice. In the course of a patient's routine examination in scanners of B₀ = 1.5 T, the nurses are present over ∼0.4-2.9 min in SMF exceeding 0.03% of B₀ (i.e. 0.5 mT), but only sometimes they are present in SMF exceeding 5% of B 0 (i.e. 75 mT). When patients need more attention because of their health status/condition, the nurses' exposure may be significantly longer--it may even exceed 10 min and 30% of B 0 (i.e. 500 mT). We have found that the level of exposure of nurses to SMF may vary from field (a median value: 0.5-1.5%; inter-quartile range: 0.04-8.8%; max value: 1.3-12% of B₀) when a patient is moved from the magnets bore before contrast administration, up to the main field level (B₀) when a patient stays in the magnets bore and nurse is crawling into the bore.

  19. Variant Humicola grisea CBH1.1

    Energy Technology Data Exchange (ETDEWEB)

    Goedegebuur, Frits; Gualfetti, Peter; Mitchinson, Colin; Larenas, Edmund

    2017-05-09

    Disclosed are variants of Humicola grisea CeI7A (CBH1.1), H. jecorina CBH1 variant or S. thermophilium CBH1, nucleic acids encoding the same and methods for producing the same. The variant cellulases have the amino acid sequence of a glycosyl hydrolase of family 7A wherein one or more amino acid residues are substituted.

  20. Superconformal SU(1, 1|n) mechanics

    Science.gov (United States)

    Galajinsky, Anton; Lechtenfeld, Olaf

    2016-09-01

    Recent years have seen an upsurge of interest in dynamical realizations of the superconformal group SU(1, 1|2) in mechanics. Remarking that SU(1, 1|2) is a particular member of a chain of supergroups SU(1, 1| n) parametrized by an integer n, here we begin a systematic study of SU(1, 1| n) multi-particle mechanics. A representation of the superconformal algebra su(1, 1| n) is constructed on the phase space spanned by m copies of the (1, 2 n, 2 n-1) supermultiplet. We show that the dynamics is governed by two prepotentials V and F, and the Witten-Dijkgraaf-Verlinde-Verlinde equation for F shows up as a consequence of a more general fourth-order equation. All solutions to the latter in terms of root systems reveal decoupled models only. An extension of the dynamical content of the (1, 2 n, 2 n-1) supermultiplet by angular variables in a way similar to the SU(1, 1|2) case is problematic.

  1. Main: SITE1SORPS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SITE1SORPS1 S000211 11-May-2006 (last modified) kehi Site 1 in the spinach (S.o.) r...er; Related to GT elements; For a compilation of related GT elements and factors, see Villain et al. (1996); See S000215 (S1FSOR

  2. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  3. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1970-01-01

    The reaction of dipotassium 2-nitroethylene-1,1-dithiolate (III) with α-halogeno aldehydes or ketones leads to derivatives of 3-nitro-thiophene-2-thiols. These reactions proceed by an acid catalyzed cyclization of the initially formed 1-(acylmethylthio)-2-nitroethylene-1-thiolates (IV). The infra...

  4. Superconformal SU(1,1|n) mechanics

    CERN Document Server

    Galajinsky, Anton

    2016-01-01

    Recent years have seen an upsurge of interest in dynamical realizations of the superconformal group SU(1,1|2) in mechanics. Remarking that SU(1,1|2) is a particular member of a chain of supergroups SU(1,1|n) parametrized by an integer n, here we begin a systematic study of SU(1,1|n) multi-particle mechanics. A representation of the superconformal algebra su(1,1|n) is constructed on the phase space spanned by m copies of the (1,2n,2n-1) supermultiplet. We show that the dynamics is governed by two prepotentials V and F, and the Witten-Dijkgraaf-Verlinde-Verlinde equation for F shows up as a consequence of a more general fourth-order equation. All solutions to the latter in terms of root systems reveal decoupled models only. An extension of the dynamical content of the (1,2n,2n-1) supermultiplet by angular variables in a way similar to the SU(1,1|2) case is problematic.

  5. Endovascular treatment of penetrating ulcers of the paraceliac aorta using fenestrated endografts.

    Science.gov (United States)

    Gargiulo, Mauro; Gallitto, Enrico; Freyrie, Antonio; Stella, Andrea

    2014-04-01

    Penetrating atherosclerotic ulcers (PAUs) are usually focal aortic lesions found in patients with significant comorbidities. They are ideal targets for an endovascular approach if localized in the descending thoracic or infrarenal aorta, but when an origin in the visceral vessels is involved, a standard endovascular approach might not be feasible or effective. We report 2 cases of endovascular treatment of PAUs involving the paraceliac abdominal aorta, using a custom-made tube fenestrated endograft with 4 fenestrations for the abdominal visceral vessels (i.e., celiac-trunk, superior mesenteric artery, and renal arteries). There were no intra- or perioperative complications. At 1 year of follow-up, patients were asymptomatic and computed tomography angiography revealed total lesion exclusion and patency of the visceral vessels. The use of a fenestrated endograft is a safe and effective option to treat paraceliac PAUs.

  6. Adsorption and hydrogenation of CO on Pd( 1 1 1 ) and Rh( 1 1 1 ) modified by subsurface vanadium

    Science.gov (United States)

    Klötzer, Bernhard; Unterberger, Werner; Hayek, Konrad

    2003-06-01

    On Pd(1 1 1) and Rh(1 1 1) a subsurface alloy of V atoms located mainly in the second metal layer is formed by vapor deposition of V at elevated temperatures. The topmost layer consists exclusively of Pd or Rh atoms in √3×√3 R30° geometry. Neither reversible adsorption of CO under UHV conditions nor hydrogenation of CO at atmospheric pressure lead to surface segregation of V compounds. Numerical simulation and threshold temperature programmed desorption analysis of CO TPD series obtained from the clean and V modified samples showed that the presence of subsurface V significantly reduces the desorption energy of molecular CO over a wide coverage range and changes the coverage-dependence of the desorption energy. The presence of subsurface V atoms promotes CO hydrogenation on both Pd(1 1 1) and Rh(1 1 1). The enhanced catalytic activity is interpreted in view of the reduced CO desorption energies and of surface roughening induced by subsurface alloy growth.

  7. Main: 1TE1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1TE1 小麦 Bread Wheat Triticum aestivum Xylanase Inhibitor Protein I Precursor. Name=...Xipi; Triticum Aestivum Molecule: Xylanase Inhibitor Protein I; Chain: A; Synonym: Xip-1; Molecule: Endo-1,4-Xylanase; Chain...: B; Synonym: Gh11; Engineered: Yes Hydrolase Inhibitor/Hydrolase 3.2.1.8 (Endo-1,4-Xylanase...rand, P.Manzanares, H.J.Gilbert, N.Juge, A.Roussel The Dual Nature Of The Wheat Xylanase Protein Inhibitor X

  8. XBZ1, XBJ1 Intelligent Transformer Substation

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    After conducting in-depth studies on and making improvements to the operational conditions of the current transformer substation, the advanced technology of the XBZ1 intelligent transformer substation and XBJ1 pre-installed transformer

  9. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1972-01-01

    A series of thieno[3,2-e]-3,4-dihydro-1,2,3-triazin-4-ones (V) and thieno[3,4-e]-3,4-dihydro-1,2,3-triazin-4-ones (VI) were prepared by diazotation of 3-aminothiophene-2-carboxamides (III) and 4-amino-thiophene-3-carboxamides (IV), respectively, both obtained by cyclization of 2-cyanoethylene-1,1...

  10. The chemistry of 1,1-dithiolates

    DEFF Research Database (Denmark)

    1972-01-01

    A series of thieno[3,2-e]-3,4-dihydro-1,2,3-triazin-4-ones (V) and thieno[3,4-e]-3,4-dihydro-1,2,3-triazin-4-ones (VI) were prepared by diazotation of 3-aminothiophene-2-carboxamides (III) and 4-amino-thiophene-3-carboxamides (IV), respectively, both obtained by cyclization of 2-cyanoethylene-1,1...

  11. Main: ELRE1PCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available light response elements (LRE) found in the parsley (P.c.) phenylalanine ammonia-lyase (PAL-1) gene promoter... See S000307; phenylalanine ammonia-lyase (PAL); UV; elicitor; light; leaf; shoot; parsley (Petroselinum crispum) CTCCAACAAACCCCTTC ... ...ELRE1PCPAL1 S000306 10-Feb-2000 (last modified) seki One of two elicitor (ELRE) and

  12. USEEIOv1.1 - openLCA

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is a version of the full USEEIO v1.1 model in the openLCA schema serialized as JSON-LD that can be imported into openLCA software (www.openlca.org) v1.5 and...

  13. Reference: L1DCPAL1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available L1DCPAL1 Takeda J, Ito Y, Maeda K, Ozeki Y. Assignment of UVB-responsive cis-elemen...anine ammonia-lyase gene (gDcPAL1). Photochem Photobiol. 76:232-238 (2002). PubMed: 12194222 ...

  14. Reference: MNF1ZMPPC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MNF1ZMPPC1 Morishima A Identification of preferred binding sites of a light-inducib...le DNA-binding factor (MNF1) within 5'-upstream sequence of C4-type phosphoenolpyruvate carboxylase gene in maize Plant Mol Biol 38:633-646 (1998) PubMed: 9747808; ...

  15. Reference: SB1NPABC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SB1NPABC1 Grec S, Vanham D, de Ribaucourt J, Purnelle B, Boutry P. Identification o...f regulatory sequence elements within the transcription promoter region of NpABC1, a gene encoding a plant ABC

  16. Main: GARE1OSREP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available GARE1OSREP1 S000419 28-November-2004 (last modified) kehi Gibberellin-responsive element (GARE...) found in the promoter region of a cystein proteinase (REP-1) gene in rice; See S000020; aleurone; GARE; gibberellin; seed; Oryza sativa (rice) TAACAGA ...

  17. Effect of Erbium substitution on temperature and field dependence of thermally activated flux flow resistance in Bi-2212 superconductor

    Science.gov (United States)

    Paladhi, D.; Mandal, P.; Sahoo, R. C.; Giri, S. K.; Nath, T. K.

    2016-12-01

    Thermally activated flux flow (TAFF) regime of Er doped Bi2Sr2Ca1-xErxCu2O8+δ (x=0.0, 0.1, 0.3) polycrystalline systems have been investigated using magneto-transport measurements up to 70 kOe magnetic field. High quality single phase samples have been prepared by standard solid state reaction method. The activation energy or pinning strength (U0) have been calculated using thermally activated flux flow (TAFF) model by linear fitting from the semi-logarithmic curve of ln ρ vs 1/T. It has been observed that activation energy (U0) decreases with Er substitution and U0 follows power law dependence with magnetic field for all three samples. Irreversibility lines (IL) have been drawn from the magneto-transport data for all three samples and it is observed that IL shifts to lower temperature with higher Er concentration. It is confirmed from the above results that pinning strength becomes weaker with Er doping. Finally, the variation of U0 have been shown with temperature by re-plotting -T(ln (ρ/ρ100)) vs T for three samples showing non-linear dependence with temperature.

  18. Cuba vs H1N1 Influenza

    Directory of Open Access Journals (Sweden)

    Gail Reed

    2011-04-01

    Full Text Available El Comité Editorial de MediSur agradece a Gail Reed, editora de Medicc Review la autorización expresa, para reproducir el artículo titulado “Cuba vs H1N1 Influenza”. Este trabajo resume el esfuerzo realizado por todos los organismos en Cuba y en especial el Ministerio de Salud Pública en la lucha para disminuir los efectos de la influenza H1N1 en la población. El artículo original se puede encontrar en: Reed G. Faceoff: Cuba vs H1N1 Influenza. MEDICC Review. 2010; 12(1:6-12. Disponible en: http://www.medicc.org/mediccreview/index.php?issue=11

  19. Short-term effects of implemented high intensity shoulder elevation during computer work

    Directory of Open Access Journals (Sweden)

    Madeleine Pascal

    2009-08-01

    Full Text Available Abstract Background Work-site strength training sessions are shown effective to prevent and reduce neck-shoulder pain in computer workers, but difficult to integrate in normal working routines. A solution for avoiding neck-shoulder pain during computer work may be to implement high intensity voluntary contractions during the computer work. However, it is unknown how this may influence productivity, rate of perceived exertion (RPE as well as activity and rest of neck-shoulder muscles during computer work. The aim of this study was to investigate short-term effects of a high intensity contraction on productivity, RPE and upper trapezius activity and rest during computer work and a subsequent pause from computer work. Methods 18 female computer workers performed 2 sessions of 15 min standardized computer mouse work preceded by 1 min pause with and without prior high intensity contraction of shoulder elevation. RPE was reported, productivity (drawings per min measured, and bipolar surface electromyography (EMG recorded from the dominant upper trapezius during pauses and sessions of computer work. Repeated measure ANOVA with Bonferroni corrected post-hoc tests was applied for the statistical analyses. Results The main findings were that a high intensity shoulder elevation did not modify RPE, productivity or EMG activity of the upper trapezius during the subsequent pause and computer work. However, the high intensity contraction reduced the relative rest time of the uppermost (clavicular trapezius part during the subsequent pause from computer work (p Conclusion Since a preceding high intensity shoulder elevation did not impose a negative impact on perceived effort, productivity or upper trapezius activity during computer work, implementation of high intensity contraction during computer work to prevent neck-shoulder pain may be possible without affecting the working routines. However, the unexpected reduction in clavicular trapezius rest during a

  20. Prism. Volume 1, Number 1, December 2009

    Science.gov (United States)

    2009-12-01

    Susan B. Epstein , U.S. Embassy in Iraq (Washington, DC: CRS, October 24, 2006), figure 1. 18 The “clear-hold-build” approach to counterinsurgency is...staff of other agencies, such as the Coast Guard, Central Intelligence Agency, and National Security Agency. See Edward F. Bruner, “Military Forces...Reconstruction Roles, ed. Joseph Cerami and Jay Boggs (Carlisle, PA: Strategic Studies Institute, 2007). 102 | leSSoNS leaRNed PRISM 1, no. 1 10

  1. A numerical method for analysis of in vitro time-dependent inhibition data. Part 2. Application to experimental data.

    Science.gov (United States)

    Korzekwa, Ken; Tweedie, Donald; Argikar, Upendra A; Whitcher-Johnstone, Andrea; Bell, Leslie; Bickford, Shari; Nagar, Swati

    2014-09-01

    Time-dependent inhibition (TDI) of cytochrome P450 enzymes is an important cause of drug-drug interactions. The standard approach to characterize the kinetics of TDI is to determine the rate of enzyme loss, kobs, at various inhibitor concentrations, [I], and replot the kobs versus [I] to obtain the key kinetic parameters, KI and kinact. In our companion manuscript (Part 1; Nagar et al., 2014) in this issue of Drug Metabolism and Disposition, we used simulated datasets to develop and test a new numerical method to analyze in vitro TDI data. Here, we have applied this numerical method to five TDI datasets. Experimental datasets include the inactivation of CYP2B6, CYP2C8, and CYP3A4. None of the datasets exhibited Michaelis-Menten-only kinetics, and the numerical method allowed use of more complex models to fit each dataset. Quasi-irreversible as well as partial inhibition kinetics were observed and parameterized. Three datasets required the use of a multiple-inhibitor binding model. The mechanistic and clinical implications provided by these analyses are discussed. Together with the results in Part 1, we have developed and applied a new numerical method for analysis of in vitro TDI data. This method appears to be generally applicable to model in vitro TDI data with atypical and complex kinetic schemes.

  2. In-situ monitoring of nickel electrodeposit structure using electrochemical noise technique

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The nickel electroplating process was investigated by means of electrochemical noise(EN), cyclic voltammetry in conjunction with the scanning electron microscopy(SEM) technique. The results show that, in the experimental conditions and with the increase of current density, the growth mechanism of nickel crystallites changes from 2-D to 3-D with the potential turning point of about - 1.15 V,and the potential for the onset of diffusion control of the ensemble nickel electroplating process was about -1.4 V. In the case of activation-control, the two-dimensional (2-D) nucleation / growth process of nickel often results in the electrocrystallization EN features of only slowly small positive potential drift and the corresponding compact layer-by-layer deposit structure, and the maximum relative energy of the RP-EDP (re-plotted relative energy distribution plot), which is obtained from wavelet analysis, defined in the region with smaller scales. While under the diffusion-control, the three-dimensional (3-D) nucleation / growth process of nickel, often results in the electrocrystallization EN features of both the fast positive potential drift and subsequent remarkable negative potential drift and the corresponding dentritic/large conglomerate structure of nickel deposit, and the maximum relative energy of the RP-EDP defined in the region with larger scales. The electroplating time affects the nickel deposit structure mainly through its influence on the growth rate of crystallites and the Ni2+ ions diffusion process around each crystallite.

  3. The ubiquitin ligase STUB1 regulates stability and activity of RUNX1 and RUNX1-RUNX1T1.

    Science.gov (United States)

    Yonezawa, Taishi; Takahashi, Hirotaka; Shikata, Shiori; Liu, Xiaoxiao; Tamura, Moe; Asada, Shuhei; Fukushima, Tsuyoshi; Fukuyama, Tomofusa; Tanaka, Yosuke; Sawasaki, Tatsuya; Kitamura, Toshio; Goyama, Susumu

    2017-07-28

    RUNX1 is a member of RUNX transcription factors and plays important roles in hematopoiesis. Disruption of RUNX1 activity has been implicated in the development of hematopoietic neoplasms. Chromosomal translocations involving the RUNX1 gene are associated with several types of leukemia, including acute myeloid leukemia driven by a leukemogenic fusion protein RUNX1-RUNX1T1. Previous studies have shown that RUNX1 is an unstable protein and is subjected to proteolytic degradation mediated by the ubiquitin-proteasome pathway. However, the precise mechanisms of RUNX1 ubiquitination have not been fully understood. Furthermore, much less is known about the mechanisms to regulate the stability of RUNX1-RUNX1T1. In this study, we identified several RUNX1-interacting E3 ubiquitin ligases using a novel high-throughput binding assay. Among them, we found that STUB1 bound to RUNX1 and induced its ubiquitination and degradation mainly in the nucleus. Immunofluorescence analyses revealed that the STUB1-induced ubiquitination also promoted nuclear export of RUNX1, which probably contributes to the reduced transcriptional activity of RUNX1 in STUB1-overexpressing cells. STUB1 also induced ubiquitination of RUNX1-RUNX1T1 and down-regulated its expression. Importantly, STUB1 overexpression showed a substantial growth-inhibitory effect in myeloid leukemia cells that harbor RUNX1-RUNX1T1, whereas it showed only a marginal effect in other non-RUNX1-RUNX1T1 leukemia cells and normal human cord blood cells. Taken together, these data suggest that the E3 ubiquitin ligase STUB1 is a negative regulator of both RUNX1 and RUNX1-RUNX1T1. Activation of STUB1 could be a promising therapeutic strategy for RUNX1-RUNX1T1 leukemia. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  4. Different RAN Components Relate to Reading at Different Points in Time

    Science.gov (United States)

    Georgiou, George K.; Papadopoulos, Timothy C.; Kaizer, Eleni L.

    2014-01-01

    The present 10-year longitudinal study examined how rapid automatized naming (RAN) components--articulation time and pause time--relate to reading fluency. Seventy-five Greek-speaking children were followed from Grade 1 to Grade 10 and were assessed five times (in Grades 1, 2, 4, 6, and 10) on RAN (digits and objects) and reading fluency (word…

  5. Transfection of HeLa-cells with pEGFP plasmid by impedance power-assisted electroporation

    DEFF Research Database (Denmark)

    Glahder, Jacob; Norrild, Bodil; Persson, Mikael B

    2005-01-01

    length 0.1 ms were applied in 1-16 repetitions with a 10-sec pause interval between pulses. Surviving cells were stained by crystal violet and counted using a confocal microscope. Transfected cells were fixed with 10% formaldehyde and counted as green spots in a fluorescence microscope. In the present...

  6. Construction of HEK293 cells stably expressing wild-type organic anion transporting polypeptide 1B1 (OATP1B1*1a) and variant OATP1B1*1b and OATP1B1*15.

    Science.gov (United States)

    Chen, M; Qu, B X; Chen, X L; Hu, H H; Jiang, H D; Yu, L S; Zhou, Q; Zeng, S

    2016-06-01

    A transgenic cell line stably expressing the human organic anion transporting polypeptide (OATP1B1) was established. Human Embryonic Kidney 293 (HEK293) cell line stably expressing OATP1B1*1a sequence was amplified through PCR with the extracted total RNA as templates from human liver, then subcloned into the plasmid pMD19-T and verified by sequencing. OATP1B1*1b/OATP1B1*15 mutant sequences were obtained by site-directed mutation PCR with pMD19-T/ OATP1B1*1a as templates. The plasmids pcDNA3.1(+)/OATP1B1*1a, *1b and *15 were constructed and transfected into HEK293 cell line using Lipofectamine 2000 transfection reagent. Several stable transfected clones were obtained after selection with G418. Using rosuvastatin as a probe substrate of OATP1B1, the intracellular rosuvastatin accumulation in HEK293 and HEK-OATP1B1*1a, *1b and *15 monoclone cells were validated by a ultra-performance liquid chromatography-tandem mass spectrometry. OATP1B1 mRNA and protein expression were detected by RT-PCR and Western blot, respectively. The results from RT-PCR, rosuvastatin uptake and Western blot assay indicated that human OATP1B1 was highly expressed in transfected cells compared with controls. The HEK-293 cell lines stably expressing human OATP1B1-wild and variant (HEK-OATP1B1, *1b and *15) are potential models to study drug transport in vitro.

  7. Ciencias 1. (Science 1). [Student's Workbook].

    Science.gov (United States)

    Raposo, Lucilia

    Ciencias 1 is the first in a series of science books designed for elementary Portuguese-speaking students. The book contains five sections divided into 43 lessons. The five sections are (1) Matter, (2) The Human Body, (3) Weather, (4) Solids, Liquids, and Gases, and (5) Living Things. Pictorial presentations and picture exercises are included for…

  8. General Relativity in (1 + 1) Dimensions

    Science.gov (United States)

    Boozer, A. D.

    2008-01-01

    We describe a theory of gravity in (1 + 1) dimensions that can be thought of as a toy model of general relativity. The theory should be a useful pedagogical tool, because it is mathematically much simpler than general relativity but shares much of the same conceptual structure; in particular, it gives a simple illustration of how gravity arises…

  9. 36 CFR 1.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... § 1.1 Purpose. (a) The regulations in this chapter provide for the proper use, management, government... purposes of units of the National Park System: to conserve scenery, natural and historic objects, and wildlife, and to provide for the enjoyment of those resources in a manner that will leave them...

  10. General Relativity in (1 + 1) Dimensions

    Science.gov (United States)

    Boozer, A. D.

    2008-01-01

    We describe a theory of gravity in (1 + 1) dimensions that can be thought of as a toy model of general relativity. The theory should be a useful pedagogical tool, because it is mathematically much simpler than general relativity but shares much of the same conceptual structure; in particular, it gives a simple illustration of how gravity arises…

  11. ME1/1 Cathode Strip Chambers

    CERN Document Server

    Erchov, Yu V; Kamenev, Alexey; Karjavin, Vladimir; Khabarov, Serguei; Moissenz, P V; Moissenz, K P; Movchan, Sergey; Perelygin, Victor; Vassiliev, S E; Zarubin, Anatoli; Tchekhovski, V A

    2008-01-01

    The 76 innermost ME1/1 cathode strip chambers (CSC) of the CMS Experiment were designed and produced in Dubna. The chambers have been installed in the detector and commissioning has been completed. This paper describes the design of the CSCs, their main mechanical parameters and read-out electronics, and the results of tests with cosmic-ray muons.

  12. 26 CFR 1.1275-1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... for the exception in section 1275(a)(1)(B)(i) only in cases where the life contingency under the... surrender option—(i) Impact on life contingency. The availability of a cash surrender option can... described in section 1275(a)(1)(B)(i). (5) Minimum payout provision—(i) Impact on life contingency....

  13. Release Notes for Whisper-1.1

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Forrest B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rising, Michael Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Alwin, Jennifer Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-04-27

    Whisper is a statistical analysis package developed in 2014 to support nuclear criticality safety (NCS) validation [1-3]. It uses the sensitivity profile data for an application as computed by MCNP6 [4-6] along with covariance files [7,8] for the nuclear data to determine a baseline upper-subcritical-limit (USL) for the application. Whisper version 1.0 was first developed and used at LANL in 2014 [3]. During 2015-2016, Whisper was updated to version 1.1 [9] and is to be included with the upcoming release of MCNP6.2. This document describes the Whisper-1.1 package that will be included with the MCNP6.2 release during 2017. Specific details are provided on the computer systems supported, the software quality assurance (SQA) procedures, installation, and testing. This document does not address other important topics, such as the importance of sensitivity-uncertainty (SU) methods to NCS validation, the theory underlying SU methodology, tutorials on the usage of MCNP-Whisper, practical approaches to using SU methodology to support and extend traditional validation, etc. There are over 50 documents included with Whisper-1.1 and available in the MCNP Reference Collection on the MCNP website (mcnp.lanl.gov) that address all of those topics and more. In this document, however, a complete bibliography of relevant MCNP-Whisper references is provided.

  14. Antiviral Prophylaxis and H1N1

    Centers for Disease Control (CDC) Podcasts

    2011-07-14

    Dr. Richard Pebody, a consultant epidemiologist at the Health Protection Agency in London, UK, discusses the use of antiviral post-exposure prophylaxis and pandemic H1N1.  Created: 7/14/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 7/18/2011.

  15. A Diagnostic Approach to Autoimmune Disorders: Clinical Manifestations: Part 1.

    Science.gov (United States)

    Sahai, Shashi; Adams, Matthew; Kamat, Deepak

    2016-06-01

    Autoimmune disorders are not commonly encountered in a general pediatric practice, but they may mimic many other disorders. Although they occur infrequently, it is always important to pause and consider an autoimmune disorder in the differential diagnosis. A detailed history and careful physical examination play an important role in guiding laboratory evaluation for these disorders. Many autoimmune disorders present with symptoms that involve multiple organ systems. The common symptoms that may make one consider a rheumatic disorder in the differential diagnosis are fever, fatigue, joint pain, rash, ulcers, and muscle weakness. The most common reason for referral to a pediatric rheumatologist is joint pain. A good joint examination may be performed by the use of the pediatric Gait, Arms, Legs, Spine screen, which is a validated screening tool. A small portion of children with fever of unknown origin may have an autoimmune disorder, with a majority of them having an infectious disease. Some patients with undiagnosed rheumatic disorders may present to the emergency. department. The characteristics of historic and clinical examination features of various autoimmune disorders are discussed in this article. [Pediatr Ann. 2016;45(6):e223-e229.].

  16. Main: BOXCPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXCPSAS1 S000226 10-May-1998 (last modified) kehi Box C in pea (P.s.) asparagine synthetase (AS...1) gene; Found at -45; AS1 is negatively regulated by light; Box C binds with nuclear proteins, which was... competed by a putative repressor element RE1 (see S000195); BOX C; AS; AS1; pea (Pisum sativum) CTCCCAC ...

  17. Determination of taste receptor type 1 member 1 (TAS1R1) gene ...

    African Journals Online (AJOL)

    Jane

    2011-10-10

    Oct 10, 2011 ... DOI: 10.5897/AJB11.1379 ... (TAS1R1) gene polymorphism and association with ... 1Institute of Cellular and Molecular Biology, College of Life Science, Xuzhou Normal University, Xuzhou, ... In this study, the coding and flanking .... Note: Exons 1, 2, 3, 4, 5 and 6 are located at base pairs 1~191, 1746~2052, ...

  18. Time lags in solar modulation

    Science.gov (United States)

    Paizis, C.; Von Rosenvinge, T. T.

    1982-01-01

    Von Rosenvinge and Paizis (1981) have discussed the amplitude variations of low energy cosmic rays, taking into account intensity-time variations which occurred starting in late 1973 and continued into mid-1975. The present investigation is concerned with the occurrence of so-called hysteresis effects during the considered period. A graph is presented which shows a comparison of the time-intensity plots for 35.3-82 MeV protons (340 MV) and the Deep River neutron monitor. A time lag can be observed between the neutron monitor intensity and the 35.3-82 MeV proton intensity. The same data is replotted to show a hysteresis loop. A plot for 35.1-82 MeV/n helium is also provided. It is found that all measured values of the time lag for protons and helium are consistent with those reported by Klecker et al. (1980). It is pointed out that the time lag for the anomalous helium is not consistent with the model of O'Gallagher (1975).

  19. Reference: EECCRCAH1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available EECCRCAH1 Yoshioka S, Taniguchi F, Miura K, Inoue T, Yamano T, Fukuzawa H. The novel Myb transcr...iption factor LCR1 regulates the CO2-responsive gene Cah1, encoding a periplasmic carbonic anhy

  20. Main: AMMORESIVDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESIVDCRNIA1 S000375 31-Jul-2001 (last modified) uchi Motif (IVD) found in the Chlamydomonas (C.R.) Nia...1 gene promoter; Located between -51 and -42; Involved in Nia1 transcription repress

  1. Conductors and Newforms for (1,1)

    Indian Academy of Sciences (India)

    Joshua Lansky; A Raghuram

    2004-11-01

    Let be a non-Archimedean local field whose residue characteristic is odd. In this paper we develop a theory of newforms for (1,1)(), building on previous work on $SL_2(F)$. This theory is analogous to the results of Casselman for $GL_2(F)$ and Jacquet, Piatetski-Shapiro, and Shalika for $GL_n(F)$. To a representation π of (1,1)(), we attach an integer () called the conductor of , which depends only on the -packet containing . A newform is a vector in which is essentially fixed by a congruence subgroup of level ()$. We show that our newforms are always test vectors for some standard Whittaker functionals, and, in doing so, we give various explicit formulae for newforms.

  2. User Manual for Whisper-1.1

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Forrest B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rising, Michael Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Alwin, Jennifer Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-01-26

    Whisper is a statistical analysis package developed in 2014 to support nuclear criticality safety (NCS) validation [1-3]. It uses the sensitivity profile data for an application as computed by MCNP6 [4-6] along with covariance files [7,8] for the nuclear data to determine a baseline upper-subcritical-limit (USL) for the application. Whisper version 1.0 was first developed and used at LANL in 2014 [3]. During 2015- 2016, Whisper was updated to version 1.1 and is to be included with the upcoming release of MCNP6.2. This document describes the user input and options for running whisper-1.1, including 2 perl utility scripts that simplify ordinary NCS work, whisper_mcnp.pl and whisper_usl.pl. For many detailed references on the theory, applications, nuclear data & covariances, SQA, verification-validation, adjointbased methods for sensitivity-uncertainty analysis, and more – see the Whisper – NCS Validation section of the MCNP Reference Collection at mcnp.lanl.gov. There are currently over 50 Whisper reference documents available.

  3. Fluconazole–malonic acid (1/1

    Directory of Open Access Journals (Sweden)

    Nina Lah

    2013-03-01

    Full Text Available Co-crystallizaton of the antifungal drug fluconazole [2-(2,4-difluorophenyl-1,3-bis(1H-1,2,4-triazol-1-ylpropan-2-ol] with malonic acid in acetonitrile solution resulted in the formation of the title 1:1 co-crystal, C13H12F2N6O·C3H4O4. The geometry around the central fluconazole atom is distorted tetrahedral. The dihedral angles between the triazole rings and the fluorinated phenyl ring are 30.64 (7 and 61.91 (5°. In the crystal, the basic packing motif may be envisioned as a cyclic aggregate formed of two fluconazole molecules linked by two malonic acid molecules through O—H...N and O—H...O hydrogen bonds. Such aggregates are further connected into (001 layers by further O—H...N hydrogen bonds. The structure also features weak non-classical C—H...O and C—H...N interactions.

  4. [Glucose transporter type 1 (GLUT-1) deficiency].

    Science.gov (United States)

    Cano, A; Ticus, I; Chabrol, B

    2008-11-01

    Impaired glucose transport across the blood brain barrier results in glucose transporter type 1 (GLUT-1) deficiency syndrome, first described in 1991. It is characterized by infantile seizures refractory to anticonvulsive treatments, microcephaly, delays in mental and motor development, spasticity, ataxia, dysarthria and other paroxysmal neurologic phenomena, often occurring prior to meals. Affected infants are normal at birth following an uneventful pregnancy and delivery. Seizures usually begin between the age of one and four months and can be preceded by apneic episodes or abnormal eyes movements. Patients with atypical presentations such as mental retardation and intermittent ataxia without seizures, or movement disorders characterized by choreoathetosis and dystonia, have also been described. Glucose is the principal fuel source for the brain and GLUT-1 is the only vehicle by which glucose enters the brain. In case of GLUT-1 deficiency, the risk of clinical manifestations is increased in infancy and childhood, when the brain glucose demand is maximal. The hallmark of the disease is a low glucose concentration in the cerebrospinal fluid in a presence of normoglycemia (cerebrospinal fluid/blood glucose ratio less than 0.4). The GLUT-1 defect can be confirmed by molecular analysis of the SCL2A1 gene or in erythrocytes by glucose uptake studies and GLUT-1 immunoreactivity. Several heterozygous mutations, with a majority of de novo mutations, resulting in GLUT-1 haploinsufficiency, have been described. Cases with an autosomal dominant transmission have been established and adults can exhibit symptoms of this deficiency. Ketogenic diet is an effective treatment of epileptic manifestations as ketone bodies serve as an alternative fuel for the developing brain. However, this diet is not effective on cognitive impairment and other treatments are being evaluated. The physiopathology of this disorder is partially unclear and its understanding could explain the clinical

  5. GLP-1 Receptor Agonists

    Science.gov (United States)

    ... in Balance › GLP-1 Receptor Agonists Fact Sheet GLP-1 Receptor Agonists May, 2012 Download PDFs English Espanol Editors Silvio ... are too high or too low. What are GLP-1 receptor agonist medicines? GLP-1 receptor agonist medicines, also called ...

  6. Main: ZDNAFORMINGATCAB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ZDNAFORMINGATCAB1 S000321 13-August-2005 (last modified) kehi Z-DNA-forming sequenc...t redundantly to induce Z-box containing promoters in white light; cab1; light; Z-DNA; leaf; shoot; HY5; COP1; LRE; Z-box; ZBF1; Z-box binding factor; Arabidopsis thaliana ATACGTGT ...

  7. Cold Sores (HSV-1)

    Science.gov (United States)

    ... A Week of Healthy Breakfasts Shyness Cold Sores (HSV-1) KidsHealth > For Teens > Cold Sores (HSV-1) A A A What's in this article? ... or around a person's lips, are caused by herpes simplex virus-1 (HSV-1) . But they don't ...

  8. 1-Phenyl-3-(pyren-1-ylprop-2-en-1-one

    Directory of Open Access Journals (Sweden)

    Jiannian Yao

    2008-03-01

    Full Text Available The title compound, C25H16O, was prepared by the condensation reaction of pyrene-1-carbaldehyde and acetophenone in ethanol solution at room temperature. The phenyl ring forms a dihedral angle of 39.10 (11° with the pyrene ring system. In the crystal structure, adjacent pyrene ring systems are linked by aromatic π–π stacking interactions, with a perpendicular interplanar distance of 3.267 (6 Å and a centroid–centroid offset of 2.946 (7 Å.

  9. The Analysis of HTTP/1.1%HTTP/1.1的分析

    Institute of Scientific and Technical Information of China (English)

    徐健; 王涛

    2004-01-01

    HTTP是互联网中使用得最为广泛的传输协议之一,最新版HTTP/1.1是对HTTP/1.0的改进,提高了浏览速度,增强了安全性等.基于此,笔者对HTTP/1.1的信息进行了详细分析,并简单介绍了MIME编码.

  10. Main: ACGTROOT1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTROOT1 S000016 31-Jul-2001 (last modified) uchi ACGT motif related to root expre...ssion; Gene: synthetic; perfect palindromic sequence (PA) containing G-box-related sequence; transacting fac...tor: TAF-1 ?; Binding of SGBF-1 (a Soybean G-box binding bZIP transcription factor) to ABRE is enhanced by SCOF-1 (a zinc finger pro...tein ); Transcription of SCOF-1 is induced by low temperature and ABA; ro

  11. 1.1.Physical method of diganosis.

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930209 Glinical and radiological diagnosis ofrenal osteodystrophy.CHEN Zhigang (陈志刚),et al.Dept Radiol,1st Affili Hosp,XianMed Univ,710061.Chin J Radiol 1992;26(1):726—729.The authors reported the radiological findingsin 42 cases of renal osteodystrophy as comparedwith 103 cases of chronic renal failure withoutbone changes.The results showed that renalosteodystrophy was closely related to age,sexand duration of renopathy (P<0.05).The au-thors suggested that osteosclerosis was a char-

  12. 1-Diphenylphosphino-1′-(diphenylphosphinoylcobaltocenium hexafluoridophosphate

    Directory of Open Access Journals (Sweden)

    Sheng-Hua Liu

    2008-10-01

    Full Text Available The title compound, [Co(C17H14OP(C17H14P]PF6, was obtained unintentionally as the product of an attempted synthesis of [1,1′-bis(oxodiphenylphosphoranylcobaltocenium] hexafluoridophosphate. The O atom of the oxo group is disordered over two positions with site occupancies of 0.65:0.35. The crystal structure contains weak intermolecular C—H...F hydrogen bonds, connecting the components of the structure into chains parallel to [010].

  13. Entanglement Tsunami in (1+1)-Dimensions

    CERN Document Server

    Leichenauer, Stefan

    2015-01-01

    We study the time dependence of the entanglement entropy of disjoint intervals following a global quantum quench in (1+1)-dimensional CFTs at large-$c$ with a sparse spectrum. The result agrees with a holographic calculation but differs from the free field theory answer. In particular, a simple model of free quasiparticle propagation is not adequate for CFTs with a holographic dual. We elaborate on the entanglement tsunami proposal of Liu and Suh and show how it can be used to reproduce the holographic answer.

  14. Discoidin Domain Receptor 1

    Science.gov (United States)

    Song, Sunmi; Shackel, Nicholas A.; Wang, Xin M.; Ajami, Katerina; McCaughan, Geoffrey W.; Gorrell, Mark D.

    2011-01-01

    Discoidin domain receptor 1 (DDR1) is a receptor tyrosine kinase that binds and is activated by collagens. Transcriptional profiling of cirrhosis in human liver using a DNA array and quantitative PCR detected elevated mRNA expression of DDR1 compared with that in nondiseased liver. The present study characterized DDR1 expression in cirrhotic and nondiseased human liver and examined the cellular effects of DDR1 expression. mRNA expression of all five isoforms of DDR1 was detected in human liver, whereas DDR1a demonstrated differential expression in liver with hepatitis C virus and primary biliary cirrhosis compared with nondiseased liver. In addition, immunoblot analysis detected shed fragments of DDR1 more readily in cirrhotic liver than in nondiseased liver. Inasmuch as DDR1 is subject to protease-mediated cleavage after prolonged interaction with collagen, this differential expression may indicate more intense activation of DDR1 protein in cirrhotic compared with nondiseased liver. In situ hybridization and immunofluorescence localized intense DDR1 mRNA and protein expression to epithelial cells including hepatocytes at the portal-parenchymal interface and the luminal aspect of the biliary epithelium. Overexpression of DDR1a altered hepatocyte behavior including increased adhesion and less migration on extracelular matrix substrates. DDR1a regulated extracellular expression of matrix metalloproteinases 1 and 2. These data elucidate DDR1 function pertinent to cirrhosis and indicate the importance of epithelial cell–collagen interactions in chronic liver injury. PMID:21356365

  15. Learning Prosody and Fluency Characteristics of Second Language Speech: The Effect of Experience on Child Learners' Acquisition of Five Suprasegmentals

    Science.gov (United States)

    Trofimovich, Pavel; Baker, Wendy

    2007-01-01

    This study examined second language (L2) experience effects on children's acquisition of fluency-(speech rate, frequency, and duration of pausing) and prosody-based (stress timing, peak alignment) suprasegmentals. Twenty Korean children (age of arrival in the United States = 7-11 years, length of US residence = 1 vs. 11 years) and 20 age-matched…

  16. 75 FR 56613 - Self-Regulatory Organizations; BATS Exchange, Inc.; NASDAQ OMX BX, Inc.; Chicago Board Options...

    Science.gov (United States)

    2010-09-16

    ... for investors to trade at rational prices. In addition to the individual stock trading pause rules..., and SIFMA Letter, at 1-2 (also stating its belief that it is ``critical for the options markets to... be deemed to be clearly erroneous,'' but stated its belief that ``its proposal reflects a significant...

  17. 75 FR 56641 - Self-Regulatory Organizations; Financial Industry Regulatory Authority, Inc.; Order Granting...

    Science.gov (United States)

    2010-09-16

    ... for investors to trade at rational prices. In addition to the individual stock trading pause rules..., GETCO Letter, at 2, and SIFMA Letter, at 1-2 (also stating its belief that it is ``critical for the... be clearly erroneous,'' but stated its belief that ``its proposal reflects a significant improvement...

  18. From Acoustics to Grammar: Perceiving and Interpreting Grammatical Prosody in Adolescents with Asperger Syndrome

    Science.gov (United States)

    Chevallier, Coralie; Noveck, Ira; Happe, Francesca; Wilson, Deirdre

    2009-01-01

    We report findings concerning the understanding of prosody in Asperger Syndrome (AS), a topic which has attracted little attention and led to contradictory results. Ability to understand grammatical prosody was tested in three novel experiments. Experiment 1 assessed the interpretation of word stress, Experiment 2 focused on grammatical pauses,…

  19. Survey of ortho-H2D+ (1(1,0)-1(1,1)) in dense cloud cores

    NARCIS (Netherlands)

    Caselli, P.; Vastel, C.; Ceccarelli, C.; van der Tak, F. F. S.; Crapsi, A.; Bacmann, A.

    2008-01-01

    Aims. We present a survey of the ortho-H2D+ (1(1,0)-1(1,1)) line toward a sample of 10 starless cores and 6 protostellar cores, carried out at the Caltech Submillimeter Observatory. The high diagnostic power of this line is revealed for the study of the chemistry, and the evolutionary and dynamical

  20. 1 CFR 9.1 - Publication required.

    Science.gov (United States)

    2010-01-01

    ... Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER THE UNITED STATES GOVERNMENT MANUAL § 9.1 Publication required. The Director of the Federal Register shall separately publish annually or at times designated by the Administrative Committee of the Federal Register a...

  1. 1-[1-(4-Nitrophenylethylidene]thiosemicarbazide

    Directory of Open Access Journals (Sweden)

    Yu-Feng Ding

    2008-09-01

    Full Text Available The title compound, C9H10N4O2S, was prepared by the reaction of 1-(4-nitrophenylethanone and thiosemicarbazide in ethanol at 367 K. There are weak intermolecular N—H...S and N—H...O hydrogen-bonding interactions in the crystal structure involving the amine and nitrile groups, respectively, as donors.

  2. (Methyl 2-(cyclohexylamino)-1-cyclopentene-1-dithiocarboxylato)

    African Journals Online (AJOL)

    Leipoldt

    This paper describes the manipulation of the electron density on the central metal ..... acetone-oxygen (O2) and the outer PPh3-protons (H23 and H24), as well as ..... Scheme 1) vs. iodomethane concentration, yields a linear relationship with a.

  3. Porcine SLITRK1

    DEFF Research Database (Denmark)

    Larsen, Knud Erik; Momeni, Jamal; Farajzadeh, Leila

    2014-01-01

    The membrane protein SLITRK1 functions as a developmentally regulated stimulator of neurite outgrowth and variants in this gene have been implicated in Tourette syndrome. In the current study we have cloned and characterized the porcine SLITRK1 gene. The genomic organization of SLITRK1 lacks...... introns, as does its human and mouse counterparts. RT-PCR cloning revealed two SLITRK1 transcripts: a full-length mRNA and a transcript variant that results in a truncated protein. The encoded SLITRK1 protein, consisting of 695 amino acids, displays a very high homology to human SLITRK1 (99%). The porcine...

  4. Main: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ory Sequence) found in maize and Arabidopsis ferritin genes (Fer1); IDRS is responsible for transcriptional ...IDRSZMFER1 S000445 04-August-2006 (last modified) kehi IDRS (Iron-Dependent Regulat...repression of ZmFer1 gene under low iron supply conditions; S=C/G; K=G/T; IDRS is not involved in the Fe-reg...ulated expression of the AtAPX1 gene (Fourcroy et al., 2004); iron; ferritin; APX1; AtFer1; Fer; Zea mays (maize); Arabidopsis thaliana; CACGAGSCCKCCAC ...

  5. CO adsorption on PdGa(1 0 0), (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) surfaces: A DFT study

    Energy Technology Data Exchange (ETDEWEB)

    Bechthold, P.; Ardhengi, J.S.; Juan, A., E-mail: cajuan@uns.edu.ar; González, E.A.; Jasen, P.V.

    2014-10-01

    Graphical abstract: - Highlights: • CO adsorption is top on Pd sites for all surfaces. • Our results agree with TDS peak at 210 K for PdGa (1{sup ¯}1{sup ¯}1{sup ¯}) attributed to CO-Pd bond. • Pd-CO bond is formed at expenses of metal-metal bond. No Ga-CO interaction is found. • A back-donation for all surfaces was detected. After adsorption Pd PDOS shift towards lower energies. • IR frequencies for the C-O adsorbed presents a red shift compared to gas phase. - Abstract: CO adsorption on (1 0 0), (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) planes is analyzed using density functional theory (DFT) calculations. Changes in the electronic structure of these surfaces and CO bond after adsorption are also addressed here. CO is located on Pd atop geometry with a tilted configuration of 7.8° in the (1 0 0) plane, while in the (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) are perpendicular to the surface. No direct interaction of CO with Ga is detected. The overlap population (OP) of Pd-Pd and Pd-Ga bond decreases as the new Pd-CO bond is formed. In all cases, the C-O bond length changes less than 1% compared to the vacuum but its strength decrease about 50% as determined by the changes in the OP. The effect of CO is limited to its first Pd neighbor. Analysis of orbital interaction reveals that Pd-CO bond mainly involves s-s and s-p orbitals with less participation of Pd 4d orbitals. Computed CO vibration frequencies after adsorption shows a red shift from vacuum towards 1972.9, 1990.4 and 1988.6 cm{sup −1} on (1 0 0), (1 1 1) and (1{sup ¯}1{sup ¯}1{sup ¯}) planes respectively, following the same trend that experimental data on the PdGa intermetallic compound.

  6. Materials Science Research Rack-1 (MSRR-1)

    Science.gov (United States)

    2001-01-01

    This scale model depicts the Materials Science Research Rack-1 (MSRR-1) being developed by NASA's Marshall Space Flight Center and the European Space Agency (ESA) for placement in the Destiny laboratory module aboard the International Space Station. The rack is part of the plarned Materials Science Research Facility (MSRF) and is expected to include two furnace module inserts, a Quench Module Insert (being developed by NASA's Marshall Space Flight Center) to study directional solidification in rapidly cooled alloys and a Diffusion Module Insert (being developed by the European Space Agency) to study crystal growth, and a transparent furnace (being developed by NASA's Space Product Development program). Multi-user equipment in the rack is being developed under the auspices of NASA's Office of Biological and Physical Research (OBPR) and ESA. Key elements are labeled in other images (0101754, 0101829, 0101830, and TBD). This image is from a digital still camera; higher resolution is not available.

  7. ORCID implementation in Invenio 1.1

    CERN Document Server

    CERN. Geneva

    2017-01-01

    We present an extension to the Invenio 1.1 software for semi-automatically harvesting ORCID IDs of users and allowing them to upload publications to their respective ORCID profile. This extension was created in the context of the Join2 initiative, however, it can easily be adapted to other Invenio instances because it is only loosely coupled with Invenio itself. It opens its own local webserver to handle the additional endpoints, and calls Invenio API functions and command line programs to interact with the database. We also present a recommended workflow for successfully harvesting ORCID ID in an institution. The implementation is realised in well-documented Python 2.6 and Go and will be published as Free Software.

  8. Data of evolutionary structure change: 1CERQ-1GD1O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERQ-1GD1O 1CER 1GD1 Q O -MKVGINGFGRIGRQVFRILHSRG-VEVALINDLTDNKT...> VAL CA 439 ALA CA 385 LEU CA 456 1GD...1 O 1GD1O VAL CA 371 LYS CA 388 VAL CA 474 1GD...1 O 1GD1O TMVIDGKMVKV

  9. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  10. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDRSZMFER1 Arnaud N, Murgia I, Boucherez J, Briat JF, Cellier F, Gaymard F. An iron...-induced nitric oxide burst precedes ubiquitin-dependent protein degradation for arabidospsis atfer1 ferritin gene expre

  11. Reference: SRENTTTO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available SRENTTTO1 Takeda S, Sugimoto K, Otsuki H, Hirochika H A 13-bp cis-regulatory elemen...t in the LTR promoter of the tobacco retrotransposon Tto1 is involved in responsiveness to tissue culture, w

  12. A1C test

    Science.gov (United States)

    HbA1C test; Glycated hemoglobin test; Glycosylated hemoglobin test; Hemoglobin glycosylated test; Glycohemoglobin test ... have recently eaten does not affect the A1C test, so you do not need to fast to ...

  13. Reference: EECCRCAH1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available EECCRCAH1 Kucho K, Yoshioka S, Taniguchi F, Ohyama K, Fukuzawa H. Cis-acting elemen...ts and DNA-binding proteins involved in CO2-responsive transcriptional activation of Cah1 encoding a periplasmic ca

  14. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  15. Reference: MYCATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MYCATERD1 Simpson SD, Nakashima K, Narusaka Y, Seki M, Shinozaki K, Yamaguchi-Shino...zaki K. Two different novel cis-acting elements of erd1, a clpA homologous Arabidopsis gene function in indu

  16. Reference: ACGTATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTATERD1 Simpson SD, Nakashima K, Narusaka Y, Seki M, Shinozaki K, Yamaguchi-Shin...ozaki K. Two different novel cis-acting elements of erd1, a clpA homologous Arabidopsis gene function in ind

  17. Reference: ABRELATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABRELATERD1 Simpson SD, Nakashima K, Narusaka Y, Seki M, Shinozaki K, Yamaguchi-Shi...nozaki K. Two different novel cis-acting elements of erd1, a clpA homologous Arabidopsis gene function in in

  18. Main: MYCATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MYCATERD1 S000413 29-November-2004 (last modified) kehi MYC recognition sequence (f...rom -466 to -461) necessary for expression of erd1 (early responsive to dehydration) in dehydrated Arabidops

  19. Antagonism between Cry1Ac1 and Cyt1A1 toxins of bacillus thuringiensis

    Science.gov (United States)

    del Rincon-Castro MC; Barajas-Huerta; Ibarra

    1999-05-01

    Most strains of the insecticidal bacterium Bacillus thuringiensis have a combination of different protoxins in their parasporal crystals. Some of the combinations clearly interact synergistically, like the toxins present in B. thuringiensis subsp. israelensis. In this paper we describe a novel joint activity of toxins from different strains of B. thuringiensis. In vitro bioassays in which we used pure, trypsin-activated Cry1Ac1 proteins from B. thuringiensis subsp. kurstaki, Cyt1A1 from B. thuringiensis subsp. israelensis, and Trichoplusia ni BTI-Tn5B1-4 cells revealed contrasting susceptibility characteristics. The 50% lethal concentrations (LC50s) were estimated to be 4,967 of Cry1Ac1 per ml of medium and 11.69 ng of Cyt1A1 per ml of medium. When mixtures of these toxins in different proportions were assayed, eight different LC50s were obtained. All of these LC50s were significantly higher than the expected LC50s of the mixtures. In addition, a series of bioassays were performed with late first-instar larvae of the cabbage looper and pure Cry1Ac1 and Cyt1A1 crystals, as well as two different combinations of the two toxins. The estimated mean LC50 of Cry1Ac1 was 2.46 ng/cm2 of diet, while Cyt1A1 crystals exhibited no toxicity, even at very high concentrations. The estimated mean LC50s of Cry1Ac1 crystals were 15.69 and 19.05 ng per cm2 of diet when these crystals were mixed with 100 and 1,000 ng of Cyt1A1 crystals per cm2 of diet, respectively. These results indicate that there is clear antagonism between the two toxins both in vitro and in vivo. Other joint-action analyses corroborated these results. Although this is the second report of antagonism between B. thuringiensis toxins, our evidence is the first evidence of antagonism between toxins from different subspecies of B. thuringiensis (B. thuringiensis subsp. kurstaki and B. thuringiensis subsp. israelensis) detected both in vivo and in vitro. Some possible explanations for this relationship are discussed.

  20. BACE1 modulates gating of KCNQ1 (Kv7.1) and cardiac delayed rectifier KCNQ1/KCNE1 (IKs).

    Science.gov (United States)

    Agsten, Marianne; Hessler, Sabine; Lehnert, Sandra; Volk, Tilmann; Rittger, Andrea; Hartmann, Stephanie; Raab, Christian; Kim, Doo Yeon; Groemer, Teja W; Schwake, Michael; Alzheimer, Christian; Huth, Tobias

    2015-12-01

    KCNQ1 (Kv7.1) proteins form a homotetrameric channel, which produces a voltage-dependent K(+) current. Co-assembly of KCNQ1 with the auxiliary β-subunit KCNE1 strongly up-regulates this current. In cardiac myocytes, KCNQ1/E1 complexes are thought to give rise to the delayed rectifier current IKs, which contributes to cardiac action potential repolarization. We report here that the type I membrane protein BACE1 (β-site APP-cleaving enzyme 1), which is best known for its detrimental role in Alzheimer's disease, but is also, as reported here, present in cardiac myocytes, serves as a novel interaction partner of KCNQ1. Using HEK293T cells as heterologous expression system to study the electrophysiological effects of BACE1 and KCNE1 on KCNQ1 in different combinations, our main findings were the following: (1) BACE1 slowed the inactivation of KCNQ1 current producing an increased initial response to depolarizing voltage steps. (2) Activation kinetics of KCNQ1/E1 currents were significantly slowed in the presence of co-expressed BACE1. (3) BACE1 impaired reconstituted cardiac IKs when cardiac action potentials were used as voltage commands, but interestingly augmented the IKs of ATP-deprived cells, suggesting that the effect of BACE1 depends on the metabolic state of the cell. (4) The electrophysiological effects of BACE1 on KCNQ1 reported here were independent of its enzymatic activity, as they were preserved when the proteolytically inactive variant BACE1 D289N was co-transfected in lieu of BACE1 or when BACE1-expressing cells were treated with the BACE1-inhibiting compound C3. (5) Co-immunoprecipitation and fluorescence recovery after photobleaching (FRAP) supported our hypothesis that BACE1 modifies the biophysical properties of IKs by physically interacting with KCNQ1 in a β-subunit-like fashion. Strongly underscoring the functional significance of this interaction, we detected BACE1 in human iPSC-derived cardiomyocytes and murine cardiac tissue and observed

  1. Main: BOXBPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXBPSAS1 S000225 17-May-1998 (last modified) kehi Box B in pea (P.s.) asparagine synthetase (AS...1) gene; Found at -61; AS1 is negatively regulated by light; Box B binds with nuclear proteins; BOX B; AS; AS

  2. Main: EECCRCAH1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available EECCRCAH1 S000494 24-April-2006 (last modified) kehi EEC; Consensus motif of the tw...o enhancer elements, EE-1 and EE-2, both found in the promoter region of the Chlamydomonas Cah1 (encoding a periplasmic ca

  3. Main: GAREHVAMY1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available GAREHVAMY1 S000038 17-May-1998 (last modified) kehi GARE (gibberellic acid responsi...ve element) of barley (H.v.) alpha-amylase gene (Amy 1/6-4); GA3; gibberellic acid; GA; GA3; amylase; Amy1/6-4; GARE; barley (Hordeum vulgare) GGCCGATAACAAACTCCGGCC ...

  4. Main: AMMORESIIUDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESIIUDCRNIA1 S000374 31-Jul-2001 (last modified) uchi Motifs (IIU and IID) fou...nd in the Chlamydomonas (C.R.) Nia1 gene promoter; Involved in ammonium-response; Located between -231 and -...219 and also between -76 and -65; Involved in Nia1 transcription activation; W=T/A; nitrate reductase; ammonium response; Chlamydomonas reinhardtii GGWAGGGT ...

  5. Main: AMMORESVDCRNIA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMMORESVDCRNIA1 S000376 31-Jul-2001 (last modified) uchi Motif (VD) found in the Ch...lamydomonas (C.R.) Nia1 gene promoter; Located between -33 and -8; Involved in Nia1 transcription activation; nitrate reductase; amm

  6. Reference: CGTGTSPHZMC1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CGTGTSPHZMC1 Kao CY, Cocciolone SM, Vasil IK, McCarty DR Localization and interaction of the cis-acting elem...ents for abscisic acid, VIVIPAROUS1, and light activation of the C1 gene of maize Plant Cell 8: 1171-1179 (1996) PubMed: 8768375 ...

  7. Main: RSEPVGRP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available RSEPVGRP1 S000099 13-Feb-2001 (last modified) kehi RSE (root-specific element) of bean (P.v.) GRP...1.8 gene; consensus sequence;See also S000288 and S000289; root; GRP1.8; bean (Phaseolus vulgaris) CAACTTTCATAT ...

  8. Main: WBOXHVISO1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available WBOXHVISO1 S000442 28-Jan-2004 (last modified) kehi SUSIBA2 bind to W-box element i...n barley iso1 (encoding isoamylase1) promoter; sugar; SURE; patatin; WRKY; isoamylase; SUSIBA2; Hordeum vulgare (barley) TGACT ...

  9. Main: ABRELATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABRELATERD1 S000414 01-August-2006 (last modified) kehi ABRE-like sequence (from -1...99 to -195) required for etiolation-induced expression of erd1 (early responsive to dehydration) in Arabidopsis; ABRE; etiolation; erd; Arabidopsis thaliana ACGTG ...

  10. Psychoneuroimmunology and HIV-1.

    Science.gov (United States)

    Antoni, Michael H.; And Others

    1990-01-01

    Presents evidence describing benefits of behavioral interventions such as aerobic exercise training on both psychological and immunological functioning among high risk human immunodeficiency virus-Type 1 (HIV-1) seronegative and very early stage seropositive homosexual men. HIV-1 infection is cast as chronic disease for which early…

  11. Melaminium nitrate–melamine–water (1/1/1

    Directory of Open Access Journals (Sweden)

    Farook Adam

    2010-11-01

    Full Text Available In the crystal structure of the title salt, C3H7N6+·NO3−·C3H6N6·H2O, the asymmetric unit consists of two neutral melamine (1,3,5-triazine-2,4,6-triamine molecules, two melaminium cations, two nitrate anions and two solvent water molecules. One of the nitrate anions is disordered over two sets of positions, with a refined occupancy ratio of 0.909 (3:0.091 (3. The cations and neutral molecules are approximately planar, with maximum deviations of 0.018 (2, 0.024 (2, 0.019 (2 and 0.007 (2 Å for each, respectively. In the crystal structure, melaminium cations and netural melamine molecules self-assemble via N—H...N hydrogen bonds to form a supramolecular hexagonal-shaped motif. In addition, the nitrate anions and water molecules are connected by N—H...O hydrogen bonds to form a three-dimensional network.

  12. 5-Chloro-1-phenylpentan-1-one

    Directory of Open Access Journals (Sweden)

    Nicole Bechmann

    2016-01-01

    Full Text Available In the title compound, C11H13ClO, which is used as a starting material for the synthesis of some materials with possible medical applications, the molecular skeleton is slightly curved, with the dihedral angle of 4.7 (1° between the mean planes of the chlorobutane and benzaldehyde fragments. In the crystal, weak C—H...O hydrogen bonds link the molecules into chains running along the [201] direction, and weak C—H...π interactions link these chains into layers parallel to the ac plane.

  13. Event generation with SHERPA 1.1

    Energy Technology Data Exchange (ETDEWEB)

    Gleisberg, T.; Hoche, Stefan.; Krauss, F.; Schoenherr, M.; Schumann, S.; Siegert, F.; Winter, J.

    2008-12-18

    In this paper the current release of the Monte Carlo event generator Sherpa, version 1.1, is presented. Sherpa is a general-purpose tool for the simulation of particle collisions at high-energy colliders. It contains a very flexible tree-level matrix-element generator for the calculation of hard scattering processes within the Standard Model and various new physics models. The emission of additional QCD partons off the initial and final states is described through a parton-shower model. To consistently combine multi-parton matrix elements with the QCD parton cascades the approach of Catani, Krauss, Kuhn and Webber is employed. A simple model of multiple interactions is used to account for underlying events in hadron-hadron collisions. The fragmentation of partons into primary hadrons is described using a phenomenological cluster-hadronization model. A comprehensive library for simulating tau-lepton and hadron decays is provided. Where available form-factor models and matrix elements are used, allowing for the inclusion of spin correlations; effects of virtual and real QED corrections are included using the approach of Yennie, Frautschi and Suura.

  14. 1-Methylpiperazine-1,4-diium dipicrate

    Directory of Open Access Journals (Sweden)

    Grzegorz Dutkiewicz

    2011-02-01

    Full Text Available In the crystal structure of the title compound [systematic name: 1-methylpiperazine-1,4-diium bis(2,4,6-trinitrophenolate], C5H14N22+·2C6H2N3O7−, the ionic components are connected by relatively strong N—H...O hydrogen bonds into centrosymmetric six-membered conglomerates, which comprise two dications and four anions. Besides Coulombic interactions, only weak C—H...O interactions and some stacking between picrates (separation between the planes of ca. 3.4 Å but only a small overlapping can be identified between these `building blocks' of the crystal structure. The piperazine ring adopts a chair conformation with the methyl substituent in the equatorial position. In the picrate anions, the twist angles of the nitro groups depend on their positions relative to the phenolate O atom: it is much smaller for the NO2 groups para to the C—O− group [15.23 (9and 3.92 (14°] than for the groups in the ortho positions [28.76 (13–39.84 (11°].

  15. Polymorphisms in CYP1B1, GSTM1, GSTT1 and GSTP1, and susceptibility to breast cancer.

    Science.gov (United States)

    Van Emburgh, Beth O; Hu, Jennifer J; Levine, Edward A; Mosley, Libyadda J; Perrier, Nancy D; Freimanis, Rita I; Allen, Glenn O; Rubin, Peter; Sherrill, Gary B; Shaw, Cindy S; Carey, Lisa A; Sawyer, Lynda R; Miller, Mark Steven

    2008-05-01

    Polymorphisms in the cytochrome P450 1B1 (CYP1B1) and glutathione S-transferase (GST) drug metabolic enzymes, which are responsible for metabolic activation/detoxification of estrogen and environmental carcinogens, were analyzed for their association with breast cancer risk in 541 cases and 635 controls from a North Carolina population. Each polymorphism, altering the catalytic function of their respective enzymes, was analyzed in Caucasian and African-American women. As reported in previous studies, individual polymorphisms did not significantly impact breast cancer risk in either Caucasian or African-American women. However, African-American women exhibited a trend towards a protective effect when they had at least one CYP1B1 119S allele (OR=0.53; 95% CI=0.20-1.40) and increased risk for those women harboring at least one CYP1B1 432V allele (OR=5.52; 95% CI=0.50-61.37). Stratified analyses demonstrated significant interactions in younger (age CYP1B1 119SS genotype (OR=3.09; 95% CI=1.22-7.84) and younger African-American women with the GSTT1 null genotype (OR=4.07; 95% CI=1.12-14.80). A notable trend was also found in Caucasian women with a history of smoking and at least one valine allele at GSTP1 114 (OR=2.12; 95% CI=1.02-4.41). In Caucasian women, the combined GSTP1 105IV/VV and CYP1B1 119AA genotypes resulted in a near 2-fold increase in risk (OR=1.96; 95% CI=1.04-3.72) and the three way combination of GSTP1 105IV/VV, CYP1B1 119AS/SS and GSTT1 null genotypes resulted in an almost 4-fold increase in risk (OR=3.97; 95% CI=1.27-12.40). These results suggest the importance of estrogen/carcinogen metabolic enzymes in the etiology of breast cancer, especially in women before the age of 60, as well as preventative measures such as smoking cessation.

  16. X-1 in flight

    Science.gov (United States)

    1947-01-01

    The Bell Aircraft Corporation X-1-1 (#46-062) in flight. The shock wave pattern in the exhaust plume is visible. The X-1 series aircraft were air-launched from a modified Boeing B-29 or a B-50 Superfortress bombers. The X-1-1 was painted a bright orange by Bell Aircraft. It was thought that the aircraft would be more visable to those doing the tracking during a flight. When NACA received the airplanes they were painted white, which was an easier color to find in the skies over Muroc Air Field in California. This particular craft was nicknamed 'Glamorous Glennis' by Chuck Yeager in honor of his wife, and is now on permanent display in the Smithsonian Institution's National Air and Space Museum in Washington, DC. There were five versions of the Bell X-1 rocket-powered research aircraft that flew at the NACA High-Speed Flight Research Station, Edwards, California. The bullet-shaped X-1 aircraft were built by Bell Aircraft Corporation, Buffalo, N.Y. for the U.S. Army Air Forces (after 1947, U.S. Air Force) and the National Advisory Committee for Aeronautics (NACA). The X-1 Program was originally designated the XS-1 for EXperimental Sonic. The X-1's mission was to investigate the transonic speed range (speeds from just below to just above the speed of sound) and, if possible, to break the 'sound barrier.' Three different X-1s were built and designated: X-1-1, X-1-2 (later modified to become the X-1E), and X-1-3. The basic X-1 aircraft were flown by a large number of different pilots from 1946 to 1951. The X-1 Program not only proved that humans could go beyond the speed of sound, it reinforced the understanding that technological barriers could be overcome. The X-1s pioneered many structural and aerodynamic advances including extremely thin, yet extremely strong wing sections; supersonic fuselage configurations; control system requirements; powerplant compatibility; and cockpit environments. The X-1 aircraft were the first transonic-capable aircraft to use an all

  17. RUNX1-ETO Leukemia.

    Science.gov (United States)

    Lin, Shan; Mulloy, James C; Goyama, Susumu

    2017-01-01

    AML1-ETO leukemia is the most common cytogenetic subtype of acute myeloid leukemia, defined by the presence of t(8;21). Remarkable progress has been achieved in understanding the molecular pathogenesis of AML1-ETO leukemia. Proteomic surveies have shown that AML-ETO forms a stable complex with several transcription factors, including E proteins. Genome-wide transcriptome and ChIP-seq analyses have revealed the genes directly regulated by AML1-ETO, such as CEBPA. Several lines of evidence suggest that AML1-ETO suppresses endogenous DNA repair in cells to promote mutagenesis, which facilitates acquisition of cooperating secondary events. Furthermore, it has become increasingly apparent that a delicate balance of AML1-ETO and native AML1 is important to sustain the malignant cell phenotype. Translation of these findings into the clinical setting is just beginning.

  18. EFFECTS OF HARVESTING ON LEAF PRODUCTION AND REPRODUCTIVE PERFORMANCE OF Copernicia prunifera (Mill. H.E. Moore1

    Directory of Open Access Journals (Sweden)

    Irlaine Rodrigues Vieira

    2016-02-01

    Full Text Available ABSTRACT This work aimed to evaluate the consequences of the monthly extraction of immature leaves in survival, leaf production and reproductive performance ofCopernicia prunifera H. E. Moore palm, popularly known as carnaúba. One hundred sixty reproductive adult palms were monitored for 17 months in four extractive communities located at the coast of the state of Piauí. As a result, it was observed that leaves, flowers, fruits and seeds production were reduced in the palm submitted to 50% or 75% monthly extraction. Higher levels of extraction were followed by smaller levels in seed germination. No deaths were observed even in the group subjected to 75% monthly leaves exploration. In order not to produce damage to palm trees development it is suggested that leaf extraction rate should not exceed 25% monthly as well as pausing of extractive activity preferentially during fruit maturation.

  19. 1-(Trifluoromethyl)vinyllithium

    OpenAIRE

    Chang, Shuh-Kuen

    2009-01-01

    InChI = 1S/C3H2F3.Li/c1-2-3(4,5)6;/h1H2; InChIKey = YDBNXCHLLXTABG-UHFFFAOYSA-N (reagent used as a versatile vinylation component) Physical Data: thermally unstable; decomposes quickly at temperatures above −78 °C. Solubility: soluble in diethyl ether, pentane, and THF. Form Supplied in: not available commercially. Preparative Method: prepared from the reaction of commercially available 2-bromo-3,3,3-trifluoropropene with n-, sec-, or tert-butyllithium in diethyl ether at −1...

  20. Tetrahydroindolizinone NK1 antagonists.

    Science.gov (United States)

    Bao, Jianming; Lu, Huagang; Morriello, Gregori J; Carlson, Emma J; Wheeldon, Alan; Chicchi, Gary G; Kurtz, Marc M; Tsao, Kwei-Lan C; Zheng, Song; Tong, Xinchun; Mills, Sander G; DeVita, Robert J

    2010-04-01

    A new class of potent NK(1) receptor antagonists with a tetrahydroindolizinone core has been identified. This series of compounds demonstrated improved functional activities as compared to previously identified 5,5-fused pyrrolidine lead structures. SAR at the 7-position of the tetrahydroindolizinone core is discussed in detail. A number of compounds displayed high NK(1) receptor occupancy at both 1 h and 24 h in a gerbil foot tapping model. Compound 40 has high NK(1) binding affinity, good selectivity for other NK receptors and promising in vivo properties. It also has clean P(450) inhibition and hPXR induction profiles.

  1. Equine herpesvirus 1 myeloencephalopathy.

    Science.gov (United States)

    Pusterla, Nicola; Hussey, Gisela Soboll

    2014-12-01

    Equine myeloencephalopathy (EHM), an uncommon manifestation of equine herpesvirus 1 (EHV-1) infection, can cause devastating losses on individual farms, boarding stables, veterinary hospitals, and show and racing venues. An improved understanding of EHM has emerged from experimental studies and from data collected during field outbreaks at riding schools, racetracks, horse shows, and veterinary hospitals throughout North America and Europe. These outbreaks have highlighted the contagious nature of EHV-1 and have prompted a reevaluation of diagnostic procedures, treatment modalities, preventative measures, and biosecurity protocols for this disease. This article focuses on recent data related to the cause, epidemiology, pathogenesis, immunity, diagnosis, treatment, and prevention of EHV-1 infection with emphasis on EHM.

  2. X-1 on display

    Science.gov (United States)

    1949-01-01

    A Bell Aircraft Corporation X-1 series aircraft on display at an Open House at NACA Muroc Flight Test Unit or High-Speed Flight Research Station hangar on South Base of Edwards Air Force Base, California. (The precise date of the photo is uncertain, but it is probably before 1948.) The instrumentation that was carried aboard the aircraft to gather data is on display. The aircraft data was recorded on oscillograph film that was read, calibrated, and converted into meaningful parameters for the engineers to evaluate from each research flight. In the background of the photo are several early U.S. jets. These include several Lockheed P-80 Shooting Stars, which were used as chase planes on X-1 flights; two Bell P-59 Airacomets, the first U.S. jet pursuit aircraft (fighter in later parlance); and a prototype Republic XP-84 Thunderjet. There were five versions of the Bell X-1 rocket-powered research aircraft that flew at the NACA High-Speed Flight Research Station, Edwards, California. The bullet-shaped X-1 aircraft were built by Bell Aircraft Corporation, Buffalo, N.Y. for the U.S. Army Air Forces (after 1947, U.S. Air Force) and the National Advisory Committee for Aeronautics (NACA). The X-1 Program was originally designated the XS-1 for eXperimental Sonic. The X-1's mission was to investigate the transonic speed range (speeds from just below to just above the speed of sound) and, if possible, to break the 'sound barrier.' Three different X-1s were built and designated: X-1-1, X-1-2 (later modified to become the X-1E), and X-1-3. The basic X-1 aircraft were flown by a large number of different pilots from 1946 to 1951. The X-1 Program not only proved that humans could go beyond the speed of sound, it reinforced the understanding that technological barriers could be overcome. The X-1s pioneered many structural and aerodynamic advances including extremely thin, yet extremely strong wing sections; supersonic fuselage configurations; control system requirements; powerplant

  3. Seleno-auranofin (Et3PAuSe-tagl): synthesis, spectroscopic (EXAFS, 197Au Mössbauer, 31P, 1H, 13C, and 77Se NMR, ESI-MS) characterization, biological activity, and rapid serum albumin-induced triethylphosphine oxide generation.

    Science.gov (United States)

    Hill, David T; Isab, Anvarhusein A; Griswold, Don E; DiMartino, Michael J; Matz, Elizabeth D; Figueroa, Angel L; Wawro, Joyce E; DeBrosse, Charles; Reiff, William M; Elder, Richard C; Jones, Benjamin; Webb, James W; Shaw, C Frank

    2010-09-06

    Seleno-auranofin (SeAF), an analogue of auranofin (AF), the orally active antiarthritic gold drug in clinical use, was synthesized and has been characterized by an array of physical techniques and biological assays. The Mössbauer and extended X-ray absorption fine structure (EXAFS) parameters of the solid compound demonstrate a linear P-Au-Se coordination environment at a gold(I) center, analogous to the structure of auranofin. The (31)P, (13)C, and (1)H NMR spectra of SeAF in chloroform solution closely resemble those of auranofin. The (77)Se spectrum consists of a singlet at 481 ppm, consistent with a metal-bound selenolate ligand. The absence of (2)J(PSe) coupling in the (31)P and (77)Se spectra may arise from dynamic processes occurring in solution or because the (2)J(PSe) coupling constants are smaller than the observed bandwidths. Electrospray ionization mass spectrometry (ESI-MS) spectra of SeAF in 50:50 methanol-water exhibited strong signals for [(Et(3)P)(2)Au](+), [(Et(3)PAu)(2)-mu-Se-tagl](+), and [Au(Se-tagl)(2)](-), which arise from ligand scrambling reactions. Three assays of the anti-inflammatory activity of SeAF allowed comparison to AF. SeAF exhibited comparable activity in the topically administered murine arachadonic acid-induced and phorbol ester-induced anti-inflammatory assays but was inactive in the orally administered carrageenan-induced assay in rats. However, in vivo serum gold levels were comparable in the rat, suggesting that differences between the in vivo metabolism of the two compounds, leading to differences in transport to the inflamed site, may account for the differential activity in the carrageenan-induced assay. Reactions of serum albumin, the principal transport protein of gold in the serum, demonstrated formation of AlbSAuPEt(3) at cysteine 34 and provided evidence for facile reduction of disulfide bonds at cysteine 34 and very rapid formation of Et(3)P=O, a known metabolite of auranofin.

  4. 2009 H1N1 Influenza 2009 H1N1 Influenza

    Directory of Open Access Journals (Sweden)

    Seth J. Sullivan, MD; Robert M. Jacobson, MD; Walter R. Dowdle, PhD; and Gregory A. Poland

    2011-04-01

    Full Text Available Within 2 months of its discovery last spring, a novel influenza A (H1N1 virus, currently referred to as 2009 H1N1, caused the first influenza pandemic in decades. The virus has caused disproportionate disease among young people with early reports of virulence similar to that of seasonal influenza. This clinical review provides an update encompassing the virology, epidemiology, clinical manifestations, diagnosis, treatment, and prevention of the 2009 H1N1 virus. Because information about this virus, its prevention,and treatment are rapidly evolving, readers are advised to seek additional information. We performed a literature search of PubMed using the following keywords: H1N1, influenza, vaccine, pregnancy, children, treatment, epidemiology, and review. Studies were selected for inclusion in this review on the basis of their relevance. Recent studies and articles were preferred.

    El Editor de este número especial agradece la autorización expresa, mediante comunicación escrita en nuestro poder, de los autores del trabajo “2009 H1N1 Influenza”, así como de los editores de la revista Mayo Clinic Proceedings, para su reproducción, como publicación secundaria en Medisur, artículo de revisión seleccionado por nosotros, que resume buena parte de los nuevos conocimientos adquiridos a partir de la literatura médica reciente relacionada con esta pandemia, durante el año 2009.

    De este modo, el artículo que a continuación de reproduce para los lectores de Medisur, está basado íntegramente en el estudio previamente publicado como: Sullivan SJ, Jacobson RM, Dowdle WR, Poland GA. 2009 H1N1 Influenza. Mayo Clin Proc. 2010;85(1:64-76.

    A continuación el resumen:

    Within 2 months of its discovery last spring, a novel influenza A (H1N1 virus, currently referred to as 2009 H1N1, caused the first influenza pandemic in decades. The virus has caused disproportionate disease among young people with early reports of virulence similar

  5. Fast integrated intravascular photoacoustic/ultrasound catheter

    Science.gov (United States)

    Choi, Changhoon; Cho, Seunghee; Kim, Taehoon; Park, Sungjo; Park, Hyoeun; Kim, Jinmoo; Lee, Seunghoon; Kang, Yeonsu; Jang, Kiyuk; Kim, Chulhong

    2016-03-01

    In cardiology, a vulnerable plaque is considered to be a key subject because it is strongly related to atherosclerosis and acute myocardial infarction. Because conventional intravascular imaging devices exhibit several limitations with regard to vulnerable plaque detection, the need for an effective lipid imaging modality has been continuously suggested. Photoacoustic (PA) imaging is a medical imaging technique with a high level of ultrasound (US) resolution and strong optical contrast. In this study, we successfully developed an integrated intravascular photoacoustic/ultrasound (IV-PAUS) imaging system with a catheter diameter of 1.2 mm for lipid-rich atherosclerosis imaging. An Nd:YAG pulsed laser with an excitation wavelength of 1064 nm was utilized. IV-PAUS offers 5-mm depth penetration and axial and lateral PA imaging resolutions of 94 μm and 203 μm, respectively, as determined by imaging a 6-μm carbon fiber. We initially obtained 3-dimensional (3D) co-registered PA/US images of metal stents. Subsequently, we successfully obtained 3D coregistered PA/US ex vivo images using an iliac artery from a rabbit atherosclerosis model. Accordingly, lipid-rich plaques were sufficiently differentiated from normal tissue in the ex vivo experiment. We validated these findings histologically to confirm the lipid content.

  6. Identification of a novel type of spacer element required for imprinting in fission yeast.

    Directory of Open Access Journals (Sweden)

    Suha Sayrac

    2011-03-01

    Full Text Available Asymmetrical segregation of differentiated sister chromatids is thought to be important for cellular differentiation in higher eukaryotes. Similarly, in fission yeast, cellular differentiation involves the asymmetrical segregation of a chromosomal imprint. This imprint has been shown to consist of two ribonucleotides that are incorporated into the DNA during lagging-strand synthesis in response to a replication pause, but the underlying mechanism remains unknown. Here we present key novel discoveries important for unravelling this process. Our data show that cis-acting sequences within the mat1 cassette mediate pausing of replication forks at the proximity of the imprinting site, and the results suggest that this pause dictates specific priming at the position of imprinting in a sequence-independent manner. Also, we identify a novel type of cis-acting spacer region important for the imprinting process that affects where subsequent primers are put down after the replication fork is released from the pause. Thus, our data suggest that the imprint is formed by ligation of a not-fully-processed Okazaki fragment to the subsequent fragment. The presented work addresses how differentiated sister chromatids are established during DNA replication through the involvement of replication barriers.

  7. HIV-1 envelope glycoprotein

    Energy Technology Data Exchange (ETDEWEB)

    Caulfield, Michael; Cupo, Albert; Dean, Hansi; Hoffenberg, Simon; King, C. Richter; Klasse, P. J.; Marozsan, Andre; Moore, John P.; Sanders, Rogier W.; Ward, Andrew; Wilson, Ian; Julien, Jean-Philippe

    2017-08-22

    The present application relates to novel HIV-1 envelope glycoproteins, which may be utilized as HIV-1 vaccine immunogens, and antigens for crystallization, electron microscopy and other biophysical, biochemical and immunological studies for the identification of broad neutralizing antibodies. The present invention encompasses the preparation and purification of immunogenic compositions, which are formulated into the vaccines of the present invention.

  8. Moschos' 1. Idyl

    DEFF Research Database (Denmark)

    Nielsen, Thomas Heine

    2009-01-01

    genudgivelse med indledning af Simon meislings oversættelse fra 1824 af Moschos' 1. idyl, Den bortløbne eros. Udgivelsesdato: 2009......genudgivelse med indledning af Simon meislings oversættelse fra 1824 af Moschos' 1. idyl, Den bortløbne eros. Udgivelsesdato: 2009...

  9. Diabetes Type 1

    Science.gov (United States)

    Diabetes means your blood glucose, or blood sugar, levels are too high. With type 1 diabetes, your pancreas does not make insulin. Insulin is ... kidneys, nerves, and gums and teeth. Type 1 diabetes happens most often in children and young adults ...

  10. PD-1 Blockers.

    Science.gov (United States)

    Wolchok, Jedd D

    2015-08-27

    Nivolumab and pembrolizumab are monoclonal antibodies that block the programmed death-1 receptor (PD-1, CD279), resulting in dis-inhibition of tumor-specific immune responses. Both are recently approved for use in the treatment of metastatic melanoma, and nivolumab as well for non-small cell lung cancer.

  11. Singularities around w=-1

    CERN Document Server

    Fernández-Jambrina, L

    2015-01-01

    In this talk we would like to analyse the appearance of singularities in FLRW cosmological models which evolve close to w=-1, where w is the barotropic index of the universe. We relate small terms in cosmological time around w=-1 with the correspondent scale factor of the universe and check for the formation of singularities.

  12. Reference: BOXBPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXBPSAS1 Ngai N, Tsai FY, Coruzzi G Light-induced transcriptional repression of the pea AS1 gene: identific...ation of cis-elements and transfactors Plant J 12:1021-1234 (1997) PubMed: 9418044; ...

  13. Reference: BOXCPSAS1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available BOXCPSAS1 Ngai N, Tsai FY, Coruzzi G Light-induced transcriptional repression of the pea AS1 gene: identific...ation of cis-elements and transfactors Plant J 12:1021-1234 (1997) PubMed: 9418044; ...

  14. Reference: MYBCOREATCYCB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available haracterization of cis-acting element involved in cell cycle phase-independent activation of Arath;CycB1;1 transcription and identifi...cation of putative regulatory proteins. Plant Mol Biol. 50:111-127 (2002). PubMed: 12139003 ...

  15. Main: CAREOSREP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CAREOSREP1 S000421 28-November-2004 (last modified) kehi CAREs (CAACTC regulatory e...lements) found in the promoter region of a cystein proteinase (REP-1) gene in rice; aleurone; GARE; gibberellin; seed; Oryza sativa (rice) CAACTC ...

  16. The No.1 Priority

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    At the beginning of each year, the Central Committee of theCommunist Party of China and the State Council jointly release thefirst document of the year, dubbed the No. 1 Document. The issuediscussed in the No. 1 Document is, of course, the most important to

  17. The No.1 Priority

    Institute of Scientific and Technical Information of China (English)

    YU SHUJUN

    2010-01-01

    @@ At the beginning of each year, the Central Committee of the Communist Party of China and the State Council jointly release the first document of the year, dubbed the No.1 Document. The issue discussed in the No.1 Document is, of course, the most important to the current economic and social development of the country.

  18. Reference: ACGTROOT1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTROOT1 Kim JC, Lee SH, Cheong YH, Yoo CM, Lee SI, Chun HJ, Yun DJ, Hong JC, Lee ...SY, Lim CO, Cho MJ A novel cold-inducible zinc finger protein from soybean, SCOF-1, enhances cold tolerance in transgenic plants Plant J 25: 247-259 (2001) PubMed: 11208017; ...

  19. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDRSZMFER1 Fourcroy P, Vansuyt G, Kushnir S, Inze D, Briat JF. Iron-regulated expre...ssion of a cytosolic ascorbate peroxidase encoded by the APX1 gene in Arabidopsis seedlings. Plant Physiol. 134: 605-613 (2004). . PubMed: 14739345 ...

  20. Excavation of LSS1

    CERN Multimedia

    1972-01-01

    Excavation of the long straight-section LSS1 by an Alpine boring machine. View of the connection chamber, in the background, the roofs of the enlarged sections (8.5 m and 6 m). On the right, the access tunnel to PP1.

  1. Main: ACGTATERD1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ACGTATERD1 S000415 03-Jun-2003 (last modified) kehi ACGT sequence (from -155 to -15...2) required for etiolation-induced expression of erd1 (early responsive to dehydration) in Arabidopsis; ACGT; etiolation; erd; Arabidopsis thaliana ACGT ...

  2. Anguillid herpesvirus 1 transcriptome

    NARCIS (Netherlands)

    Beurden, van S.J.; Gatherer, D.; Kerr, K.; Galbraith, J.; Herzyk, P.; Peeters, B.P.H.; Rottier, P.J.M.; Engelsma, M.Y.; Davidson, A.J.

    2012-01-01

    We used deep sequencing of poly(A) RNA to characterize the transcriptome of an economically important eel virus, anguillid herpesvirus 1 (AngHV1), at a stage during the lytic life cycle when infectious virus was being produced. In contrast to the transcription of mammalian herpesviruses, the overall

  3. Main: CACTFTPPCA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CACTFTPPCA1 S000449 19-August-2004 (last modified) kehi Tetranucleotide (CACT) is a...ion of the phosphoenolpyruvate carboxylase (ppcA1) of the C4 dicot F. trinervia; Y=T/C; mesohpyll; CACT; Flaveria trinervia YACT ...

  4. A Note on Indefinite Equation1/x+1/y+1/z +1/w+1/xyzw=0%关于不定方程1/x+1/y+1/z +1/w+1/xyzw=0的一点注记

    Institute of Scientific and Technical Information of China (English)

    管训贵

    2010-01-01

    利用初等方法研究了不定方程1/x+1/y+1/xyzw=1/z+1/w以及1/x+1/y+1/z=1/w+1/xyzw的正整数解问题,分别给出了它们的全部正整数解的公式:(x,y,z,w)=(n+k,n(n+k)-d/k,n2(n+k)2-n(n+k)d-k/kd,n)其中n,k,d为正整数,满足d|n2(n+k)2-k),d<n(n+k)-k,k|(n2-d) ;以及 (x,y,z,w)=(n+k,n(n+k)+d/k,n2(n+k)2+n(n+k)d-k/kd,n),其中n,k,d为正整数,满足 d|(n2(n+k)2-k) ,d<n2(n+k)2-k,k|(n2+d).

  5. TELECOM 1 multiservices network

    Science.gov (United States)

    Lombard, D.; Ramat, P.; Rancy, F.

    The main objectives of the TELECOM 1 French domestic satellite project are to set up a business communication network which is to carry a wide range of digital services including data, voice, and pictures between a number of small earth stations located on the subscribers' premises. The parallel development of terrestrial specialized services networks has enabled the fitting of the TELECOM 1 network with high interworking capabilities with these networks. It has also allowed TELECOM 1 to be designed as the basis of the Future Integrated Services Digital Network. The TELECOM 1 network consists of the terrestrial network, the satellite network, and the maintenance network. Various elements which include the terrestrial network; the satellite network, and its modulation, TDMA frame and terminals; the System Management Center; the signalling system; and the demand assignment operation which are involved in the operation of the multiservices network are presented. The TELECOM 1 network evolution until 1990 through the rapid development of the ISDN is discussed.

  6. Type 1 Tyrosinaemia

    LENUS (Irish Health Repository)

    Mannion, MA

    2016-06-01

    Tyrosinaemia type 1 (TYR1, OMIM# 276700) is a rare autosomal recessive disease that results from an enzyme defect that leads to a deficiency in fumarylacetoacetase (FAH)1. We present 3 cases of TYR1 in the Irish population over a 9 year period, the only cases known to have been diagnosed in Ireland since 1989. The common presenting symptom was hypoglycaemia and the diagnosis was made by the identification of the pathognomonic biomarker succinylacetone on urine organic acid analysis. We discuss the clinical presentation, biochemical and genetic results including one novel mutation. We also highlight the importance of early initiation of Nitisinone (NTBC), which reduces the complications of TYR1 and the incidence of liver transplantation in this population2.

  7. T(1,1,t+1,t,1)和T(1,1,t+2,t,1)的色唯一性%Chromatic Uniqueness of T(1,1,t+1,t,1)and T(1,1,t+2,t,1)

    Institute of Scientific and Technical Information of China (English)

    毛建树; 刘儒英

    2009-01-01

    In this paper,let h(G,x)denote adjoining polynomial of graph G,and β(G)denote the minimum negative real roots of h(G,,x),we prove that T(1,1,t+1,t,1)andT(1,1,t+2,t,1)with t≥3 are chromatically unique.%h(G,x)表示图G的伴随多项式,β(G)表示h(G,x)的最小负实根.证明了当t≥3时,T(1,1,t+1,t,1)和T(1,1,t+2,t,1)的补图的色唯一性.

  8. Influenza Stigma during the 2009 H1N1 Pandemic.

    Science.gov (United States)

    Earnshaw, Valerie A; Quinn, Diane M

    2013-06-01

    The current study examines the extent to which H1N1 was stigmatized at the height of the 2009 H1N1 pandemic in the U.S. and explores the role that H1N1 stigma played in people's desire for physical distance from others with H1N1. H1N1 was the most stigmatized disease, with participants endorsing greater prejudice towards people with H1N1 than people with cancer or HIV/AIDS. Further, H1N1 stigma partially mediated the relationship between participants' perceptions that H1N1 was threatening and their desire for physical distance from people with H1N1. Therefore, H1N1 stigma played a role in, but was not entirely responsible for, the relationship between perceptions that H1N1 was threatening and desire for distance from others with H1N1.

  9. Main: 1W1S [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1S トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1S.jpg ...

  10. Main: 1W1Q [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1Q トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1Q.jpg ...

  11. Main: 1W1R [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1R トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...LLFSSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1R.jpg ...

  12. Main: 1W1O [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1W1O トウモロコシ Corn Zea mays L. Cytokinin Dehydrogenase 1 Precursor Name=Ckx1; Zea May...SSVAPNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDIFN corn_1W1O.jpg ...

  13. Data of evolutionary structure change: 1DTGA-1B1XA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DTGA-1B1XA 1DTG 1B1X A A ---KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVAC...VVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKD...ndex>0 1DTG A 1DTGA A 1DTGA CQLCP-----GCGCS 2 1DTG A 1DTGA

  14. Data of evolutionary structure change: 1BU1A-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1A-1OOTA 1BU1 1OOT A A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW.../line> 1OOT A 1OOTA -19.135000228881836 0.26499998569488525 29.607999801635742 ...0.7739999890327454 0.5450000166893005 0.3240000009536743 tion> 1.8553839921951...in> 1OOT A 1OOTA WTGRV--NGREG

  15. Data of evolutionary structure change: 1BU1B-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1B-1OOTA 1BU1 1OOT B A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW... 1OOT A 1OOTA -18.01099967956543 29.775999069213867 13.968000411987305 ...381469727 -0.722000002861023 -0.6259999871253967 tion> 1.83514404296875...1OOT A 1OOTA WTGRV--NGREG

  16. Data of evolutionary structure change: 1B1GA-1CLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B1GA-1CLMA 1B1G 1CLM A A KSPEELKGIFEKYAAK-EGDPNQLSKEELKLLLQTEFPS...-- LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSL-----GQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFK...SN CA 464 1CLM A 1CLMA...dbChain> 1CLMA LQDMINEVDADGN HHHHHH 2 1CLM A 1CLMA

  17. Open Praxis, volumen 1 issue 1

    Directory of Open Access Journals (Sweden)

    Editor Open Praxis

    2007-01-01

    Full Text Available Table of Contents - A Study on the Importance of Fostering Trust in a Distance Learning Community Sónia Sousa, David Lamas & Brian Hudson (1-10 - Teacher Upgrading through Distance Education in a South African Context C. G. Kruger & Prof. E. J. Spamer (11-19 - An Investigation into Delivery of On-Line Courses within an Early Childhood Teacher Education Distance Programme in New Zealand Susan E. Smart (20-29 - Transnational Online Project Management Curriculum Model for Engineering Students Enrique Benimeli Bofarull, Anke Muendler, Peter Haber (30-39 - China Rural Distance Education and Construction of the New Countryside Li Fanghong & Zeng Yichun (40-46 - E-Learning in Japan: Steam Locomotive on Shinkansen Ali E. Ozkul, Ph.D. & Kumiko Aoki, Ph.D.  (47-55 - Widening Access to Higher Education: Open and Distance Learning in Higher Education Setting in Indonesia Paulina Pannen (56-65 - Research and Development of a Costing Toolkit for Distance, Flexible and ICT-Based Education for Teacher Development in Africa Frank R J Banks (66-75 - Fostering E-Learning in Medical Education: The Eurovacc Team Experience Guilherme Andrade Marson, Nathalie Debard, Jean-Pierre Kraehenbuhl, Pascal Py, Yan Cornneille, Laurent Richard, Alain Meystre (76-86 - Program Upgrading Teachers in Education Irene Hardy de Gómez (87-95 - ICT based learning strategies for Educating nomads Yogesh Kulkarni & Dr. Madhav Gaikwad (96-102 - Information and Communication Technology and Distance Education in Brazil Marta de Campos Maia & Fernando de Souza Meirelles (103-112 - ICDE’s interview with Susan D’Antoni, UNESCO International Institute for Educational Planning (IIEP (113-117 - ICDE Task Force Open Educational Resources – Inquiry Results (118-125 - 22nd ICDE – World Conference on Distance Education: Facts and figures (126-131

  18. Linac 1, inner structure

    CERN Multimedia

    1968-01-01

    This photo shows the inner structure of Linac 1. As injector to the PS, and later to the Booster, Linac 1 accelerated protons to 50 MeV, but it has also accelerated heavier ions. Fitted with a 520 keV RFQ pre-injector (instead of the original Cockcroft-Walton generator), it delivered protons and heavy ions to LEAR, from 1982 to 1992. After 33 years of faithful service, Linac 1 was dismantled in 1992 to make room for Linac 3 (Pb ions).

  19. The Paracaspase MALT1.

    Science.gov (United States)

    Hachmann, Janna; Salvesen, Guy S

    2016-03-01

    The human paracaspase MALT1 is a caspase homolog that plays a central role in NF-κB signaling. Over the past few years it has become clear that this is due to a combination of its scaffolding and proteolytic function. Knockout mice and mice expressing a catalytically dead variant of the protease have provided valuable information. This review aims to provide an overview of recent developments regarding the enzymatic mechanism and specificity of MALT1, its substrates discovered to date, different mouse models, as well as the role of MALT1 in NF-κB signaling downstream of a variety of different receptors.

  20. Polymer Blends. Volume 1

    Science.gov (United States)

    1992-05-01

    PBI/ ULTEM NEAT RESIN MOLDING EVALUATIONS 18 2.1.3 85/15 PBI/ ULTEM COMPOSITE EVALUATIONS 22 2.1.4 FIRST GENERATION SUMMARY 26 2.2 IMPROVED PBI/"BEST...PBI 37 2.2.4 85/15 eCPBI-2/ ULTEM NEAT RESIN EVALUATIONS 42 2.2.5 SECOND GENERATION SUMMARY 45 2.3 IMPROVED PBI/6F POLYIMIDE BLENDS: THIRD GENERATION...PYROMELLITIC DIANHYDRIDE 100 A1.2 REVIEW AND RISK ANALYSIS 105 iv FIGURES FIGURE PAGE # I HIGH PERFORMANCE POLYMER BLENDS PLAN 6 2 PBI/ ULTEM SEPARATION

  1. Epos Epic 1

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Epic 1书架音箱是Epos新推出的产品,Epic 1的设计十分重视每一个细节。在单元方面,Epic 1所使用的软球顶高音单元和中低音单元都是Epos全新开发的产品。其中,高音单元在设计时运用了CAD仿真软件进行辅助设计,从而保证了单元的品质。

  2. ATG16L1

    DEFF Research Database (Denmark)

    Salem, Mohammad; Ammitzboell, Mette; Nys, Kris;

    2015-01-01

    Genetic variations in the autophagic pathway influence genetic predispositions to Crohn disease. Autophagy, the major lysosomal pathway for degrading and recycling cytoplasmic material, constitutes an important homeostatic cellular process. Of interest, single-nucleotide polymorphisms in ATG16L1...... (autophagy-related 16-like 1 [S. cerevisiae]), a key component in the autophagic response to invading pathogens, have been associated with an increased risk of developing Crohn disease. The most common and well-studied genetic variant of ATG16L1 (rs2241880; leading to a T300A conversion) exhibits a strong...

  3. A Distributed Tier-1

    DEFF Research Database (Denmark)

    Fischer, Lars; Grønager, Michael; Kleist, Josva

    2008-01-01

    The Tier-1 facility operated by the Nordic DataGrid Facility (NDGF) differs significantly from other Tier-1s in several aspects: firstly, it is not located at one or a few premises, but instead is distributed throughout the Nordic countries; secondly, it is not under the governance of a single...... organization but instead is a meta-center built of resources under the control of a number of different national organizations. We present some technical implications of these aspects as well as the high-level design of this distributed Tier-1. The focus will be on computing services, storage and monitoring....

  4. Struktur von ABCE1

    OpenAIRE

    Karcher, Annette

    2007-01-01

    ABCE1 ist ein Mitglied der ATP Binding Cassette (ABC) Superfamilie. ABC Proteine binden und hydrolysieren ATP und verändern dabei ihre Konformation. Dadurch können sie mechanochemische Arbeit leisten. Durch drei zusätzliche Domänen unterscheidet sich ABCE1 von allen bislang bekannten und charakterisierten Mitgliedern dieser Familie. Neben den ATP-bindenden Regionen enthält ABCE1 eine cysteinreiche, N-terminale Domäne, welche zwei Eisen-Schwefel-Cluster bindet. Diese Domäne hat hohe s...

  5. 41 CFR 101-1.104-1 - Publication.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Publication. 101-1.104-1 Section 101-1.104-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.104-1...

  6. Reference: ZDNAFORMINGATCAB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ZDNAFORMINGATCAB1 Yadav V, Kundu S, Chattopadhyay D, Negi P, Wei N, Deng XW, Chatto...padhyay S Light regulated modulation of Z-box containing promoters by photoreceptors and downstream regulato

  7. Type 1 Diabetes Facts

    Science.gov (United States)

    ... and environmental triggers are involved. Its onset has nothing to do with diet or lifestyle. There is nothing you can do to prevent T1D, and—at present—nothing you can do to get rid of it. ...

  8. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard

    2015-01-01

    In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently......-of-school literacy practices. A final find-ing is the emphasis on teacher uncertainty regarding how and why to integrate technology within exist-ing paradigms of the subject. This calls for further research on how technology may be justified in L1 practice, including various forms of teacher education....... no systematic overview of the documented possibilities and challenges related to the use of technology in L1. At the same time, there is terminological confusion in use of ‘technology’ and related concepts in L1. Finally, there is a general lack of critical reflection on the relation between technological...

  9. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  10. Class 1 Areas

    Data.gov (United States)

    U.S. Environmental Protection Agency — A "Class 1" area is a geographic area recognized by the EPA as being of the highest environmental quality and requiring maximum protection. Class I areas are areas...

  11. Reference: CAREOSREP1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CAREOSREP1 Sutoh K, Yamauchi D. Two cis-acting elements necessary and sufficient for gibberellin-upre...gulated proteinase expression in rice seeds Plant J. 34:635-645 (2003) PubMed: 12787245; ...

  12. Type 1 diabetes

    DEFF Research Database (Denmark)

    Green, Anders; Kyvik, Kirsten Ohm

    2001-01-01

    Prediction of Type 1 diabetes at individual level is relevant for any possible intervention before clinical disease develops. Currently available markers of Type 1 diabetes include genetic specificities and immune markers, in addition to a positive family history. This chapter reviews the measures...... and methods of importance in predicting Type 1 diabetes. Based on numerical examples it is demonstrated that available markers have a low level of performance, even when combined. Even so, combined marker information may allow for the identification of the large majority of the general population who...... is at very low disease risk. The impact at population level of predicting Type 1 diabetes varies between societies because the performance of markers depends on levels of disease risk and distribution of markers within a population. The incorporation of the influence of non-genetic etiological factors may...

  13. Main: MARABOX1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available MARABOX1 S000063 13-Feb-2001 (last modified) kehi A-box found in SAR(scaffold attac...hment region; or matrix attachment region, MAR); MAR; SAR; matrix; A-box; scaffold; Drosophila; fly; AATAAAYAAA ...

  14. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard

    2015-01-01

    of empirical studies, what characterizes the research field?; and 3) for discussion, which broader implications does the review suggest for a rethinking of L1 in terms of practice and research? Introducing the notion of educational boundary objects, a theoretical framework is developed, which suggests four...... metaphors for understanding technology within L1: as a tool, as media, as socialization, and as literacy practices. These are found useful for analyzing and comparing both theoretical perspectives and empirical research on L1. A key finding of the study is that, although the included research......In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently...

  15. Reference: CACTFTPPCA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available CACTFTPPCA1 Gowik U, Burscheidt J, Akyildiz M, Schlue U, Koczor M, Streubel M, West...he promoter of the C4 phosphoenolpyruvate carboxylase gene. Plant Cell. 16:1077-1090(2004) PubMed: 15100398 ...

  16. Contaminant Candidate List 1

    Data.gov (United States)

    U.S. Environmental Protection Agency — CCL 1 is a list of contaminants that are currently not subject to any proposed or promulgated national primary drinking water regulations, that are known or...

  17. Main: ARE1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ARE1 S000022 16-Jan-1998 (last modified) kehi ARE (antioxidant response element); antioxidant... response element of rat glutathione S-transferase Ya subunit, and rat NAD(P)H:quinone reductase genes; antioxidant

  18. Alpha-1 Antitrypsin Deficiency

    Science.gov (United States)

    ... by blood tests showing the low levels of alpha-1 antitrypsin and abnormal liver tests. Other tests such as ultrasound imaging or tests using specialized X-ray techniques may be necessary. A liver biopsy may ...

  19. 3+1 Pariisis

    Index Scriptorium Estoniae

    2000-01-01

    Pariisis Arhitektuurigaleriis La Galerie d'Architecture näitus "4 Architectures", kuhu on valitud arhitektuuribürood neljast riigist: 3+1 arhitektid Eestist, Archis Lätist, Private Ideology Leedust, White arkitekter Rootsist.

  20. Main: PYRIMIDINEBOXHVEPB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available PYRIMIDINEBOXHVEPB1 S000298 10-Feb-2000 (last modified) seki Pyrimidine box found i... induction; See S000297, S000259; EPB; cysteine proteinase; GA; ABA; GARE; pyrimidine box; seed; aleurone; barley (Hordeum vulgare) TTTTTTCC ...

  1. Reference: PYRIMIDINEBOXHVEPB1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available PYRIMIDINEBOXHVEPB1 Cercos M, Gomez-Cadenas A, Ho THD Hormonal regulation of a cyst...dinated gene expression regulated by gibberellins and abscisic acid Plant J 19: 107-118 (1999) PubMed: 10476058 ...

  2. Mark 1 Test Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Mark I Test Facility is a state-of-the-art space environment simulation test chamber for full-scale space systems testing. A $1.5M dollar upgrade in fiscal year...

  3. Ajadi et al. (1)

    African Journals Online (AJOL)

    DELL

    The physico- chemical as well as microbiological qualities of water samples collected over a period of ten months from five ... The data showed variation in terms of swimming pools and seasons as o. -1 ...... (4 Ed). University of Texas Medical.

  4. 1Moist Forest R

    African Journals Online (AJOL)

    USER

    2014-11-15

    Nov 15, 2014 ... 1Moist Forest Research Station, Forestry Research Institute of ... extension contact, cocoa income, livestock income as well as level of education. .... The zone is a tropical coastal wetland with ..... Dry-Season Farming and.

  5. Chapter 1: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2009-01-18

    This report describes analysis undertaken by EERE to better understand the extent to which the technologies and market improvements funded by its fiscal year (FY) 2006 Budget Request1 will make energy more affordable, cleaner, and more reliable.

  6. Probability 1/e

    Science.gov (United States)

    Koo, Reginald; Jones, Martin L.

    2011-01-01

    Quite a number of interesting problems in probability feature an event with probability equal to 1/e. This article discusses three such problems and attempts to explain why this probability occurs with such frequency.

  7. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  8. Main: ABADESI1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ABADESI1 S000007 10-Feb-2000 (last modified) seki Responsive to ABA and desiccation...; Motif I of rice rab16A-D (initially called rab-21); Expressed in seeds late during embryogenesis; Induced

  9. Type 1 diabetes

    DEFF Research Database (Denmark)

    Green, Anders; Kyvik, Kirsten Ohm

    2001-01-01

    Prediction of Type 1 diabetes at individual level is relevant for any possible intervention before clinical disease develops. Currently available markers of Type 1 diabetes include genetic specificities and immune markers, in addition to a positive family history. This chapter reviews the measures...... and methods of importance in predicting Type 1 diabetes. Based on numerical examples it is demonstrated that available markers have a low level of performance, even when combined. Even so, combined marker information may allow for the identification of the large majority of the general population who...... is at very low disease risk. The impact at population level of predicting Type 1 diabetes varies between societies because the performance of markers depends on levels of disease risk and distribution of markers within a population. The incorporation of the influence of non-genetic etiological factors may...

  10. External Ballistics. Part 1

    Science.gov (United States)

    1978-07-11

    in -Cable I.1I. LCC 78107109 A6 i laklE 7.1. 2-. rpa 5 8 15 30 60 75 90 120 140 180 L M 556 890 668 3336 6721 8 008 144 155 20016 gay : Al). dey. Eage...unerator and the deo.minator cf the rigbt side cf tk$ Fteceding/revious equality on COSM +16 (v +cooy+ 6) cos + ifter integration let u* bave IB A O , g

  11. Symmetrization Selection Rules, 1

    CERN Document Server

    Page, P R

    1996-01-01

    We introduce a category of strong and electromagnetic interaction selection rules for the two-body connected decay and production of exotic J^{PC} = 0^{+-}, 1^{-+}, 2^{+-}, 3^{-+}, ... hybrid and four-quark mesons. The rules arise from symmetrization in states in addition to Bose symmetry and CP invariance. Examples include various decays to \\eta'\\eta, \\eta\\pi, \\eta'\\pi and four-quark interpretations of a 1^{-+} signal.

  12. Interleukin-1 in malnutrition.

    Science.gov (United States)

    Bhaskaram, P; Sivakumar, B

    1986-01-01

    The effect of malnutrition on the in vitro production of interleukin-1 by lipopolysaccharide stimulated circulating monocytes has been investigated in children suffering from kwashiorkor and marasmus. The interleukin-1 activity was significantly lower in children with severe malnutrition. Furthermore, macrophages from children with kwashiorkor produced factors that suppressed mouse thymocyte proliferation. These observations show a significant impairment of macrophage function and provide a mechanism for the suppression of cellular immunity in malnutrition. PMID:3082298

  13. Interleukin-1 in malnutrition.

    OpenAIRE

    1986-01-01

    The effect of malnutrition on the in vitro production of interleukin-1 by lipopolysaccharide stimulated circulating monocytes has been investigated in children suffering from kwashiorkor and marasmus. The interleukin-1 activity was significantly lower in children with severe malnutrition. Furthermore, macrophages from children with kwashiorkor produced factors that suppressed mouse thymocyte proliferation. These observations show a significant impairment of macrophage function and provide a m...

  14. Pesticidrester 1. kvartal 2015

    DEFF Research Database (Denmark)

    Andersen, Jens Hinge; Jensen, Bodil Hamborg

    Resultaterne af den danske pesticidkontrol fra Fødevarestyrelsen og DTU Fødevareinstituttet fra 1. kvartal 2015 viser, at ingen af de påviste sprøjterester udgør en sundhedsmæssig risiko.......Resultaterne af den danske pesticidkontrol fra Fødevarestyrelsen og DTU Fødevareinstituttet fra 1. kvartal 2015 viser, at ingen af de påviste sprøjterester udgør en sundhedsmæssig risiko....

  15. Msx1 Mutations

    Science.gov (United States)

    Wang, Y.; Kong, H.; Mues, G.; D’Souza, R.

    2011-01-01

    Mutations in the transcription factors PAX9 and MSX1 cause selective tooth agenesis in humans. In tooth bud mesenchyme of mice, both proteins are required for the expression of Bmp4, which is the key signaling factor for progression to the next step of tooth development. We have previously shown that Pax9 can transactivate a 2.4-kb Bmp4 promoter construct, and that most tooth-agenesis-causing PAX9 mutations impair DNA binding and Bmp4 promoter activation. We also found that Msx1 by itself represses transcription from this proximal Bmp4 promoter, and that, in combination with Pax9, it acts as a potentiator of Pax9-induced Bmp4 transactivation. This synergism of Msx1 with Pax9 is significant, because it is currently the only documented mechanism for Msx1-mediated activation of Bmp4. In this study, we investigated whether the 5 known tooth-agenesis-causing MSX1 missense mutations disrupt this Pax9-potentiation effect, or if they lead to deficiencies in protein stability, protein-protein interactions, nuclear translocation, and DNA-binding. We found that none of the studied molecular mechanisms yielded a satisfactory explanation for the pathogenic effects of the Msx1 mutations, calling for an entirely different approach to the investigation of this step of odontogenesis on the molecular level. PMID:21297014

  16. Wozu AT1-Rezeptorantagonisten?

    Directory of Open Access Journals (Sweden)

    Berent R

    2000-01-01

    Full Text Available ACE-Hemmer sind nun seit fast 20 Jahren im klinischen Einsatz. Ihre Effektivität in der Behandlung der arteriellen Hypertonie, der Herzinsuffizienz und bei nephrologischen Erkrankungen wurde durch eine große Zahl an randomisierten, prospektiven Studien belegt. Zusätzlich ist das Nebenwirkungsprofil (inklusive seltener Nebenwirkungen dieser Substanzklasse durch die langjährige Anwendung gut dokumentiert. Unter einer AT1-Rezeptorantagonistentherapie konnte bislang eindeutig gezeigt werden, daß das Auftreten von Nebenwirkungen, im speziellen des Reizhustens, deutlich seltener ist und im Placebobereich liegt, was die Compliance der Patienten sicherlich erhöht. Klinisch finden sich allerdings kaum Unterschiede in der Hämodynamik bei der Einnahme von ACE-Hemmern oder AT1-Rezeptorantagonisten. AT1-Rezeptorantagonisten blockieren sicherlich effektiver die AT1-rezeptorvermittelte Vasokonstriktion, währenddessen sich die ACE-Hemmerwirkung aus einer partiellen Abnahme der Angiotensin-II-Bildung und der Akkumulation von Bradykinin zusammensetzt. Aufgrund der derzeitigen Datenlage kann der AT1-Rezeptorantagonist nicht als Alternative zum ACE-Hemmer empfohlen werden, außer ein Absetzen des ACE-Hemmers ist wegen Nebenwirkungen notwendig. Auch die Kombinationstherapie, AT1-Rezeptorantagonist plus ACE-Hemmer, stellt zum jetzigen Zeitpunkt noch keine etablierte Therapie dar.

  17. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  18. 49 CFR 172.522 - EXPLOSIVES 1.1, EXPLOSIVES 1.2 and EXPLOSIVES 1.3 placards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false EXPLOSIVES 1.1, EXPLOSIVES 1.2 and EXPLOSIVES 1.3... INFORMATION, TRAINING REQUIREMENTS, AND SECURITY PLANS Placarding § 172.522 EXPLOSIVES 1.1, EXPLOSIVES 1.2 and EXPLOSIVES 1.3 placards. (a) Except for size and color, the EXPLOSIVES 1.1, EXPLOSIVES 1.2 and EXPLOSIVES 1.3...

  19. Data of evolutionary structure change: 1COBB-1F1GD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1COBB-1F1GD 1COB 1F1G B D ATKAVCVLKGDGPVQGTIHFEAKG--DTVVVTGSITGLTE-GDHGFHVHQFGD...NTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLAC...GVIGIAK -VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGN...VKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN ...pdbID>1F1G D 1F1GD FEQASESEPTTV

  20. Data of evolutionary structure change: 1BU1D-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1D-1OOTA 1BU1 1OOT D A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEESGE---WW...14> 1OOT A 1OOTA...tryChain> -21.645000457763672 -6.38100004196167 51.89799880981445 ...76022339 -0.7429999709129333 -0.09000000357627869 tion> 1.78559505939483641OOT A 1OOTA WTGRV--NGREG

  1. (4R-4-[(1R-1,2-Dihydroxyethyl]-1-[(1R-1-phenylethyl]pyrrolidin-2-one

    Directory of Open Access Journals (Sweden)

    Peter D. W. Boyd

    2008-09-01

    Full Text Available The title compound, C14H19NO3, was obtained as one of the two isomers of a Sharpless asymmetric dihydroxylation reaction of (1S-1-[(1R-1-phenylethyl]-4-vinylpyrrolidin-2-one. The absolute stereochemistry of this isomer was determined from the known stereochemistry (R at the bridge C atom between the phenyl and pyrrolidine rings. The molecules form one-dimensional tapes along the b axis via hydrogen bonding between the carbonyl O atom and the alcohol groups of neighbouring molecules. These assemble into sheets via interdigitative stacking of the phenyl rings and C—H...O interactions.

  2. 26 CFR 1.23-1 - Residential energy credit.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Residential energy credit. 1.23-1 Section 1.23-1... Rates During A Taxable Year § 1.23-1 Residential energy credit. (a) General rule. Section 23 or former section 44C provides a residential energy credit against the tax imposed by chapter 1 of the...

  3. 26 CFR 1.666(a)-1 - Amount allocated.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Amount allocated. 1.666(a)-1 Section 1.666(a)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED... January 1, 1969 § 1.666(a)-1 Amount allocated. (a)(1) If a trust other than a foreign trust created by a...

  4. 26 CFR 1.50-1 - Restoration of credit.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Restoration of credit. 1.50-1 Section 1.50-1... Computing Credit for Investment in Certain Depreciable Property § 1.50-1 Restoration of credit. (a) In general. Section 49(a) (relating to termination of credit) does not apply to property— (1) The...

  5. 26 CFR 1.1377-1 - Pro rata share.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Pro rata share. 1.1377-1 Section 1.1377-1...) INCOME TAXES Small Business Corporations and Their Shareholders § 1.1377-1 Pro rata share. (a) Computation of pro rata shares—(1) In general. For purposes of subchapter S of chapter 1 of the...

  6. 26 CFR 1.11-1 - Tax on corporations.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Tax on corporations. 1.11-1 Section 1.11-1... Corporations § 1.11-1 Tax on corporations. (a) Every corporation, foreign or domestic, is liable to the tax imposed under section 11 except (1) corporations specifically excepted under such section from such...

  7. 26 CFR 1.771-1 - Effective date.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Effective date. 1.771-1 Section 1.771-1 Internal... TAXES Effective Date for Subchapter K, Chapter 1 of the Code § 1.771-1 Effective date. (a) General rule.... Certain provisions of section 771 apply after specific dates in 1954, as follows: (1) Adoption of...

  8. TRUPACT-1 implementation plan

    Energy Technology Data Exchange (ETDEWEB)

    Hurley, J.D.; Tappen, J.J. (Westinghouse Electric Corp., Albuquerque, NM (United States). Joint Integration Office); Christensen, D.S. (USDOE Joint Integration Office, Albuquerque, NM (United States)) (eds.)

    1985-09-01

    TRUPACT-1, the TRansUranic PACkage Transporter is a packaging designed to transport defense contact handled transuranic (CH-TRU) waste from generating and interim TRU waste storage facilities to the Waste Isolation Pilot Plant (WIPP). Prior to fabrication and procurement of a full fleet, an initial design (TRUPACT-1) will be introduced to the defense TRU waste complex through use in an operational prototype fleet which will consist of Units 1, 2, and 3. In an effort to provide a relatively smooth introduction of the TRUPACT-1, the TRUPACT Technical Team (TTT) has developed the following implementation plan. The plan provides detailed information on user handling opportunities, schedules, equipment, responsibilities, reporting and data collection activities to be performed. The intent of this document is to provide users of the TRUPACT-1 with a guidance document, complete with references, that will allow the smooth introduction of this new transportation system by providing the information necessary for collecting operational, performance and cost data. These data will be used in modeling and full fleet design and procurement activities. In addition, these data will help fine tune procedures in the inspection and maintenance document and the operational document. Additional objectives of this plan are to aid in the establishment of site operational, inspection and maintenance procedures as well as training of site operators and briefing state and local officials.

  9. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  10. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  11. IUPHAR Review 1

    DEFF Research Database (Denmark)

    Harmar, Anthony J; Fahrenkrug, Jan; Gozes, Illana;

    2012-01-01

    (GHRH). VIP and PACAP exert their actions through three G protein-coupled receptors (GPCRs) - PAC(1) , VPAC(1) and VPAC(2) - belonging to class B (also referred to as class II, or secretin receptor-like GPCRs). This family comprises receptors for all peptides structurally related to VIP and PACAP...... in the control of circadian rhythms, learning and memory, anxiety and responses to stress and brain injury. Recent genetic studies also implicate the VPAC(2) receptor in susceptibility to schizophrenia and the PAC(1) receptor in post-traumatic stress disorder. In the periphery, VIP and PACAP play important roles...... the existing nomenclature for these receptors and reviews our current understanding of their structure, pharmacology and functions and their likely physiological roles in health and disease. More detailed information has been incorporated into newly revised pages in the IUPHAR database (http://iuphar-db.org/DATABASE/FamilyMenuForward?family...

  12. BIOTECHNOLOGY BIOPRODUCTS "HEALING-1"

    Directory of Open Access Journals (Sweden)

    S. I. Artiukhova

    2014-01-01

    Full Text Available Summary. The article presents data on the development of technology and qualitative research, bio-products «Healing-1». One of the promising directions in food biotechnology is the development of new integrated starter-based consortia of microorganisms, which have higher activity compared with cultures prepared using pure cultures. So it was interesting studies on the development of new biotechnology and bio-based microbial consortium of lactic acid bacteria. Based on the analysis of biotechnological properties of native cultures created a new consortium of microorganisms containing lactic acid streptococci and bacilli, allowing the maximum extent possible to implement the physiological, biochemical and technological potential of microorganisms. Scientifically substantiated and experimentally developed a new biotechnology production of bioproducts «Healing-1», obtained on the basis of microbial consortium with broad spectrum antimicrobial activity. Experimentally investigated quality parameters of organic food «Healing-1» using a new microbial consortium as freshly prepared and during storage. Found that antagonistic activity of microflora bio «Healing-1» with respect to pathogenic and conditionally pathogenic bacteria, as well as its resistance to substances in the gastrointestinal tract of man is more pronounced compared to bioproducts obtained using a separate starter, members of the microbial consortium. It should be noted a more pronounced synthesis of exopolysaccharides in bioproduct «Healing-1», which leads to increased viscosity of the system and improves the consistency of bio. New bioproducts have good organoleptic characteristics and contain a high number of viable cells of lactic acid bacteria. High stability and survival of lactic acid bacteria during storage. In the study of attacked proteins bioproducts digestive proteinases «in vitro» found that the fermentation of milk microbial consortium increases the digestibility

  13. Green syntheses, v.1

    CERN Document Server

    Tundo, Pietro

    2014-01-01

    Introduction to the Green Syntheses SeriesPietro Tundo and John AndraosApplication of Material Efficiency Metrics to Assess Reaction Greenness-Illustrative Case Studies from Organic SynthesesJohn AndraosReaction 1: Synthesis of 3-Benzyl-5-Methyleneoxazolidin-2-one from N-Benzylprop-2-yn-1-Amine and CO2Qing-Wen Song and Liang-Nian HeReaction 2: Synthesis of the 5-Membered Cyclic Carbonates from Epoxides and CO2Qing-Wen Song, Liang-Nian HePart I: Green Methods for the Epoxidation of

  14. Microelectronic systems 1 checkbook

    CERN Document Server

    Vears, R E

    2013-01-01

    Microelectronic Systems 1 Checkbook provides coverage of the Business and Technician Education Council level 1 unit in Microelectronic Systems. However, it can be regarded as a basic textbook in microelectronic systems for a much wider range of studies. Each topic considered in the text is presented in a way that assumes the reader has little prior knowledge of electronics. The aim of the book is to provide an introduction to the concept of systems, to differentiate analogue and digital systems, and to describe the nature of microprocessor-controlled systems. An introduction to programming is

  15. 1Q84

    Institute of Scientific and Technical Information of China (English)

    谈墨者

    2011-01-01

    1Q84年——我就这么来称呼这个新世界吧。不管喜欢还是不喜欢,目前我已经置身于这"1Q84年"。我必须尽快适应这个带着问号的世界,像被放进陌生森林中的动物一样,为了生存下去,得尽快了解并顺应这里的规则。

  16. DNM1 encephalopathy

    DEFF Research Database (Denmark)

    von Spiczak, Sarah; Helbig, Katherine L; Shinde, Deepali N

    2017-01-01

    cluster within the GTPase or middle domains, and structural modeling and existing functional data suggest a dominant-negative effect on DMN1 function. CONCLUSIONS: The phenotypic spectrum of DNM1-related encephalopathy is relatively homogeneous, in contrast to many other genetic epilepsies. Up to one......-third of patients carry the recurrent p.Arg237Trp variant, which is now one of the most common recurrent variants in epileptic encephalopathies identified to date. Given the predicted dominant-negative mechanism of this mutation, this variant presents a prime target for therapeutic intervention....

  17. A Quantum Monte Carlo Study on Mixed-Spin Chains of 1/2-1/2-1-1 and 3/2-3/2 -1-1

    Institute of Scientific and Technical Information of China (English)

    XU Zhao-Xin; ZHANG Jun; YING He-Ping

    2003-01-01

    The ground-state and thermodynamic properties of quantum mixed-spin chains of1/2-1/2-1-1and 3/2-3/2-1-1are investigated by a quantum Monte Carlo simulation with the loop-cluster algorithm. For 1/2-1/2-1-1 chain, we find it has two phases separated by an energy-gap vanishing point in the ground-state. For 3/2-3/2-1-1 chain, the numerical results show two energy-gap vanishing points isolated by different phases in its ground-state. Our calculations indicate that all these ground state phases can be understood by means of valence-bond-solid picture, and the thermodynamic behavior at finite temperatures is continuous as a function of parameterα=J2/J1.

  18. Density functional theory study of SO{sub 2}-adsorbed Ni(1 1 1) and hydroxylated NiO(1 1 1) surface

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Xin [Corrosion and Protection Center, Key Laboratory for Corrosion and Protection (MOE), University of Science and Technology Beijing, Beijing 100083 (China); Dong, Chaofang, E-mail: cfdong@ustb.edu.cn [Corrosion and Protection Center, Key Laboratory for Corrosion and Protection (MOE), University of Science and Technology Beijing, Beijing 100083 (China); Chen, Zhanghua [School of Mathematics and Physics. University of Science and Technology Beijing, Beijing 100083 (China); Xiao, Kui; Li, Xiaogang [Corrosion and Protection Center, Key Laboratory for Corrosion and Protection (MOE), University of Science and Technology Beijing, Beijing 100083 (China)

    2015-11-15

    Highlights: • The adsorption of O{sub 2} on Ni surface is weakened with the increasing coverage of O. • SO{sub 2} can adsorb on clean Ni(1 1 1) surface by molecular form. • SO{sub 2} can only adsorb on hydroxylated NiO surface with O vacancies. • The atomic O strengthens the adsorption of SO{sub 2} on substrate and passive film. • Unbroken passive film surface can inhibit the adsorption of SO{sub 2} effectively. - Abstract: Spin polarized, DFT + U periodic calculation is used as an effective way to model the adsorption process of SO{sub 2} on hydroxylated NiO(1 1 1) surface. The adsorption of atomic O and O{sub 2} on the clean Ni(1 1 1) surface is calculated to investigate the forming process of passive film. The molecular and dissociated adsorptions of H{sub 2}O on NiO(1 1 1) surface are evaluated to construct defect-free hydroxylated NiO(1 1 1) surface. The adsorption of SO{sub 2} and atomic O on clean Ni(1 1 1) surface is also investigated to compare with the adsorption capacity between passive film and substrate. With respect to the single adsorption process of SO{sub 2} on defect-free hydroxylated NiO(1 1 1) surface, the effects of O vacancy of surface and atomic O closed to the surface are investigated. The calculation results show that there is no chemical adsorption of SO{sub 2} on the defect-free hydroxylated NiO(1 1 1) surface with or without atomic O. Either single SO{sub 2} or SO{sub 2} with atomic O prefer adsorbing on the hydroxylated NiO(1 1 1) surface with O vacancies. The adsorption behavior is strengthened with the increase of percentage of surface O vacancy. The existence of atomic O leads to the production of SO{sub 3} on the hydroxylated NiO(1 1 1) surface and strengthens the adsorption capacity of SO{sub 2}. Furthermore, the results also reveal the relationship between the charge transfer and the adsorption energy of SO{sub 2} and atomic O on the hydroxylated NiO(1 1 1) surface and clean Ni(1 1 1) surface. We inferred that broken

  19. Preparation of 1,1'-dinitro-3,3'-azo-1,2,4-triazole. [1,1'-dinitro-3,3'-azo-1,2,4-triazole

    Science.gov (United States)

    Lee, K.Y.

    1985-03-05

    A new high density composition of matter, 1,1'-dinitro-3,3'-azo-1,2,4-triazole, has been synthesized using inexpensive, commonly available compounds. This compound has been found to be an explosive, and its use as a propellant is anticipated. 1 fig., 1 tab.

  20. Data of evolutionary structure change: 1BU1F-1OOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BU1F-1OOTA 1BU1 1OOT F A -IIVVALYDYEAIHHEDLSFQKGDQMVVLEES---GEWW...4> 1OOT A 1OOTA ...in> -2.4820001125335693 10.661999702453613 46.814998626708984 ...8 -0.6930000185966492 -0.30300000309944153 tion> 2.081804037094116 A 1OOTA WTGRV--NGREG