WorldWideScience

Sample records for repetition blindness rb

  1. Perceptual Repetition Blindness Effects

    Science.gov (United States)

    Hochhaus, Larry; Johnston, James C.; Null, Cynthia H. (Technical Monitor)

    1994-01-01

    The phenomenon of repetition blindness (RB) may reveal a new limitation on human perceptual processing. Recently, however, researchers have attributed RB to post-perceptual processes such as memory retrieval and/or reporting biases. The standard rapid serial visual presentation (RSVP) paradigm used in most RB studies is, indeed, open to such objections. Here we investigate RB using a "single-frame" paradigm introduced by Johnston and Hale (1984) in which memory demands are minimal. Subjects made only a single judgement about whether one masked target word was the same or different than a post-target probe. Confidence ratings permitted use of signal detection methods to assess sensitivity and bias effects. In the critical condition for RB a precue of the post-target word was provided prior to the target stimulus (identity precue), so that the required judgement amounted to whether the target did or did not repeat the precue word. In control treatments, the precue was either an unrelated word or a dummy.

  2. Orientation-Invariant Object Recognition: Evidence from Repetition Blindness

    Science.gov (United States)

    Harris, Irina M.; Dux, Paul E.

    2005-01-01

    The question of whether object recognition is orientation-invariant or orientation-dependent was investigated using a repetition blindness (RB) paradigm. In RB, the second occurrence of a repeated stimulus is less likely to be reported, compared to the occurrence of a different stimulus, if it occurs within a short time of the first presentation.…

  3. Repetition blindness for natural images of objects with viewpoint changes

    Directory of Open Access Journals (Sweden)

    Stephane eBuffat

    2013-01-01

    Full Text Available When stimuli are repeated in a rapid serial visual presentation (RSVP, observers sometimes fail to report the second occurrence of a target. This phenomenon is referred to as repetition blindness (RB. We report an RSVP experiment with photographs in which we manipulated object viewpoints between the first and second occurrences of a target (0-, 45-, or 90-degree changes, and spatial frequency content. Natural images were spatially filtered to produce low, medium, or high spatial-frequency stimuli. RB was observed for all filtering conditions. Surprisingly, for full-spectrum images, RB increased significantly as the viewpoint reached 90 degrees. For filtered images, a similar pattern of results was found for all conditions except for medium spatial-frequency stimuli. These findings suggest that object recognition in RSVP are subtended by viewpoint-specific representations for all spatial frequencies except medium ones.

  4. Sublexical Processing in Visual Recognition of Chinese Characters: Evidence from Repetition Blindness for Subcharacter Components

    Science.gov (United States)

    Yeh, Su-Ling; Li, Jing-Ling

    2004-01-01

    Repetition blindness (RB) refers to the failure to detect the second occurrence of a repeated item in rapid serial visual presentation (RSVP). In two experiments using RSVP, the ability to report two critical characters was found to be impaired when these two characters were identical (Experiment 1) or similar by sharing one repeated component…

  5. pRB Takes an EZ Path to a Repetitive Task.

    Science.gov (United States)

    Sanidas, Ioannis; Dyson, Nicholas J

    2016-12-15

    Repetitive DNA elements are essential for genome function; in this issue of Molecular Cell, Ishak et al. (2016) describe a novel mechanism of epigenetic repression at these elements that requires pRB-dependent recruitment of EZH2.

  6. rTMS of the occipital cortex abolishes Braille reading and repetition priming in blind subjects.

    Science.gov (United States)

    Kupers, R; Pappens, M; de Noordhout, A Maertens; Schoenen, J; Ptito, M; Fumal, A

    2007-02-27

    To study the functional involvement of the visual cortex in Braille reading, we applied repetitive transcranial magnetic stimulation (rTMS) over midoccipital (MOC) and primary somatosensory (SI) cortex in blind subjects. After rTMS of MOC, but not SI, subjects made significantly more errors and showed an abolishment of the improvement in reading speed following repetitive presentation of the same word list, suggesting a role of the visual cortex in repetition priming in the blind.

  7. Repetition Blindness Reveals Differences between the Representations of Manipulable and Nonmanipulable Objects

    Science.gov (United States)

    Harris, Irina M.; Murray, Alexandra M.; Hayward, William G.; O'Callaghan, Claire; Andrews, Sally

    2012-01-01

    We used repetition blindness to investigate the nature of the representations underlying identification of manipulable objects. Observers named objects presented in rapid serial visual presentation streams containing either manipulable or nonmanipulable objects. In half the streams, 1 object was repeated. Overall accuracy was lower when streams…

  8. Repetitive Daily Blindness with Hemiplegic Migraine and SCN1A Mutations

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2009-05-01

    Full Text Available Two novel SCN1A mutations are identified in two unrelated families with familial hemiplegic migraine and a unique phenotype of elicited repetitive daily blindness, in a report from Hopital Lariboisiere, and other centers in Paris, France, and Geneva, Switzerland.

  9. Theoretical Debate and Brain Mechanisms of Repetition Blindness Effect%重复知盲效应的理论之争及脑机制

    Institute of Scientific and Technical Information of China (English)

    肖雪珍; 王爱平

    2015-01-01

    重复知盲现象自被发现至今已走过四分之一世纪,这期间重复知盲的产生机制一直是争论的焦点,并有标记个体化理论、类型节点不应期理论、竞争理论、提取失败理论和建构/归因理论等多种理论解释。大量研究证明,重复知盲是一种视知觉失败现象,但也有研究认为它是一种记忆失败现象。很多研究还发现,重复知盲不仅受到呈现时间和间隔刺激个数的限制,还受到实验材料的性质、刺激的空间位置及人们的反应方式等多种因素的影响。近些年来,随着ERP和fMRI等技术的利用,从更深层次揭示了重复知盲产生的脑机制。同时,重复知盲也作为一种实验范式应用于视觉加工领域的研究中。目前关于重复知盲仍然有很多问题值得探索。%It has been over a quarter of a century since the repetition blindness (RB) effect was first reported by Kanwisher (1987) and the precise mechanism underlying RB has been extensively debated. Researchers proposed different theories to account for the effect, for example, it has been argued that RP occurs due to a failure at the visual perception level; alternatively, it has also been argued that RP involves failure to memorize the repeated stimulus. Meanwhile, RB is influenced by many factors, such as presentation durations, lags, experimental materials, spatial locations and tasks. The popularization of neuroscience technology such as ERP and fMRI in recent years allows researchers to reveal the brain activity of RB. As a kind of experimental method, researchers have applied RB effect to explore some phenomena of the visual perception. The current paper reviews these basic research topics. However, many aspects of repetition blindness are still worth of further exploration.

  10. Repetition suppression for speech processing in the associative occipital and parietal cortex of congenitally blind adults.

    Directory of Open Access Journals (Sweden)

    Laureline Arnaud

    Full Text Available In the congenitally blind (CB, sensory deprivation results in cross-modal plasticity, with visual cortical activity observed for various auditory tasks. This reorganization has been associated with enhanced auditory abilities and the recruitment of visual brain areas during sound and language processing. The questions we addressed are whether visual cortical activity might also be observed in CB during passive listening to auditory speech and whether cross-modal plasticity is associated with adaptive differences in neuronal populations compared to sighted individuals (SI. We focused on the neural substrate of vowel processing in CB and SI adults using a repetition suppression (RS paradigm. RS has been associated with enhanced or accelerated neural processing efficiency and synchronous activity between interacting brain regions. We evaluated whether cortical areas in CB were sensitive to RS during repeated vowel processing and whether there were differences across the two groups. In accordance with previous studies, both groups displayed a RS effect in the posterior temporal cortex. In the blind, however, additional occipital, temporal and parietal cortical regions were associated with predictive processing of repeated vowel sounds. The findings suggest a more expanded role for cross-modal compensatory effects in blind persons during sound and speech processing and a functional transfer of specific adaptive properties across neural regions as a consequence of sensory deprivation at birth.

  11. Repetition Suppression for Speech Processing in the Associative Occipital and Parietal Cortex of Congenitally Blind Adults

    Science.gov (United States)

    Arnaud, Laureline; Sato, Marc; Ménard, Lucie; Gracco, Vincent L.

    2013-01-01

    In the congenitally blind (CB), sensory deprivation results in cross-modal plasticity, with visual cortical activity observed for various auditory tasks. This reorganization has been associated with enhanced auditory abilities and the recruitment of visual brain areas during sound and language processing. The questions we addressed are whether visual cortical activity might also be observed in CB during passive listening to auditory speech and whether cross-modal plasticity is associated with adaptive differences in neuronal populations compared to sighted individuals (SI). We focused on the neural substrate of vowel processing in CB and SI adults using a repetition suppression (RS) paradigm. RS has been associated with enhanced or accelerated neural processing efficiency and synchronous activity between interacting brain regions. We evaluated whether cortical areas in CB were sensitive to RS during repeated vowel processing and whether there were differences across the two groups. In accordance with previous studies, both groups displayed a RS effect in the posterior temporal cortex. In the blind, however, additional occipital, temporal and parietal cortical regions were associated with predictive processing of repeated vowel sounds. The findings suggest a more expanded role for cross-modal compensatory effects in blind persons during sound and speech processing and a functional transfer of specific adaptive properties across neural regions as a consequence of sensory deprivation at birth. PMID:23717628

  12. The Mechanism of the Repetition Blindness Effect: Evidence From Chinese Reduplicated Words Processing%重复知盲效应产生的机制——来自汉语叠词加工的证据

    Institute of Scientific and Technical Information of China (English)

    冷英; 何秀丽

    2012-01-01

    the Experimental 1 trials, and at 198 ms per word on the Experimental 2 trials. Their task was to report all of the words or just to report the last two words. The results showed that (1) When presentation rates reached 128ms per word or 198ms per word, RB could occur in processing repeated Chinese characters in the full-report task. In the partial-report task, RB disappeared, but repetition priming (RP) did not occur. (2) In the full-report task, the correct rate of words report decreased, not only in the repeated stimulus lists but also in non-repeated stimulus lists in RSVP. The correct rate of non-repeated words report in the repeated stimulus lists was lower than in the non-repeated stimulus lists. The type-token individuation theory regards the repetition blindness as the failure of perception or encoding of the repeated words. And the construction theory considers the effect as the interference during words report and the failure of the retrieval of repeated words. These results indicated that the construction theory could more reasonably explanian the effect of repetition blindness. The study provided a new approach to examine the theories about the psychological mechanism of repetition blindness. The study used a new kind of materials to ascertain the reason why the repetition blindness occurred. Using Chinese reduplicated words as materials to exam the effect of repetition blindness could directly provide the context for the repeated words because the non-repeated words were bed- ded in repeated words. So it is an efficient way to distinguish between the type-token individuation theory and the construction theory on account of the characteristics of repetition in Chinese reduplicated words.

  13. Repetition Blindness in Chinese Polyphones Processing%汉字多音字加工过程中的重复知盲效应

    Institute of Scientific and Technical Information of China (English)

    冷英; 陈旭莲

    2011-01-01

    Repetition blindness (Kanwisher, 1987, 1991) refers to the phenomenon that participants have difficulty detecting repetitions of words (Cl and C2) presented in a rapid serial visual presentation (RSVP) paradigm. Several accounts focused on why and how the recognition deficit for C2 occurs, such as Token Individuation Theory (Kanwisher, 1987, 1991; Kanwisher & Potter, 1989, 1990; Chun, 1997), Refractory Period Hypothesis (Luo & Caramazza, 1995, 1996), Potential Retrieval-Based Models (Fagot, & Pashler, 1995), Construction and Attribution Theory (Masson, 2004; Whittlesea & Masson, 2005; Whittlesea & Hughes, 2005) and Competition Hypothesis (Morris, Still, & Caldwell-Harris Harris, 2009). Among these theories, Token Individuation Theory and Construction and Attribution Theory are the most widely influential. Up to now, it is difficult for them to come to an agreement on the processing level of repetition blindness. For example, Token Individuation Theory argued that repetition blindness was perception deficit, occurring at perception level, while Construction and Attribution Theory argued that repetition blindness was memory deficit, occurring at semantic level. The present research investigated the processing level of repetition blindness with Chinese Polyphones.We used a mixed design with three variables, one between-subject variable, Time Interval with two levels (100ms and 200ms), and two within-subject variables, Repetition with three levels (completely repeated, homophones repeated and different phonetic repeated), and Position with two levels (position homology and position dissimilarity). Each trial included three words, two experimental words (Cl and C2) and a high frequency word in between. All materials were presented on a computer screen in a rapid serial visual presentation (RSVP) paradigm. Participants were instructed to verbally report all words in a trial, no matter whether a word was repeated or not. The dependent variable was the accuracy rate for

  14. The Effect of Encoding Effectiveness from the Stimulus on Repetition Blindness%刺激的编码效力对重复知盲的影响

    Institute of Scientific and Technical Information of China (English)

    冷英; 邹煜晖; 莫雷

    2014-01-01

    通过改变目标刺激和非目标刺激的编码效力,探讨重复知盲发生的机制。采用RSVP任务,操作目标的重复性与目标的性质(实验1a 和实验2)、位置(实验1b)和非目标的字频(实验2),对比不同条件下第二个重复刺激的正确报告率。结果是:(1)非目标为字母、目标是字母时的重复知盲大于目标为电脑符号时的重复知盲。(2)非目标为字母、目标为电脑符号时,目标在1和3位置时出现了重复知盲,而在2和4位置时没有出现重复知盲。(3)当非目标为高频汉字、目标也是高频汉字时的重复知盲大于目标为符号时的重复知盲。(4)当目标为高频汉字、非目标是高频汉字时出现了重复知盲,而非目标是低频汉字时重复知盲消失。实验结果表明,字母和汉字条件下,目标刺激和非目标刺激的编码效力都会对重复知盲产生影响,支持竞争假设。%Repeating an item in a brief or rapid display usually produces faster or more accurate identifying of the item. However, sometimes the repetition produces the opposite effect that the second occurrence (R2) of a target (R1) in RSVP paradigm often fails to be reported. This phenomenon is called repetition blindness (Kanwisher, 1987). Existing theories of repetition blindness can be classified as activation/inhibition view which holds that the ability to report an item’s occurrence in short time depends on activation of an abstract representation of the item, and construction/attribution view which hold that the variability of repetition blindness when different aspects of the processing episode are changed (Morris, Still, &Caldwell-Harris, 2009). But neither view is able to explain the evidence from studies supporting the other view. Morris et al. (2009) supposed the Competition Hypothesis and challenged those views. According to the hypothesis, inter-item competition in RSVP is the key to initiate repetition blindness. However

  15. RB: Programmer Specification of Redundancy

    OpenAIRE

    Smith, Jonathan M.; Gerald Q. Maguire Jr.

    1987-01-01

    RB is a programming language for specifying redundancy in various dimensions. Avizienis's notation T I HIS, for Time I Hardware I Software, describes the different types of redundancy possible in a computation: repetition (nT I HIS), redundant hardware (T I nH I S), and program (software) (T I H InS). These can each be controlled by the programmer with RB. RB derives its name from its use of the recovery block notion to specify fault-tolerant segments of software. RB also supplies the program...

  16. The efficacy of cerebellar vermal deep high frequency (theta range) repetitive transcranial magnetic stimulation (rTMS) in schizophrenia: A randomized rater blind-sham controlled study.

    Science.gov (United States)

    Garg, Shobit; Sinha, Vinod Kumar; Tikka, Sai Krishna; Mishra, Preeti; Goyal, Nishant

    2016-09-30

    Repetitive transcranial magnetic stimulation (rTMS) is a promising therapeutic for schizophrenia. Treatment effects of rTMS have been variable across different symptom clusters, with negative symptoms showing better response, followed by auditory hallucinations. Cerebellum, especially vermis and its abnormalities (both structural and functional) have been implicated in cognitive, affective and positive symptoms of schizophrenia. rTMS to this alternate site has been suggested as a novel target for treating patients with this disorder. Hypothesizing cerebellar vermal magnetic stimulation as an adjunct to treat schizophrenia psychopathology, we conducted a double blind randomized sham controlled rTMS study. In this study, forty patients were randomly allocated (using block randomization method) to active high frequency (theta patterned) rTMS (n=20) and sham (n=20) groups. They received 10 sessions over 2 weeks. The Positive and Negative Syndrome Scale (PANSS) and Calgary Depression Scale for Schizophrenia (CDSS) scores were assessed at baseline, after last session and at 4 weeks (2 weeks post-rTMS). We found a significantly greater improvement in the group receiving active rTMS sessions, compared to the sham group on negative symptoms, and depressive symptoms. We conclude that cerebellar stimulation can be used as an effective adjunct to treat negative and affective symptoms.

  17. Effects of repetitive peripheral magnetic stimulation on upper-limb spasticity and impairment in patients with spastic hemiparesis: a randomized, double-blind, sham-controlled study.

    Science.gov (United States)

    Krewer, Carmen; Hartl, Sandra; Müller, Friedemann; Koenig, Eberhard

    2014-06-01

    To investigate short-term and long-term effects of repetitive peripheral magnetic stimulation (rpMS) on spasticity and motor function. Monocentric, randomized, double-blind, sham-controlled trial. Neurologic rehabilitation hospital. Patients (N=66) with severe hemiparesis and mild to moderate spasticity resulting from a stroke or a traumatic brain injury. The average time ± SD since injury for the intervention groups was 26 ± 71 weeks or 37 ± 82 weeks. rpMS for 20 minutes or sham stimulation with subsequent occupational therapy for 20 minutes, 2 times a day, over a 2-week period. Modified Tardieu Scale and Fugl-Meyer Assessment (arm score), assessed before therapy, at the end of the 2-week treatment period, and 2 weeks after study treatment. Additionally, the Tardieu Scale was assessed after the first and before the third therapy session to determine any short-term effects. Spasticity (Tardieu >0) was present in 83% of wrist flexors, 62% of elbow flexors, 44% of elbow extensors, and 10% of wrist extensors. Compared with the sham stimulation group, the rpMS group showed short-term effects on spasticity for wrist flexors (P=.048), and long-term effects for elbow extensors (P<.045). Arm motor function (rpMS group: median 5 [4-27]; sham group: median 4 [4-9]) did not significantly change over the study period in either group, whereas rpMS had a positive effect on sensory function. Therapy with rpMS increases sensory function in patients with severe limb paresis. The magnetic stimulation, however, has limited effect on spasticity and no effect on motor function. Copyright © 2014 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  18. Efficacy of bilateral repetitive transcranial magnetic stimulation for negative symptoms of schizophrenia : results of a multicenter double-blind randomized controlled trial

    NARCIS (Netherlands)

    Dlabac-de Lange, J. J.; Bais, L.; van Es, F. D.; Visser, B. G. J.; Reinink, E.; Bakker, B.; van den Heuvel, E. R.; Aleman, A.; Knegtering, H.

    2015-01-01

    Background. Few studies have investigated the efficacy of repetitive transcranial magnetic stimulation (rTMS) treatment for negative symptoms of schizophrenia, reporting inconsistent results. We aimed to investigate whether 10 Hz stimulation of the bilateral dorsolateral prefrontal cortex during 3 w

  19. Topical antioxidants protect the skin from chemical-induced irritation in the repetitive washing test: a placebo-controlled, double-blind study.

    Science.gov (United States)

    Schempp, Christoph M; Meinke, Martina C; Lademann, Jürgen; Ferrari, Yvonne; Brecht, Thomas; Gehring, Wolfgang

    2012-10-01

    There is increasing evidence that reactive oxygen species play an important role in the development of both irritant and allergic contact dermatitis. To assess the potential of topical antioxidants to prevent the development of experimentally induced irritant contact dermatitis. We evaluated the effect of a cream containing a combination of antioxidants on sodium lauryl sulfate-induced irritant contact dermatitis in the repetitive washing test. As readout parameters for skin barrier function and cutaneous inflammation stratum corneum hydration, cutaneous blood flow and transepidermal water loss were assessed in 25 volunteers with bioengineering methods. In comparison with the cream base and a frequently used barrier cream, the antioxidant cream had high radical scavenging activity and effectively protected the skin from chemical-induced irritation. The superiority of the cream with antioxidants to the cream base suggests that reactive oxygen species, at least in part, play a role in the development of irritant contact dermatitis. © 2012 John Wiley & Sons A/S.

  20. Effect of Low-Frequency Repetitive Transcranial Magnetic Stimulation on Naming Abilities in Early-Stroke Aphasic Patients: A Prospective, Randomized, Double-Blind Sham-Controlled Study

    Directory of Open Access Journals (Sweden)

    Konrad Waldowski

    2012-01-01

    Full Text Available Background and Purpose. Functional brain imaging studies with aphasia patients have shown increased cortical activation in the right hemisphere language homologues, which hypothetically may represent a maladaptive strategy that interferes with aphasia recovery. The aim of this study was to investigate whether low-frequency repetitive transcranial magnetic stimulation (rTMS over the Broca’s homologues in combination with speech/language therapy improves naming in early-stroke aphasia patients. Methods. 26 right-handed aphasic patients in the early stage (up to 12 weeks of a first-ever left hemisphere ischemic stroke were randomized to receive speech and language therapy combined with real or sham rTMS. Prior to each 45-minute therapeutic session (15 sessions, 5 days a week, 30 minutes of 1-Hz rTMS was applied. Outcome measures were obtained at baseline, immediately after 3 weeks of experimental treatment and 15 weeks; posttreatment using the Computerized Picture Naming Test. Results. Although both groups significantly improved their naming abilities after treatment, no significant differences were noted between the rTMS and sham stimulation groups. The additional analyses have revealed that the rTMS subgroup with a lesion including the anterior part of language area showed greater improvement primarily in naming reaction time 15 weeks after completion of the therapeutic treatment. Improvement was also demonstrated in functional communication abilities. Conclusions. Inhibitory rTMS of the unaffected right inferior frontal gyrus area in combination with speech and language therapy cannot be assumed as an effective method for all poststroke aphasia patients. The treatment seems to be beneficial for patients with frontal language area damage, mostly in the distant time after finishing rTMS procedure.

  1. Low frequency (1-Hz), right prefrontal repetitive transcranial magnetic stimulation (rTMS) compared with venlafaxine ER in the treatment of resistant depression: a double-blind, single-centre, randomized study.

    Science.gov (United States)

    Bares, Martin; Kopecek, Miloslav; Novak, Tomas; Stopkova, Pavla; Sos, Peter; Kozeny, Jiri; Brunovsky, Martin; Höschl, Cyril

    2009-11-01

    Previous studies have shown effectiveness of repetitive transcranial magnetic stimulation (rTMS) in the treatment of depression. This double-blind study compared efficacy of l Hz rTMS over the right prefrontal dorsolateral cortex with venlafaxine ER in the treatment of resistant depression. A total of 60 inpatients with depressive disorder (DSM-IV criteria), who previously did not respond to at least one antidepressant treatment, were randomly assigned to 1 Hz rTMS with placebo and venlafaxine ER with sham rTMS for 4 weeks. The primary outcome measure was score change in the Montgomery-Asberg Depression Rating Scale (MADRS). We also used Clinical Global Impression (CGI) and Beck Depressive. Inventory-Short Form (BDI-SF). The response was defined as a >or=50% reduction of MADRS score. There were no significant differences between treatment groups in MADRS (p=0.38), BDI-SF (p=0.56) and CGI (p=0.17) scores from baseline to endpoint. Response rates for rTMS (33%) and venlafaxine (39%) as well as remission (MADRS score

  2. 75 FR 69611 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 768, 772, and 772B Turbofan Engines

    Science.gov (United States)

    2010-11-15

    ... Directives; Rolls-Royce plc RB211-Trent 768, 772, and 772B Turbofan Engines AGENCY: Federal Aviation... require the same initial and repetitive visual inspections of Rolls-Royce plc RB211-Trent 768 and 772... directive (AD) 98-09-27, Amendment 39-10508 (63 FR 24911, May 6, 1998): Rolls-Royce plc: Docket No....

  3. Genetic Predisposition to Retinoblastoma (Rb)

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    Determination of 8 cytogenetic indicators in 14 cases of Rb,their 21 parents and 14 normal controls revealed various degrees ofchromosome instability and nondisjunction in the patients and their parents,indicating the presence of genetic neoplastic predisposition to neoplasm inRb patients.Eye Science 1993;9:149-152.

  4. RB975242 and RB975201 - Late maturation sugarcane varieties

    Directory of Open Access Journals (Sweden)

    Monalisa Sampaio Carneiro

    2016-11-01

    Full Text Available The sugarcane varieties RB975201 and RB975242 were developed and released for harvest at the end of the season (late maturation in the CentralSouth region of Brazil. In specific environments, these varieties were compared with commercial standards in sugar yield per area. They are resistant to major sugarcane diseases and present the Bru1 gene of resistance to brown rust.

  5. Repetitive maladaptive behavior: beyond repetition compulsion.

    Science.gov (United States)

    Bowins, Brad

    2010-09-01

    Maladaptive behavior that repeats, typically known as repetition compulsion, is one of the primary reasons that people seek psychotherapy. However, even with psychotherapeutic advances it continues to be extremely difficult to treat. Despite wishes and efforts to the contrary repetition compulsion does not actually achieve mastery, as evidenced by the problem rarely resolving without therapeutic intervention, and the difficulty involved in producing treatment gains. A new framework is proposed, whereby such behavior is divided into behavior of non-traumatic origin and traumatic origin with some overlap occurring. Repetitive maladaptive behavior of non-traumatic origin arises from an evolutionary-based process whereby patterns of behavior frequently displayed by caregivers and compatible with a child's temperament are acquired and repeated. It has a familiarity and ego-syntonic aspect that strongly motivates the person to retain the behavior. Repetitive maladaptive behavior of traumatic origin is characterized by defensive dissociation of the cognitive and emotional components of trauma, making it very difficult for the person to integrate the experience. The strong resistance of repetitive maladaptive behavior to change is based on the influence of both types on personality, and also factors specific to each. Psychotherapy, although very challenging at the best of times, can achieve the mastery wished and strived for, with the aid of several suggestions provided.

  6. Generation of pulsed and continuous-wave squeezed light with 87Rb vapor.

    Science.gov (United States)

    Agha, Imad H; Messin, Gaétan; Grangier, Philippe

    2010-03-01

    We present experimental studies on the generation of pulsed and continuous-wave squeezed vacuum via nonlinear rotation of the polarization ellipse in a (87)Rb vapor. Squeezing is observed for a wide range of input powers and pump detunings on the D1 line, while only excess noise is present on the D2 line. The maximum continuous-wave squeezing observed is -1.4 +/- 0.1 dB (-2.0 dB corrected for losses). We measure -1.1 dB squeezing at the resonance frequency of the (85)Rb F = 3 --> F' transition, which may allow the storage of squeezed light generated by (87)Rb in a (85)Rb quantum memory. Using a pulsed pump, pulsed squeezed light with -1 dB of squeezing for 200 ns pulse widths is observed at 1 MHz repetition rate.

  7. Grammatical Change through Repetition.

    Science.gov (United States)

    Arevart, Supot

    1989-01-01

    The effect of repetition on grammatical change in an unrehearsed talk is examined based on a case study of a single learner. It was found that repetition allows for accuracy monitoring in that errors committed in repeated contexts undergo correction. Implications for teaching are discussed. (23 references) (LB)

  8. The Negative Repetition Effect

    Science.gov (United States)

    Mulligan, Neil W.; Peterson, Daniel J.

    2013-01-01

    A fundamental property of human memory is that repetition enhances memory. Peterson and Mulligan (2012) recently documented a surprising "negative repetition effect," in which participants who studied a list of cue-target pairs twice recalled fewer targets than a group who studied the pairs only once. Words within a pair rhymed, and…

  9. Roles of repetitive sequences

    Energy Technology Data Exchange (ETDEWEB)

    Bell, G.I.

    1991-12-31

    The DNA of higher eukaryotes contains many repetitive sequences. The study of repetitive sequences is important, not only because many have important biological function, but also because they provide information on genome organization, evolution and dynamics. In this paper, I will first discuss some generic effects that repetitive sequences will have upon genome dynamics and evolution. In particular, it will be shown that repetitive sequences foster recombination among, and turnover of, the elements of a genome. I will then consider some examples of repetitive sequences, notably minisatellite sequences and telomere sequences as examples of tandem repeats, without and with respectively known function, and Alu sequences as an example of interspersed repeats. Some other examples will also be considered in less detail.

  10. Roles of repetitive sequences

    Energy Technology Data Exchange (ETDEWEB)

    Bell, G.I.

    1991-12-31

    The DNA of higher eukaryotes contains many repetitive sequences. The study of repetitive sequences is important, not only because many have important biological function, but also because they provide information on genome organization, evolution and dynamics. In this paper, I will first discuss some generic effects that repetitive sequences will have upon genome dynamics and evolution. In particular, it will be shown that repetitive sequences foster recombination among, and turnover of, the elements of a genome. I will then consider some examples of repetitive sequences, notably minisatellite sequences and telomere sequences as examples of tandem repeats, without and with respectively known function, and Alu sequences as an example of interspersed repeats. Some other examples will also be considered in less detail.

  11. Repetition and Translation Shifts

    Directory of Open Access Journals (Sweden)

    Simon Zupan

    2006-06-01

    Full Text Available Repetition manifests itself in different ways and at different levels of the text. The first basic type of repetition involves complete recurrences; in which a particular textual feature repeats in its entirety. The second type involves partial recurrences; in which the second repetition of the same textual feature includes certain modifications to the first occurrence. In the article; repetitive patterns in Edgar Allan Poe’s short story “The Fall of the House of Usher” and its Slovene translation; “Konec Usherjeve hiše”; are compared. The author examines different kinds of repetitive patterns. Repetitions are compared at both the micro- and macrostructural levels. As detailed analyses have shown; considerable microstructural translation shifts occur in certain types of repetitive patterns. Since these are not only occasional; sporadic phenomena; but are of a relatively high frequency; they reduce the translated text’s potential for achieving some of the gothic effects. The macrostructural textual property particularly affected by these shifts is the narrator’s experience as described by the narrative; which suffers a reduction in intensity.

  12. Willed blindness

    DEFF Research Database (Denmark)

    Gjerris, Mickey

    2015-01-01

    This article describes how we seem to live in a willed blindness towards the effects that our meat production and consumption have on animals, the environment and the climate. A willed blindness that cannot be explained by either lack of knowledge or scientific uncertainty. The blindness enables us...... blindness focusing on the development of either a new moral vision of our obligations or new visions of what a good life is....

  13. Color Blindness

    Institute of Scientific and Technical Information of China (English)

    严双红

    2007-01-01

    About one in 12 boys is color-blind, and one in every 400 girls, so in each school class there are likely to be at least one or two people who are color-blind. Because they are color- blind from birth, most people do not know that they are color-

  14. Repetitive transcranial magnetic stimulation increases the corticospinal inhibition and the brain-derived neurotrophic factor in chronic myofascial pain syndrome: an explanatory double-blinded, randomized, sham-controlled trial.

    Science.gov (United States)

    Dall'Agnol, Letizzia; Medeiros, Liciane Fernandes; Torres, Iraci L S; Deitos, Alicia; Brietzke, Aline; Laste, Gabriela; de Souza, Andressa; Vieira, Júlia Lima; Fregni, Felipe; Caumo, Wolnei

    2014-08-01

    Chronic myofascial pain syndrome has been related to defective descending inhibitory systems. Twenty-four females aged 19 to 65 years with chronic myofascial pain syndrome were randomized to receive 10 sessions of repetitive transcranial magnetic stimulation (rTMS) (n = 12) at 10 Hz or a sham intervention (n = 12). We tested if pain (quantitative sensory testing), descending inhibitory systems (conditioned pain modulation [quantitative sensory testing + conditioned pain modulation]), cortical excitability (TMS parameters), and the brain-derived neurotrophic factor (BDNF) would be modified. There was a significant interaction (time vs group) regarding the main outcomes of the pain scores as indexed by the visual analog scale on pain (analysis of variance, P myofascial pain syndrome were mediated by top-down regulation mechanisms, enhancing the corticospinal inhibitory system possibly via BDNF secretion modulation. High-frequency rTMS analgesic effects were mediated by top-down regulation mechanisms enhancing the corticospinal inhibitory, and this effect involved an increase in BDNF secretion. Copyright © 2014 American Pain Society. Published by Elsevier Inc. All rights reserved.

  15. Trialogue: Preparation, Repetition and...

    Science.gov (United States)

    Oberg, Antoinette; And Others

    1996-01-01

    This paper interrogates both curriculum theory and the limits and potentials of textual forms. A set of overlapping discourses (a trialogue) focuses on inquiring into the roles of obsession and repetition in creating deeply interpretive locations for understanding. (SM)

  16. RB1 in cancer: different mechanisms of RB1 inactivation and alterations of pRb pathway in tumorigenesis.

    Science.gov (United States)

    Di Fiore, Riccardo; D'Anneo, Antonella; Tesoriere, Giovanni; Vento, Renza

    2013-08-01

    Loss of RB1 gene is considered either a causal or an accelerating event in retinoblastoma. A variety of mechanisms inactivates RB1 gene, including intragenic mutations, loss of expression by methylation and chromosomal deletions, with effects which are species-and cell type-specific. RB1 deletion can even lead to aneuploidy thus greatly increasing cancer risk. The RB1gene is part of a larger gene family that includes RBL1 and RBL2, each of the three encoding structurally related proteins indicated as pRb, p107, and p130, respectively. The great interest in these genes and proteins springs from their ability to slow down neoplastic growth. pRb can associate with various proteins by which it can regulate a great number of cellular activities. In particular, its association with the E2F transcription factor family allows the control of the main pRb functions, while the loss of these interactions greatly enhances cancer development. As RB1 gene, also pRb can be functionally inactivated through disparate mechanisms which are often tissue specific and dependent on the scenario of the involved tumor suppressors and oncogenes. The critical role of the context is complicated by the different functions played by the RB proteins and the E2F family members. In this review, we want to emphasize the importance of the mechanisms of RB1/pRb inactivation in inducing cancer cell development. The review is divided in three chapters describing in succession the mechanisms of RB1 inactivation in cancer cells, the alterations of pRb pathway in tumorigenesis and the RB protein and E2F family in cancer.

  17. 重复经颅磁刺激辅助治疗精神分裂症的双盲对照研究%Repetitive transcranial magnetic stimulation for the treatment of schizophrenia:a double-blind study

    Institute of Scientific and Technical Information of China (English)

    王丹逢; 郭建雄; 刘恩益; 张春平; 卢想云

    2015-01-01

    目的:探讨重复经颅磁刺激治疗( rTMS)对精神分裂症阳性症状及阴性症状的效果。方法采用随机数字表法将64例符合《精神障碍诊断与统计手册(第4版)》( DSM-IV)诊断标准的精神分裂症患者分为研究组(真刺激)和对照组(伪刺激)各32例,在原有抗精神病药物剂量保持不变基础上,分别予2周10次的1Hz左侧颞顶叶rTMS真性刺激和假性刺激治疗。治疗开始前和治疗结束后均采用阳性和阴性症状量表( PANSS)评定临床疗效。结果两组在治疗后阳性症状评分、阴性症状评分、一般精神病理学评分、PANSS 总评分差异无统计学差异(P>0.05);治疗后研究组的幻觉性行为(P3)的减分率与对照组相比,差异有统计学差异(P0. 05). However,we do found that the hallucinatory behavior(P3)of the study group was significantly lower than it in the control group(P<0. 05). Conclusion Repeti-tive transcranial magnetic stimulation can improve the hallucinatory behavior(P3)of schizophrenia.

  18. [Cortical blindness].

    Science.gov (United States)

    Chokron, S

    2014-02-01

    Cortical blindness refers to a visual loss induced by a bilateral occipital lesion. The very strong cooperation between psychophysics, cognitive psychology, neurophysiology and neuropsychology these latter twenty years as well as recent progress in cerebral imagery have led to a better understanding of neurovisual deficits, such as cortical blindness. It thus becomes possible now to propose an earlier diagnosis of cortical blindness as well as new perspectives for rehabilitation in children as well as in adults. On the other hand, studying complex neurovisual deficits, such as cortical blindness is a way to infer normal functioning of the visual system.

  19. RbYb(PO34

    Directory of Open Access Journals (Sweden)

    Hui Chen

    2013-01-01

    Full Text Available Rubidium ytterbium(III tetrakis(polyphosphate, RbYb(PO34, was synthesized by solid-state reaction. It adopts structure type IV of the MRE(PO34 (M = alkali metal and RE = rare earth metal family of compounds. The structure is composed of a three-dimensional framework made up from double spiral polyphosphate chains parallel to [10-1] and irregular [YbO8] polyhedra. There are eight PO4 tetrahedra in the repeat unit of the polyphosphate chains. The Rb+ cation is located in channels extending along [100] that are delimited by the three-dimensional framework. It is surrounded by 11 O atoms, defining an irregular polyhedron.

  20. Observation of broad p-wave Feshbach resonances in ultracold $^{85}$Rb-$^{87}$Rb mixtures

    CERN Document Server

    Dong, Shen; Shen, Chuyang; Wu, Yewei; Tey, Meng Khoon; You, Li; Gao, Bo

    2016-01-01

    We observe new Feshbach resonances in ultracold mixtures of $^{85}$Rb and $^{87}$Rb atoms in the $^{85}$Rb$|2, +2\\rangle$+$^{87}$Rb$|1, +1\\rangle$ and $^{85}$Rb$|2, -2\\rangle$+$^{87}$Rb$|1, -1\\rangle$ scattering channels. The positions and properties of the resonances are predicted and characterized using the semi-analytic multichannel quantum-defect theory by Gao. Of particular interest, a number of broad entrance-channel dominated p-wave resonances are identified, implicating exciting opportunities for studying a variety of p-wave interaction dominated physics.

  1. Novel porcine repetitive elements

    Directory of Open Access Journals (Sweden)

    Nonneman Dan J

    2006-12-01

    Full Text Available Abstract Background Repetitive elements comprise ~45% of mammalian genomes and are increasingly known to impact genomic function by contributing to the genomic architecture, by direct regulation of gene expression and by affecting genomic size, diversity and evolution. The ubiquity and increasingly understood importance of repetitive elements contribute to the need to identify and annotate them. We set out to identify previously uncharacterized repetitive DNA in the porcine genome. Once found, we characterized the prevalence of these repeats in other mammals. Results We discovered 27 repetitive elements in 220 BACs covering 1% of the porcine genome (Comparative Vertebrate Sequencing Initiative; CVSI. These repeats varied in length from 55 to 1059 nucleotides. To estimate copy numbers, we went to an independent source of data, the BAC-end sequences (Wellcome Trust Sanger Institute, covering approximately 15% of the porcine genome. Copy numbers in BAC-ends were less than one hundred for 6 repeat elements, between 100 and 1000 for 16 and between 1,000 and 10,000 for 5. Several of the repeat elements were found in the bovine genome and we have identified two with orthologous sites, indicating that these elements were present in their common ancestor. None of the repeat elements were found in primate, rodent or dog genomes. We were unable to identify any of the replication machinery common to active transposable elements in these newly identified repeats. Conclusion The presence of both orthologous and non-orthologous sites indicates that some sites existed prior to speciation and some were generated later. The identification of low to moderate copy number repetitive DNA that is specific to artiodactyls will be critical in the assembly of livestock genomes and studies of comparative genomics.

  2. Blind Masseurs

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    Guan Enming and his wife Hao Dejuan, a blind couple, vowed to "never become a burden for society." The couple retired from the QJngdao Massotherapy Hospital in 1992, and thereafter opened a private clinic with assistance from their

  3. The Rb problem in massive AGB stars.

    Science.gov (United States)

    Pérez-Mesa, V.; García-Hernández, D. A.; Zamora, O.; Plez, B.; Manchado, A.; Karakas, A. I.; Lugaro, M.

    2017-03-01

    The asymptotic giant branch (AGB) is formed by low- and intermediate-mass stars (0.8 M_{⊙} develop thermal pulses (TP) and suffer extreme mass loss. AGB stars are the main contributor to the enrichment of the interstellar medium (ISM) and thus to the chemical evolution of galaxies. In particular, the more massive AGB stars (M > 4 M_{⊙}) are expected to produce light (e.g., Li, N) and heavy neutron-rich s-process elements (such as Rb, Zr, Ba, Y, etc.), which are not formed in lower mass AGB stars and Supernova explosions. Classical chemical analyses using hydrostatic atmospheres revealed strong Rb overabundances and high [Rb/Zr] ratios in massive AGB stars of our Galaxy and the Magellanic Clouds (MC), confirming for the first time that the ^{22}Ne neutron source dominates the production of s-process elements in these stars. The extremely high Rb abundances and [Rb/Zr] ratios observed in the most massive stars (specially in the low-metallicity MC stars) uncovered a Rb problem; such extreme Rb and [Rb/Zr] values are not predicted by the s-process AGB models, suggesting fundamental problems in our present understanding of their atmospheres. We present more realistic dynamical model atmospheres that consider a gaseous circumstellar envelope with a radial wind and we re-derive the Rb (and Zr) abundances in massive Galactic AGB stars. The new Rb abundances and [Rb/Zr] ratios derived with these dynamical models significantly resolve the problem of the mismatch between the observations and the theoretical predictions of the more massive AGB stars.

  4. MIMICRY, DIFFERENCE AND REPETITION

    Directory of Open Access Journals (Sweden)

    Marcelo Mendes de Souza

    2008-07-01

    Full Text Available This article addresses Homi K. Bhabha’s concept of mimicry in a broader context, other than that of cultural studies and post-colonial studies, bringing together other concepts, such as that of Gilles Deleuze in Difference and repetition, among other texts, and other names, such as Silviano Santiago, Jorge Luís Borges, Franz Kafka and Giorgio Agamben. As a partial conclusion, the article intends to oppose Bhabha’s freudian-marxist view to Five propositions on Psychoanalysis (1973, Gilles Deleuze’s text about Psychoanalysis published right after his book The Anti-Oedipus.

  5. [Rb(18-crown-6][Rb([2.2.2]-cryptand]Rb2Sn9·5NH3

    Directory of Open Access Journals (Sweden)

    Stefanie Gaertner

    2011-05-01

    Full Text Available The crystal structure of the title compound, poly[[(4,7,13,16,21,24-hexaoxa-1,10-diazabicyclo[8.8.8]hexacosanerubidium] [[(1,4,7,10,13,16-hexaoxacyclooctadecanerubidium]di-μ-rubidium-μ-nonastannide] pentaammonia], {[Rb(C18H36N2O6][Rb3Sn9(C12H24O6C12H24O6]·5NH3}n represents the first ammoniate of a Zintl anion together with two different chelating substances, namely 18-crown-6 and [2.2.2]-cryptand. The involvement of these large molecules in the crystal structure of [Rb(18-crown-6][Rb([2.2.2]-cryptand]Rb2Sn9·5NH3 leads to the formation of a new structural motif, namely one-dimensionally extended double strands running parallel to [100] and built by Sn94− cages and Rb+ cations. The double strands are shielded by 18-crown-6 and [2.2.2]-cryptand. The cations are additionally coordinated by ammonia molecules. One of the four independent Rb+ cations is disordered over two sets of sites in a 0.74 (2:0.26 (2 ratio.

  6. Repetitive behaviours in patients with Gilles de la Tourette syndrome: tics, compulsions, or both?

    Directory of Open Access Journals (Sweden)

    Yulia Worbe

    Full Text Available BACKGROUND: Repetitive behaviours (RB in patients with Gilles de la Tourette syndrome (GTS are frequent. However, a controversy persists whether they are manifestations of obsessive-compulsive disorder (OCD or correspond to complex tics. METHODS: 166 consecutive patients with GTS aged 15-68 years were recruited and submitted to extensive neurological, psychiatric and psychological evaluations. RB were evaluated by the YBOCS symptom checklist and Mini International Neuropsychiatric Interview (M.I.N.I, and classified on the basis of a semi-directive psychiatric interview as compulsions or tics. RESULTS: RB were present in 64.4% of patients with GTS (107/166 and categorised into 3 major groups: a 'tic-like' group (24.3%-40/166 characterised by RB such as touching, counting, 'just right' and symmetry searching; an 'OCD-like' group (20.5%-34/166 with washing and checking rituals; and a 'mixed' group (13.2%-22/166 with both 'tics-like' and 'OCD-like' types of RB present in the same patient. In 6.3% of patients, RB could not be classified into any of these groups and were thus considered 'undetermined'. CONCLUSIONS: The results confirm the phenomenological heterogeneity of RB in GTS patients and allows to distinguish two types: tic-like behaviours which are very likely an integral part of GTS; and OCD-like behaviours, which can be considered as a comorbid condition of GTS and were correlated with higher score of complex tics, neuroleptic and SSRIs treatment frequency and less successful socio-professional adaptation. We suggest that a meticulous semiological analysis of RB in GTS patients will help to tailor treatment and allow to better classify patients for future pathophysiologic studies. TRIAL REGISTRATION: ClinicalTrials.gov NCT00169351.

  7. Blind Ambition

    Science.gov (United States)

    Olson, Catherine Applefeld

    2009-01-01

    No matter how dedicated they may be, some teachers are daunted by extreme challenges. Carol Agler, music director at the Ohio State School for the Blind (OSSB), is not one of those teachers. Since joining the OSSB staff 11 years ago, Agler has revived the school's long-dormant band program and created its first marching band. Next January, she…

  8. Skin tumors Rb(eing uncovered

    Directory of Open Access Journals (Sweden)

    CLOTILDE eCOSTA

    2013-12-01

    Full Text Available The Rb1 gene was the first bona fide tumor suppressor identified and cloned more than 25 years ago. Since then, a plethora of studies have revealed the functions of pRb and the existence of a sophisticated and strictly regulated pathway that modulates such functional roles. An emerging paradox affecting Rb1 in cancer connects the relatively low number of mutations affecting Rb1 gene in specific human tumors, compared with the widely functional inactivation of pRb in most, if not in all, human cancers. The existence of a retinoblastoma family of proteins pRb, p107 and p130 and their potential unique and overlapping functions as master regulators of cell cycle progression and transcriptional modulation by similar processes, may provide potential clues to explain such conundrum. Here, we will review the development of different genetically engineered mouse models, in particular those affecting stratified epithelia, and how they have offered new avenues to understand the roles of the Rb family members and their targets in the context of tumor development and progression.

  9. Repetition in Waiting for Godot

    Institute of Scientific and Technical Information of China (English)

    李想; 魏妍

    2015-01-01

    Waiting for Godot is one of the most famous plays written by Samuel Barclay Beckett, and also is the founding work of“Theatre of the Absurd”. In the drama, repetitive phenomena shed light on the whole construction considerably. All the charac-ters were helpless and unthinking. Their dialogues were simple, nonsense and repetitive. Two scenes were cyclical. Repetition was used subtly in order to express the theme of the play, showing mental crisis after depravation of WWII.

  10. 高频重复经颅磁刺激治疗精神分裂症难治性阴性症状的随机双盲对照试验%Effects of high frequency repetitive transcranial magnetic stimulation on refractory negative symptom of schizophrenia: A double blind, randomized controlled trial

    Institute of Scientific and Technical Information of China (English)

    任艳萍; 周东丰; 蔡焯基; 黄青; 卢芩; 陈琦

    2011-01-01

    目的:探讨双背侧前额叶高频重复经颅磁刺激(repetitive transcranial magnetic stimulation,rTMS)治疗精神分裂症难治性阴性症状的疗效和安全性,并观察不良反应.方法:本研究为双盲随机对照临床试验.研究对象来源于2002年11月1日至2003年12月31日期间就诊于北京大学第六医院和北京安定医院的门诊和住院患者,符合美国精神疾病诊断与统计手册第4版(Diagnostic and Statistical Manual of Mental Disorders,Fourth Edition,DSM.IV)中精神分裂症诊断标准.23例以难治性阴性症状为主的精神分裂症患者随机分为rTMS治疗组(n=12)和对照组(n=11),分别给予10次20Hz rTMS真刺激和伪刺激治疗,治疗期间维持原有抗精神病药种类及剂量不变.采用阳性和阴性症状量表(Positive and Negative Syndrome Scale,PANSS)评估临床症状,采用治疗中需处理的不良反应症状量表(Treatment Emergent Symptom scale,TESS)及其他检查评估不良反应.结果:23例患者均完成治疗.治疗组有效率高于对照组(34%vs.17%,P<0.05).未观察到明显不良反应.结论:抗精神病药合并20 Hz双背侧前额叶重复经颅磁刺激治疗精神分裂症难治性阴性症状有效、安全.%Objective: To examine the therapeutic effects of dual dorsolateral prefrontal repetitive transcranial magnetic stimulation ( rTMS ) on refractory negative symptom experienced by patients with schizophrenia. Methods: A double-blind, randomized controlled study was conducted. Totally 23 schizophrenic patients met the Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition (DSM-IV) criteria for schizophrenia were recruited. Subjects were grouped into active treatment subgroup and sham subgroup randomly. Clinical symptom was measured with the Positive and Negative Symptom Scale (PANSS) . Side effects were valuated with the Treatment Emergent Symptom Scale (TESS). Results: Totally 23 subjects completed the trial. The treatment efficiency of

  11. Rb1 GENE MUTATIONS IN OSTEOSARCOMA

    Institute of Scientific and Technical Information of China (English)

    ZENG Ji-bin; SONG Yue; WANG Yi; SHI Yu-yuan

    1999-01-01

    @@ Genetic alternations, such as mutations caused inactivities of tumor suppressor gene, have been identified in a wide variety of tumors, including osteosarcoma. Osteosarcoma is the most frequent primary malignant bone tumor that occurs in the extremities of young adolescents in most cases. Because of the high frequent occurrence of this type of tumor in hereditary retinoblastoma patients, involvement of the Rb1 gene mutations was suspected in the development of osteosarcoma, and a few reports have shown alternations of the Rb1 gene in osteosarcoma. We studied Rb1 gene mutations in 9 osteosarcoma samples and one cell line (OS 732) to explore the types and mechanism of Rb1 gene mutations in osteosarcoma.

  12. Understanding maximal repetitions in strings

    CERN Document Server

    Crochemore, Maxime

    2008-01-01

    The cornerstone of any algorithm computing all repetitions in a string of length n in O(n) time is the fact that the number of runs (or maximal repetitions) is O(n). We give a simple proof of this result. As a consequence of our approach, the stronger result concerning the linearity of the sum of exponents of all runs follows easily.

  13. RB975952 – Early maturing sugarcane cultivar

    Directory of Open Access Journals (Sweden)

    Monalisa Sampaio Carneiro

    2015-08-01

    Full Text Available RB975952 is an early maturing sugarcane cultivar released for the South-Central region of Brazil. It should be harvested between April and May, and it is recommended for planting in environments with medium to high production potential. RB975952 has high resistance levels to the main diseases of the crop, it also has a good shoot development after mechanical harvesting, and high sucrose yields.

  14. (87)Rb-stabilized 375-MHz Yb:fiber femtosecond frequency comb.

    Science.gov (United States)

    Schratwieser, Thomas C; Balskus, Karolis; McCracken, Richard A; Farrell, Carl; Leburn, Christopher G; Zhang, Zhaowei; Lamour, Tobias P; Ferreiro, Teresa I; Marandi, Alireza; Arnold, Aidan S; Reid, Derryck T

    2014-05-01

    We report a fully stabilized 1030-nm Yb-fiber frequency comb operating at a pulse repetition frequency of 375 MHz. The comb spacing was referenced to a Rb-stabilized microwave synthesizer and the comb offset was stabilized by generating a super-continuum containing a coherent component at 780.2 nm which was heterodyned with a (87)Rb-stabilized external cavity diode laser to produce a radio-frequency beat used to actuate the carrier-envelope offset frequency of the Yb-fiber laser. The two-sample frequency deviation of the locked comb was 235 kHz for an averaging time of 50 seconds, and the comb remained locked for over 60 minutes with a root mean squared deviation of 236 kHz.

  15. Lysine methylation regulates the pRb tumour suppressor protein.

    Science.gov (United States)

    Munro, S; Khaire, N; Inche, A; Carr, S; La Thangue, N B

    2010-04-22

    The pRb tumour suppressor protein has a central role in coordinating early cell cycle progression. An important level of control imposed on pRb occurs through post-translational modification, for example, phosphorylation. We describe here a new level of regulation on pRb, mediated through the targeted methylation of lysine residues, by the methyltransferase Set7/9. Set7/9 methylates the C-terminal region of pRb, both in vitro and in cells, and methylated pRb interacts with heterochromatin protein HP1. pRb methylation is required for pRb-dependent cell cycle arrest and transcriptional repression, as well as pRb-dependent differentiation. Our results indicate that methylation can influence the properties of pRb, and raise the interesting possibility that methylation modulates pRb tumour suppressor activity.

  16. RB: An essential player in adult neurogenesis.

    Science.gov (United States)

    Fong, Bensun C; Slack, Ruth S

    2017-01-01

    The fundamental mechanisms underlying adult neurogenesis remain to be fully clarified. Members of the cell cycle machinery have demonstrated key roles in regulating adult neural stem cell (NSC) quiescence and the size of the adult-born neuronal population. The retinoblastoma protein, Rb, is known to possess CNS-specific requirements that are independent from its classical role as a tumor suppressor. The recent study by Vandenbosch et al. has clarified distinct requirements for Rb during adult neurogenesis, in the restriction of proliferation, as well as long-term adult-born neuronal survival. However, Rb is no longer believed to be the main cell cycle regulator maintaining the quiescence of adult NSCs. Future studies must consider Rb as part of a larger network of regulatory effectors, including the other members of the Rb family, p107 and p130. This will help elucidate the contribution of Rb and other pocket proteins in the context of adult neurogenesis, and define its crucial role in regulating the size and fate of the neurogenic niche.

  17. Time-resolved detection of relative intensity squeezed nanosecond pulses in a Rb87 vapor

    CERN Document Server

    Agha, Imad H; Glorieux, Quentin; Coudreau, Thomas; Grangier, Philippe; Messin, Gaetan

    2011-01-01

    We present theoretical and experimental results on the generation and detection of pulsed, relative-intensity squeezed light in a hot Rb87 vapor. The intensity noise correlations between a pulsed probe beam and its conjugate, generated through nearly-degenerate four-wave mixing in a double-lambda system, are studied numerically and measured experimentally via time-resolved balanced detection. We predict and observe about -1 dB of time-resolved relative intensity squeezing with 50 nanosecond pulses at 1 MHz repetition rate. (-1.34 dB corrected for loss).

  18. Crystal structure of Rb-elpasolite Rb{sub 2}NaAlF{sub 6}

    Energy Technology Data Exchange (ETDEWEB)

    Yakubovich, O. V., E-mail: yakubol@geol.msu.ru; Kiryukhina, G. V.; Dimitrova, O. V. [Moscow State University, Faculty of Geology (Russian Federation)

    2013-05-15

    Single crystals of Rb{sub 2}NaAlF{sub 6}, the Rb analogue of the mineral elpasolite, are obtained in the NaF-Rb{sub 2}CO{sub 3}-Al{sub 2}O{sub 3}-Rb{sub 3}PO{sub 4}-H{sub 2}O system under hydrothermal conditions, and their structure is determined by X-ray diffraction (R = 0.0188): a = 8.3087(1) A, space group Fm3bar m, Z = 4, and {rho}{sub calcd} = 3.88 g/cm{sup 3}. The hypothesis that Rb elpasolite exists in nature in late associations of pegmatites enriched in rubidium is proposed.

  19. Proton instability of {sup 73}Rb

    Energy Technology Data Exchange (ETDEWEB)

    Jokinen, A. [CERN, Geneva (Switzerland). PPE Div.; Oinonen, M. [Univ. of Jyvaeskylae (Finland). Dept. of Physics; Aeystoe, J. [CERN, Geneva (Switzerland). PPE Div.]|[Univ. of Jyvaeskylae (Finland). Dept. of Physics] [and others; ISOLDE Collaboration

    1996-08-01

    The study of the stability of an astrophysically interesting nucleus {sup 73}Rb was performed by searching its {beta}{sup +} and proton decay at the ISOLDE facility at CERN. Light rubidium isotopes were produced in a spallation reaction of a niobium target induced by a pulsed 1 GeV proton beam. The previously reported proton-unbound character of {sup 73}Rb was confirmed and the upper limit for its production cross-section was reduced by more than one order of magnitude. (orig.)

  20. Repetition in English Political Public Speaking

    Institute of Scientific and Technical Information of China (English)

    李红梅

    2010-01-01

    Repetition is frequently used in English political public speaking to make it easy to be remembered and powerful to move the feelings of the public. This paper is intended to analyze the functions of repetition and different levels of repetition to highlight the significance of repetition in English political public speaking and the ability of using it in practice.

  1. RB1CC1 activates RB1 pathway and inhibits proliferation and cologenic survival in human cancer.

    Directory of Open Access Journals (Sweden)

    Tokuhiro Chano

    Full Text Available RB1-inducible coiled-coil 1 (RB1CC1, also known as FIP200 plays a role in the enhancement of the RB1 pathway through the direct binding to a GC-rich region 201bp upstream (from the initiation ATG of the RB1 promoter. Here, we identified hSNF5 and p53 as the binding partners of RB1CC1 by immunoprecipitation and immunofluorescence assays. Interaction between these molecules and the RB1 pathway was analyzed by the assays of chromatin immunoprecipitation, luciferase-reporter, reverse transcription-polymerase chain reaction and immunoblot. The tumor growth suppression by RB1CC1 was evaluated by flow cytometry or by a cell growth assay. The nuclear RB1CC1 complex involving hSNF5 and/or p53 activated transcription of RB1, p16 and p21, and suppressed tumor cell growth. Furthermore, nuclear RB1CC1 expression significantly correlated with those of RB1 and p16 in breast cancer tissue in vivo, and the Ki-67 proliferation index was dependent on p53 as well as RB1CC1. The present study indicates that RB1CC1 together with hSNF5 and/or p53 enhances the RB1 pathway through transcriptional activation of RB1, p16 and p21. Evaluation of RB1CC1 expression combined with RB1 and p53 status is expected to provide useful information in clinical practice and future therapeutic strategies in breast cancer.

  2. Repetitive transcranial magnetic stimulation for levodopa-induced dyskinesias in Parkinson's disease.

    NARCIS (Netherlands)

    Filipovic, S.R.; Rothwell, J.C.; Warrenburg, B.P.C. van de; Bhatia, K.P.

    2009-01-01

    In a placebo-controlled, single-blinded, crossover study, we assessed the effect of "real" repetitive transcranial magnetic stimulation (rTMS) versus "sham" rTMS (placebo) on peak dose dyskinesias in patients with Parkinson's disease (PD). Ten patients with PD and prominent dyskinesias had rTMS (1,8

  3. Doing Business Economy Profile 2015 : Venezuela, RB

    OpenAIRE

    2014-01-01

    This economy profile for Doing Business 2015 presents the 11 Doing Business indicators for Venezuela RB. To allow for useful comparison, the profile also provides data for other selected economies (comparator economies) for each indicator. Doing Business 2015 is the 12th edition in a series of annual reports measuring the regulations that enhance business activity and those that constrain ...

  4. Progress of the ~(87)Rb Fountain Clock

    Institute of Scientific and Technical Information of China (English)

    ZHOU Zi-Chao; WEI Rong; SHI Chun-Yan; LV De-Sheng; LI Tang; WANG Yu-Zhu

    2009-01-01

    A fountain atomic clock based on cold ~(87)Rb atoms has been in operation in our laboratory for several months.We therefore report the design of the rubidium fountain clock including its physical package,optical system and daily operation.Ramsey fringes have been attained with the signal to noise ratio of about 100.

  5. RB1: a prototype tumor suppressor and an enigma.

    Science.gov (United States)

    Dyson, Nicholas J

    2016-07-01

    The retinoblastoma susceptibility gene (RB1) was the first tumor suppressor gene to be molecularly defined. RB1 mutations occur in almost all familial and sporadic forms of retinoblastoma, and this gene is mutated at variable frequencies in a variety of other human cancers. Because of its early discovery, the recessive nature of RB1 mutations, and its frequency of inactivation, RB1 is often described as a prototype for the class of tumor suppressor genes. Its gene product (pRB) regulates transcription and is a negative regulator of cell proliferation. Although these general features are well established, a precise description of pRB's mechanism of action has remained elusive. Indeed, in many regards, pRB remains an enigma. This review summarizes some recent developments in pRB research and focuses on progress toward answers for the three fundamental questions that sit at the heart of the pRB literature: What does pRB do? How does the inactivation of RB change the cell? How can our knowledge of RB function be exploited to provide better treatment for cancer patients?

  6. The experiment on the saturation polarization of Rb vapour

    Institute of Scientific and Technical Information of China (English)

    Huang Xiang-You; You Pei-Lin; Du Wei-Min

    2004-01-01

    @@ A cylindrical capacitor containing rubidium vapour is made. The capacitance of it at. different voltages is measured under a certain Rb vapour pressure. The experimental C-V curve shows that the saturation polarization of Rb vapour is easily observed. The experiment further supports the idea that the Rb atom has a large permanent electric dipole moment.

  7. Varianish: Jamming with Pattern Repetition

    Directory of Open Access Journals (Sweden)

    Jort Band

    2014-10-01

    Full Text Available In music, patterns and pattern repetition are often regarded as a machine-like task, indeed often delegated to drum Machines and sequencers. Nevertheless, human players add subtle differences and variations to repeated patterns that are musically interesting and often unique. Especially when looking at minimal music, pattern repetitions create hypnotic effects and the human mind blends out the actual pattern to focus on variation and tiny differences over time. Varianish is a musical instrument that aims at turning this phenomenon into a new musical experience for musician and audience: Musical pattern repetitions are found in live music and Varianish generates additional (musical output accordingly that adds substantially to the overall musical expression. Apart from the theory behind the pattern finding and matching and the conceptual design, a demonstrator implementation of Varianish is presented and evaluated.

  8. REPETITIVE CLUSTER-TILTED ALGEBRAS

    Institute of Scientific and Technical Information of China (English)

    Zhang Shunhua; Zhang Yuehui

    2012-01-01

    Let H be a finite-dimensional hereditary algebra over an algebraically closed field k and CFm be the repetitive cluster category of H with m ≥ 1.We investigate the properties of cluster tilting objects in CFm and the structure of repetitive clustertilted algebras.Moreover,we generalize Theorem 4.2 in [12](Buan A,Marsh R,Reiten I.Cluster-tilted algebra,Trans.Amer.Math.Soc.,359(1)(2007),323-332.) to the situation of CFm,and prove that the tilting graph KCFm of CFm is connected.

  9. Upper Bound to the Ionization Energy of 85Rb2

    CERN Document Server

    Bellos, M A; Banerjee, J; Ascoli, M; Allouche, A -R; Eyler, E E; Gould, P L; Stwalley, W C

    2013-01-01

    We report an upper bound to the ionization energy of 85Rb2 of 31348.0(6) cm-1, which also provides a lower bound to the dissociation energy D0 of 85Rb2+ of 6307.5(6) cm-1. These bounds were measured by the onset of autoionization of excited states of 85Rb2 below the 5s+7p atomic limit. We form 85Rb2 molecules via photoassociation of ultracold 85Rb atoms, and subsequently excite the molecules by single-photon ultraviolet transitions to states above the ionization threshold.

  10. Repetitive elements in parasitic protozoa

    Directory of Open Access Journals (Sweden)

    Clayton Christine

    2010-05-01

    Full Text Available Abstract A recent paper published in BMC Genomics suggests that retrotransposition may be active in the human gut parasite Entamoeba histolytica. This adds to our knowledge of the various types of repetitive elements in parasitic protists and the potential influence of such elements on pathogenicity. See research article http://www.biomedcentral.com/1471-2164/11/321

  11. 76 FR 24798 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-Trent 875-17, RB211-Trent 877-17, RB211...

    Science.gov (United States)

    2011-05-03

    ...-30-AD; Amendment 39-16657; AD 2011-08-07] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2011-08-07 Rolls-Royce plc: Amendment... applies to Rolls-Royce plc (RR) RB211-Trent 875-17, RB211-Trent 877-17, RB211-Trent 884-17,...

  12. The multiple connections between pRB and cell metabolism.

    Science.gov (United States)

    Nicolay, Brandon N; Dyson, Nicholas J

    2013-12-01

    The pRB tumor suppressor is traditionally seen as an important regulator of the cell cycle. pRB represses the transcriptional activation of a diverse set of genes by the E2F transcription factors and prevents inappropriate S-phase entry. Advances in our understanding of pRB have documented roles that extend beyond the cell cycle and this review summarizes recent studies that link pRB to the control of cell metabolism. pRB has been shown to regulate glucose tolerance, mitogenesis, glutathione synthesis, and the expression of genes involved in central carbon metabolism. Several studies have demonstrated that pRB directly targets a set of genes that are crucial for nucleotide metabolism, and this seems likely to represent one of the ways by which pRB influences the G1/S-phase transition and S-phase progression.

  13. Repetition rate stabilization of an erbium-doped all-fiber laser via opto-mechanical control of the intracavity group velocity

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Xuling; He, Boqu; Zhao, Jian; Liu, Yang; Bai, Dongbi; Wang, Chao; Liu, Geping; Luo, Daping; Liu, Fengjiang; Li, Wenxue; Zeng, Heping, E-mail: hpzeng@phy.ecnu.edu.cn [State Key Laboratory of Precision Spectroscopy, East China Normal University, Shanghai 200062 (China); Yang, Kangwen; Hao, Qiang [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, Shanghai 200093 (China)

    2015-01-19

    We present a method for stabilizing the repetition rate of an erbium-doped all-fiber laser by inserting an electronic polarization controller (EPC) in the fiber laser cavity. The device exhibited good integration, low cost, and convenient operation. Such a repetition rate stabilization may facilitate an all-fiber laser comb system with high integration. The repetition rate was phase-locked to a Rb reference more than 72 h with a low feedback voltage applied to one channel of the EPC. The repetition rate was 74.6 MHz. The standard deviation and the repetition rate linewidth were 1.4 and 1.7 mHz, respectively.

  14. Three Magnetic Rotation Bands in 84^Rb

    CERN Document Server

    Shen, Shuifa; Han, Guangbing; Wen, Shuxian; Yan, Yupeng; Wu, Xiaoguang; Zhu, Lihua; He, Chuangye; Li, Guangsheng

    2016-01-01

    High-spin states in $^{84}$Rb are studied by using the $^{70}$Zn($^{18}$O, p3n)$^{84}$Rb reaction at beam energy of 75 MeV. Three high-lying negative-parity bands are established, whose level spacings are very regular, i.e., there don't exist signature splitting. The dipole character of the transitions of these three bands is assigned by the $\\gamma$-$\\gamma$ directional correlations of oriented states (DCO) intensity ratios and the multipolarity M1 is suggested by the analogy to multiparticle excitations in neighboring nuclei. The strong M1 and weak or no E2 transitions are observed. All these characteristic features show they are magnetic rotation bands.

  15. Repetition suppression and repetition priming are processing outcomes.

    Science.gov (United States)

    Wig, Gagan S

    2012-01-01

    Abstract There is considerable evidence that repetition suppression (RS) is a cortical signature of previous exposure to the environment. In many instances RS in specific brain regions is accompanied by improvements in specific behavioral measures; both observations are outcomes of repeated processing. In understanding the mechanism by which brain changes give rise to behavioral changes, it is important to consider what aspect of the environment a given brain area or set of areas processes, and how this might be expressed behaviorally.

  16. The origin of the RB1 imprint.

    Directory of Open Access Journals (Sweden)

    Deniz Kanber

    Full Text Available The human RB1 gene is imprinted due to a differentially methylated CpG island in intron 2. This CpG island is part of PPP1R26P1, a truncated retrocopy of PPP1R26, and serves as a promoter for an alternative RB1 transcript. We show here by in silico analyses that the parental PPP1R26 gene is present in the analysed members of Haplorrhini, which comprise Catarrhini (Old World Monkeys, Small apes, Great Apes and Human, Platyrrhini (New World Monkeys and tarsier, and Strepsirrhini (galago. Interestingly, we detected the retrocopy, PPP1R26P1, in all Anthropoidea (Catarrhini and Platyrrhini that we studied but not in tarsier or galago. Additional retrocopies are present in human and chimpanzee on chromosome 22, but their distinct composition indicates that they are the result of independent retrotransposition events. Chimpanzee and marmoset have further retrocopies on chromosome 8 and chromosome 4, respectively. To examine the origin of the RB1 imprint, we compared the methylation patterns of the parental PPP1R26 gene and its retrocopies in different primates (human, chimpanzee, orangutan, rhesus macaque, marmoset and galago. Methylation analysis by deep bisulfite sequencing showed that PPP1R26 is methylated whereas the retrocopy in RB1 intron 2 is differentially methylated in all primates studied. All other retrocopies are fully methylated, except for the additional retrocopy on marmoset chromosome 4, which is also differentially methylated. Using an informative SNP for the methylation analysis in marmoset, we could show that the differential methylation pattern of the retrocopy on chromosome 4 is allele-specific. We conclude that the epigenetic fate of a PPP1R26 retrocopy after integration depends on the DNA sequence and selective forces at the integration site.

  17. Short pulse diode-pumped Tm:YAG slab laser electro-optically Q-switched by RbTiOPO4 crystal

    Science.gov (United States)

    Jin, Lin; Liu, Pian; Huang, Haitao; Liu, Xuan; Shen, Deyuan

    2016-10-01

    In this paper, a laser diode end pumped RbTiOPO4 (RTP) electro-optically Q-switched Tm:YAG slab laser was demonstrated. Stable Q-switched pulse with the shortest pulse width of 58 ns and an average output power of 7.5 W were realized at the repetition rate of 1 KHz, corresponding to the slope efficiency of 21.7%.

  18. Cohesive Function of Lexical Repetition in Text

    Institute of Scientific and Technical Information of China (English)

    张莉; 卢沛沛

    2013-01-01

    Lexical repetition is the most direct form of lexical cohesion,which is the central device for making texts hang together. Although repetition is the most direct way to emphasize,it performs the cohesive effect more apparently.

  19. Experimental determination and prediction of activity coefficients of RbCl in aqueous (RbCl+RbNO{sub 3}) mixture at T=298.15 K

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Jun [Chemical Engineering Department, Henan University of Science and Technology, 48 Xiyuan Road, Luoyang, Henan 471003 (China)]. E-mail: zhjabc@mail.haust.edu.cn; Huang Xingyuan [Chemical Engineering Department, Henan University of Science and Technology, 48 Xiyuan Road, Luoyang, Henan 471003 (China); Xia Shuping [Institute of Salt Lakes, Chinese Academy of Sciences, Xi' an 710043 (China)

    2005-11-15

    Activity coefficients for rubidium chloride in the (RbCl+RbNO{sub 3}+H{sub 2}O) ternary system were determined from electromotive force (emf) measurements of the cell:Rb-ionselectiveelectrode(ISE) vertical bar RbCl(m{sub A}),RbNO{sub 3}(m{sub B}),H{sub 2}O vertical bar Ag vertical bar AgClat T=298.15 K and over total ionic strengths from (0.01 upto 3.50) mol.kg{sup -1}. The Rb{sup +} ion selective electrode (Rb-ISE) and Ag vertical bar AgCl electrode used in this work were made in our laboratory and had reasonably good Nernst responses, which demonstrate that the emf method can be applied to measure the above system with high precision. The experimental data were analyzed using the Harned rule and Pitzer model. The Harned coefficients and the Pitzer binary and ternary ionic interaction parameters for the system have been evaluated. The experimental results obey the Harned rule, and the Pitzer model can be used to describe this aqueous system satisfactorily. The activity coefficients of RbNO{sub 3}, the osmotic coefficients of the mixtures and the excess free energy of mixing were also calculated.

  20. Blind Quantum Signature with Blind Quantum Computation

    Science.gov (United States)

    Li, Wei; Shi, Ronghua; Guo, Ying

    2017-04-01

    Blind quantum computation allows a client without quantum abilities to interact with a quantum server to perform a unconditional secure computing protocol, while protecting client's privacy. Motivated by confidentiality of blind quantum computation, a blind quantum signature scheme is designed with laconic structure. Different from the traditional signature schemes, the signing and verifying operations are performed through measurement-based quantum computation. Inputs of blind quantum computation are securely controlled with multi-qubit entangled states. The unique signature of the transmitted message is generated by the signer without leaking information in imperfect channels. Whereas, the receiver can verify the validity of the signature using the quantum matching algorithm. The security is guaranteed by entanglement of quantum system for blind quantum computation. It provides a potential practical application for e-commerce in the cloud computing and first-generation quantum computation.

  1. Blind Quantum Signature with Blind Quantum Computation

    Science.gov (United States)

    Li, Wei; Shi, Ronghua; Guo, Ying

    2016-12-01

    Blind quantum computation allows a client without quantum abilities to interact with a quantum server to perform a unconditional secure computing protocol, while protecting client's privacy. Motivated by confidentiality of blind quantum computation, a blind quantum signature scheme is designed with laconic structure. Different from the traditional signature schemes, the signing and verifying operations are performed through measurement-based quantum computation. Inputs of blind quantum computation are securely controlled with multi-qubit entangled states. The unique signature of the transmitted message is generated by the signer without leaking information in imperfect channels. Whereas, the receiver can verify the validity of the signature using the quantum matching algorithm. The security is guaranteed by entanglement of quantum system for blind quantum computation. It provides a potential practical application for e-commerce in the cloud computing and first-generation quantum computation.

  2. Circular Dichroism of RbHe and RbN$_2$ Molecules

    CERN Document Server

    Lancor, B; Wyllie, R; Walker, T G

    2010-01-01

    We present measurements of the circular dichroism of optically pumped Rb vapor near the D1 resonance line. Collisions with the buffer gases $^3$He and N$_2$ reduce the transparency of the vapor, even when fully polarized. We use two methods to measure this effect, show that the He results can be understood from RbHe potential curves, and show how this effect conspires with the spectral profile of the optical pumping light to increase the laser power demands for optical pumping of very optically thick samples.

  3. Blind system identification

    OpenAIRE

    Abed-Meriam, Karim; Qui, Wanzhi; Hua, Yingbo

    1997-01-01

    Blind system identification (BSI) is a fundamental signal processing technology aimed at retrieving a system's unknown information from its output only. This technology has a wide range of possible applications such as mobile communications, speech reverberation cancellation, and blind image restoration. This paper reviews a number of recently developed concepts and techniques for BSI, which include the concept of blind system identifiability in a deterministic framework, the blind techniques...

  4. Time-resolved detection of relative-intensity squeezed nanosecond pulses in an {sup 87}Rb vapor

    Energy Technology Data Exchange (ETDEWEB)

    Agha, Imad H; Giarmatzi, Christina; Grangier, Philippe; Messin, Gaetan [Laboratoire Charles Fabry, Institut d' Optique, CNRS, Universite Paris-Sud, Campus Polytechnique, 91127 Palaiseau Cedex (France); Glorieux, Quentin; Coudreau, Thomas, E-mail: agha@enst.fr [Laboratoire Materiaux et Phenomenes Quantiques, UMR 7162, Universite Paris-Diderot CNRS, 10, rue A Domon et L Duquet, 75013 Paris (France)

    2011-04-15

    We present theoretical and experimental results on the generation and detection of pulsed, relative-intensity squeezed light in a hot {sup 87}Rb vapor. The intensity noise correlations between a pulsed probe beam and its conjugate, generated through nearly degenerate four-wave mixing in a double-lambda system, are studied numerically and measured experimentally via time-resolved balanced detection. We predict and observe approximately - 1 dB of time-resolved relative-intensity squeezing with 50 ns pulses at 1 MHz repetition rate. (- 1.34 dB corrected for loss).

  5. Dynamic Changes in Ginsenoside Rb 2 and Rb3 Content in Solid-state Fermentation%人参须固态发酵中皂苷 Rb 2与 Rb 3的动态变化

    Institute of Scientific and Technical Information of China (English)

    闫梅霞; 崔丽丽; 许世泉; 刘俊霞; 王英平

    2014-01-01

    以人参须为发酵基质进行赤芝双向固态发酵,测定发酵过程中人参皂苷Rb2和Rb3的含量,分析固态发酵对其影响。发酵作用使基质中Rb2和Rb3含量发生显著变化,但2种皂苷含量变化不同。Rb2在发酵初期和发酵后期都出现含量先升高后降低的过程,Rb3仅在发酵初期含量先升高后降低,发酵结束时基质中未检测到2种皂苷。%Bidirectional solid-state fermentation was carried out through the strains of Ganoderma lucidum in ginseng .The content of ginseno-side Rb2 and Rb3 was determined and the impact on the ginsenoside by solid -state fermentation was analyzed .The content of Rb2 and Rb3 changed significantly through the fermentation ,but the two kinds of ginsenoside content varied differently .The content of Rb2 increased in the early fermentation stage ,then decreased in the late fermentation stage ,the level of Rb3 increased then decreased only in the early fermentation stage ,the two kinds of ginsenoside content was 0 by the end of the fermentation .

  6. Permanent Electric Dipole Moment of an Rb Atom

    Institute of Scientific and Technical Information of China (English)

    黄湘友; 游佩林

    2002-01-01

    We experimentally determine the conjecture that hydrogen-like atoms such as Rb and Cs may have large permanent electric dipole moments (EDMs). The saturated Rb vapour fills a cylindrical capacitor in the experiment.The influence of the vapour dielectric medium on capacitance is measured with a digital capacitance meter. Supposing that the measurement influence comes from the permanent EDMs of Rb atoms, from the experimental result we find that the EDM is large, i.e. dRb ≥ 8.6e × 10-9 cm.

  7. Quorum Sensing Activity in Pandoraea pnomenusa RB38

    Directory of Open Access Journals (Sweden)

    Robson Ee

    2014-06-01

    Full Text Available Strain RB38 was recovered from a former dumping area in Malaysia. MALDI-TOF mass spectrometry and genomic analysis identified strain RB-38 as Pandoraea pnomenusa. Various biosensors confirmed its quorum sensing properties. High resolution triple quadrupole liquid chromatography–mass spectrometry analysis was subsequently used to characterize the N-acyl homoserine lactone production profile of P. pnomenusa strain RB38, which validated that this isolate produced N-octanoyl homoserine lactone as a quorum sensing molecule. This is the first report of the production of N-octanoyl homoserine lactone by P. pnomenusa strain RB38.

  8. Selective Chemosensitization of Rb Mutant Cells

    Science.gov (United States)

    2001-07-01

    3 jopaA o E +•» to o ü 2 3 O) U. Vt3*> OOCd» Vl.3» (0 O CM ll I S j 41 • A I O O) Di (0 o CM • o 00 CO Q. o o Q. Ö...Rb) protein, and inac- tivation of both is essential for viral transformation (Lane and Crawford 1979; Linzer and Levine 1979; De- Caprio et al...wild-type MEFs expressing El A dis - played an ~10-fold increase in p53 and Mdm2 levels as compared to their ARF-deficient counterparts, the abso

  9. Molecular Mechanisms of pRB Function in Differentiation Contributing to pRB Mediated Tumor Suppression

    Science.gov (United States)

    2002-06-01

    mutations result in elimination protein-binding functions of the A/B pocket. 1. Using coimmunoprecipitation assays for detection of pRB interacting proteins My...chromatin/nuclear matrix. Another caviat is that pRB interacting proteins are presumably low-extractable nuclear proteins. Also, epitope tag might be... interacting proteins . Due to the failure to detect selective pRB complexes applying immunoprecipitation, I used a modified yeast two-hybrid assay as a backup

  10. Circuit considerations for repetitive railguns

    Energy Technology Data Exchange (ETDEWEB)

    Honih, E.M.

    1986-01-01

    Railgun electromagnetic launchers have significant military and scientific potential. They provide direct conversion of electrical energy to projectile kinetic energy, and they offer the hope of achieving projectile velocities greatly exceeding the limits of conventional guns. With over 10 km/sec already demonstrated, railguns are attracting attention for tactical and strategic weapons systems and for scientific equation-of-state research. The full utilization of railguns will require significant improvements in every aspect of system design - projectile, barrel, and power source - to achieve operation on a large scale. This paper will review fundamental aspects of railguns, with emphasis on circuit considerations and repetitive operation.

  11. Identification of the genomic mutation in Epha4(rb-2J/rb-2J) mice.

    Science.gov (United States)

    Mohd-Zin, Siti W; Abdullah, Nor-Linda; Abdullah, Aminah; Greene, Nicholas D E; Cheah, Pike-See; Ling, King-Hwa; Yusof, Hadri; Marwan, Ahmed I; Williams, Sarah M; York, Kerri T; Ahmad-Annuar, Azlina; Abdul-Aziz, Noraishah M

    2016-07-01

    The EphA4 receptor tyrosine kinase is involved in numerous cell-signalling activities during embryonic development. EphA4 has the ability to bind to both types of ephrin ligands, the ephrinAs and ephrinBs. The C57BL/6J-Epha4rb-2J/GrsrJ strain, denoted Epha4(rb-2J/rb-2J), is a spontaneous mouse mutant that arose at The Jackson Laboratory. These mutants exhibited a synchronous hind limb locomotion defect or "hopping gait" phenotype, which is also characteristic of EphA4 null mice. Genetic complementation experiments suggested that Epha4(rb-2J) corresponds to an allele of EphA4, but details of the genomic defect in this mouse mutant are currently unavailable. We found a single base-pair deletion in exon 9 resulting in a frame shift mutation that subsequently resulted in a premature stop codon. Analysis of the predicted structure of the truncated protein suggests that both the kinase and sterile α motif (SAM) domains are absent. Definitive determination of genotype is needed for experimental studies of mice carrying the Epha4(rb-2J) allele, and we have also developed a method to ease detection of the mutation through RFLP. Eph-ephrin family members are reportedly expressed as numerous isoforms. Hence, delineation of the specific mutation in EphA4 in this strain is important for further functional studies, such as protein-protein interactions, immunostaining and gene compensatory studies, investigating the mechanism underlying the effects of altered function of Eph family of receptor tyrosine kinases on phenotype.

  12. A 3 month, follow-up, randomized, placebo-controlles study of repetitive transcranial magnetic stimulation in depression.

    NARCIS (Netherlands)

    Koerselman, F; Laman, D.M; van Duijn, H; van Duijn, M.A.J.; Willems, M.AM

    2004-01-01

    Background/Objective: There is evidence for an antidepressant effect of repetitive transcranial magnetic stimulation (rTMS), but little is known about posttreatment course. Therefore, we conducted a placebo-controlled, double-blind study in depressed patients in order to investigate the effect of rT

  13. RB, the conductor that orchestrates life, death and differentiation.

    Science.gov (United States)

    Khidr, L; Chen, P-L

    2006-08-28

    The retinoblastoma susceptibility gene was the first tumor suppressor gene identified in humans and the first tumor suppressor gene knocked out by targeted deletion in mice. RB serves as a transducer between the cell cycle machinery and promoter-specific transcription factors, its most documented activity being the repression of the E2F family of transcription factors, which regulate the expression of genes involved in cell proliferation and survival. Recent investigations of RB function suggest that it works as a fundamental regulator to coordinate pathways of cellular growth and differentiation. In this review, we unravel the novel role of an equally important aspect of RB in downregulating the differentiation inhibitor EID-1 during cellular differentiation by teasing apart the signal, which elicit differentiation and limit cell cycle progression, since the molecular mechanisms relating to RB activation of differentiation is much less understood. We review the various roles for RB in differentiation of neurons, muscle, adipose tissue, and the retina. In addition, we provide an update for the current models of the role of RB in cell cycle to entry and exit, extending the view toward chromatin remodeling and expose the dichotomies in the regulation of RB family members. We conclude with a discussion of a novel RB regulatory network, incorporating the dynamic contribution of EID family proteins.

  14. Digital repetitive control under varying frequency conditions

    OpenAIRE

    Ramos Fuentes, Germán Andrés

    2012-01-01

    The tracking/rejection of periodic signals constitutes a wide field of research in the control theory and applications area and Repetitive Control has proven to be an efficient way to face this topic; however, in some applications the period of the signal to be tracked/rejected changes in time or is uncertain, which causes and important performance degradation in the standard repetitive controller. This thesis presents some contributions to the open topic of repetitive control workin...

  15. Precision study of the $\\beta$-decay of $^{74}$Rb

    CERN Multimedia

    Van Duppen, P L E; Lunney, D

    2002-01-01

    We are proposing a high-resolution study of the $\\beta$-decay of $^{74}$Rb in order to extrapolate our precision knowledge of the superallowed $\\beta$-decays from the sd and fp shells towards the medium-heavy Z=N nuclei. The primary goal is to provide new data for testing the CVC hypothesis and the unitarity condition of the CKM matrix of the Standard Model. The presented programme would involve the careful measurements of the decay properties of $^{74}$Rb including the branching ratios to the excited states as well as the precise determination of the decay energy of $^{74}$Rb. The experimental methods readily available at ISOLDE include high-transmission conversion electron spectroscopy, $\\gamma$-ray spectroscopy as well as the measurements of the masses of $^{74}$Rb and $^{74}$Kr using two complementary techniques, ISOLTRAP and MISTRAL. The experiment would rely on a high-quality $^{74}$Rb beam available at ISOLDE with adequate intensity.

  16. Analysis list: RB1 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available RB1 Prostate,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/R...B1.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/RB1.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/hg19/target/RB1.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/RB1.Prostate.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/RB1.Uterus.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/Prostate.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Uterus.gml ...

  17. Improved RB-HARQ scheme based on structured LDPC codes

    Institute of Scientific and Technical Information of China (English)

    WANG Wen-jun; LIN Yue-wei; YAN Yuan

    2007-01-01

    Reliability-based hybrid automatic repeat request (ARQ) (RB-HARQ) is a recently introduced approach to incremental-redundancy ARQ. In RB-HARQ scheme, the bits that are to be retransmitted are adaptively selected at the receiver based on the estimated bit reliability. It could result in significant performance gain but requires huge overhead in the feedback channel. In this study, an improved RB-HARQ scheme (IRB-HARQ) for structured low-density parity-check codes is proposed, which simplifies the comparison operations needed to search the bits to be retransmitted and outperforms the RB-HARQ scheme in consideration of the bit transmission power for the requesting messages on the feedback link. Simulation results show that the IRB-HARQ scheme is more efficient and practical than the RB-HARQ scheme.

  18. 75 FR 51654 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-22B and RB211-524 Series Turbofan Engines

    Science.gov (United States)

    2010-08-23

    ...-10] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR) RB211-22B and RB211-524 Series.... The FAA amends Sec. 39.13 by adding the following new AD: 2010-17-10 Rolls-Royce plc: Amendment 39... AD applies to Rolls-Royce plc RB211-22B series and RB211-524B4-D-02, RB211-524D4-19,...

  19. [Repetition and fear of dying].

    Science.gov (United States)

    Lerner, B D

    1995-03-01

    In this paper a revision is made of the qualifications of Repetition (R) in Freuds work, i.e. its being at the service of the Pleasure Principle and, beyond it, the binding of free energy due to trauma. Freud intends to explain with this last concept the "fort-da" and the traumatic dreams (obsessively reiterated self-reproaches may be added to them). The main thesis of this work is that R. is not only a defense against the recollection of the ominous past (as in the metaphorical deaths of abandonment and desertion) but also a way of maintaining life and identify fighting against the inescapable omninous future (known but yet experienced), i.e. our own death. Some forms of R. like habits, identificatory behaviors and sometimes even magic, are geared to serve the life instinct. A literary illustration shows this desperate fight.

  20. Pressure rig for repetitive casting

    Science.gov (United States)

    Vasquez, Peter (Inventor); Hutto, William R. (Inventor); Philips, Albert R. (Inventor)

    1989-01-01

    The invention is a pressure rig for repetitive casting of metal. The pressure rig performs like a piston for feeding molten metal into a mold. Pressure is applied to an expandable rubber diaphragm which expands like a balloon to force the metal into the mold. A ceramic cavity which holds molten metal is lined with blanket-type insulating material, necessitating only a relining for subsequent use and eliminating the lengthy cavity preparation inherent in previous rigs. In addition, the expandable rubber diaphragm is protected by the insulating material thereby decreasing its vulnerability to heat damage. As a result of the improved design the life expectancy of the pressure rig contemplated by the present invention is more than doubled. Moreover, the improved heat protection has allowed the casting of brass and other alloys with higher melting temperatures than possible in the conventional pressure rigs.

  1. RB1 Methylation by SMYD2 Enhances Cell Cycle Progression through an Increase of RB1 Phosphorylation

    Directory of Open Access Journals (Sweden)

    Hyun-Soo Cho

    2012-06-01

    Full Text Available It is well known that RB functions are regulated by posttranslational modifications such as phosphorylation and acetylation, but the significance of lysine methylation on RB has not been fully elucidated. Our expression analysis of SMYD2 by quantitative real-time polymerase chain reaction showed that expression levels of SMYD2 are significantly elevated in human bladder carcinomas compared with nonneoplastic bladder tissues (P < .0001, and its expression levels in tumor tissues were much higher than those of any other normal tissues. SMYD2 knockdown resulted in the suppression of cancer cell growth, and cell cycle analysis indicated that SMYD2 might play a crucial role in the G1/S transition. According to an in vitro methyltransferase assay, we found that SMYD2 methylates RB1 protein, and liquid chromatography-tandem mass spectrometry analysis revealed lysine 810 of RB1 to be methylated by SMYD2. Importantly, this methylation enhanced Ser 807/811 phosphorylation of RB1 both in vitro and in vivo. Furthermore, we demonstrated that methylated RB1 accelerates E2F transcriptional activity and promotes cell cycle progression. SMYD2 is an important oncoprotein in various types of cancer, and SMYD2-dependent RB1 methylation at lysine 810 promotes cell cycle progression of cancer cells. Further study may explore SMYD2-dependent RB1 methylation as a potential therapeutic target in human cancer.

  2. Observation of Quantum Beating in rb at 2.1 THz and 18.2 THz: Long-Range Rb^{*}-Rb Interactions.

    Science.gov (United States)

    Goldshlag, William; Ricconi, Brian J.; Eden, J. Gary

    2017-06-01

    The interaction of Rb 7s ^{2}S_{1/2}, 5d ^{2}D_{3/2,5/2} and 5p ^{2}P_{3/2} atoms with the background species at long range (100-1000Å) has been observed by pump-probe ultrafast laser spectroscopy. Parametric four-wave mixing in Rb vapor with pairs of 50-70 fs pulses produces coherent Rb 6P-5S emission at 420 nm that is modulated by Rb quantum beating. The two dominant beating frequencies are 18.2 THz and 2.07 THz, corresponding to quantum beating between 7S and 5D states and to the (5D-5P_{3/2})-(5P_{3/2}-5S) defect, respectively. Analysis of Rabi oscillations in these pump-probe experiments allows for the mean interaction energy at long range to be determined. The figure shows Fourier transform spectra of representative Rabi oscillation waveforms. The waveform and spectrum at left illustrate quantum beating in Rb at 2.1 THz. The spectrum at right is dominated by the 18.2 THz frequency component generated by 7S-5D beating in Rb. Insets show respective temporal behaviors of the 6P-5S line near the coherent transient (zero interpulse delay).

  3. A cold 87Rb atomic beam

    Institute of Scientific and Technical Information of China (English)

    Wang Xiao-Jia; Feng Yan-Ying; Xue Hong-Bo; Zhou Zhao-Ying; Zhang Wen-Dong

    2011-01-01

    We demonstrate an experimental setup for the production of a beam source of cold 87Rb atoms.The atoms are extracted from a trapped cold atomic cloud in an unbalanced three-dimensional magneto-optical trap.Via a radiation pressure difference generated by a specially designed leak tunnel along one trapping laser beam,the atoms are pushed out continuously with low velocities and a high flux.The most-probable velocity in the beam is varied from 9 m/s to 19 m/s by varying the detuning of the trapping laser beams in the magneto-optical trap and the flux can be tuned up to 4× 109 s-1 by increasing the intensity of the trapping beams.We also present a simple model for describing the dependence of the beam performance on the magneto-optical trap trapping laser intensity and the detuning.

  4. Optical pumping in a microfabricated Rb vapor cell using a microfabricated Rb discharge light source

    Energy Technology Data Exchange (ETDEWEB)

    Venkatraman, V.; Kang, S.; Affolderbach, C.; Mileti, G., E-mail: gaetano.mileti@unine.ch [Laboratoire Temps-Fréquence, University of Neuchâtel, Neuchâtel 2000 (Switzerland); Shea, H. [Microsystems for Space Technologies Laboratory, Ecole Polytechnique Fédérale de Lausanne (EPFL), Neuchâtel 2002 (Switzerland)

    2014-02-03

    Miniature (Rb discharge lamp light source, as well as (2) a conventional glass-blown Rb discharge lamp. The microfabricated Rb lamp cell is a dielectric barrier discharge (DBD) light source, having the same inner cell volume of around 40 mm{sup 3} as that of the resonance cell, both filled with suitable buffer gases. A miniature (∼2 cm{sup 3} volume) test setup based on the M{sub z} magnetometer interrogation technique was used for observation of optical-radiofrequency double-resonance signals, proving the suitability of the microfabricated discharge lamp to introduce efficient optical pumping. The pumping ability of this light source was found to be comparable to or even better than that of a conventional glass-blown lamp. The reported results indicate that the micro-fabricated DBD discharge lamp has a high potential for the development of a new class of miniature atomic clocks, magnetometers, and quantum sensors.

  5. Comparing repetition-based melody segmentation models

    NARCIS (Netherlands)

    Rodríguez López, M.E.; de Haas, Bas; Volk, Anja

    2014-01-01

    This paper reports on a comparative study of computational melody segmentation models based on repetition detection. For the comparison we implemented five repetition-based segmentation models, and subsequently evaluated their capacity to automatically find melodic phrase boundaries in a corpus of 2

  6. Task Repetition and Second Language Speech Processing

    Science.gov (United States)

    Lambert, Craig; Kormos, Judit; Minn, Danny

    2017-01-01

    This study examines the relationship between the repetition of oral monologue tasks and immediate gains in L2 fluency. It considers the effect of aural-oral task repetition on speech rate, frequency of clause-final and midclause filled pauses, and overt self-repairs across different task types and proficiency levels and relates these findings to…

  7. Repetitions: A Cross-Cultural Study.

    Science.gov (United States)

    Murata, Kumiko

    1995-01-01

    This study investigated how repetition is used in conversation among native speakers of British English, native speakers of Japanese, and Japanese speakers of English. Five interactional functions of repetition (interruption-orientated, solidarity, silence-avoidance, hesitation, and reformulation) were identified, as well as the cultural factors…

  8. Proteomic analysis of pRb loss highlights a signature of decreased mitochondrial oxidative phosphorylation.

    Science.gov (United States)

    Nicolay, Brandon N; Danielian, Paul S; Kottakis, Filippos; Lapek, John D; Sanidas, Ioannis; Miles, Wayne O; Dehnad, Mantre; Tschöp, Katrin; Gierut, Jessica J; Manning, Amity L; Morris, Robert; Haigis, Kevin; Bardeesy, Nabeel; Lees, Jacqueline A; Haas, Wilhelm; Dyson, Nicholas J

    2015-09-01

    The retinoblastoma tumor suppressor (pRb) protein associates with chromatin and regulates gene expression. Numerous studies have identified Rb-dependent RNA signatures, but the proteomic effects of Rb loss are largely unexplored. We acutely ablated Rb in adult mice and conducted a quantitative analysis of RNA and proteomic changes in the colon and lungs, where Rb(KO) was sufficient or insufficient to induce ectopic proliferation, respectively. As expected, Rb(KO) caused similar increases in classic pRb/E2F-regulated transcripts in both tissues, but, unexpectedly, their protein products increased only in the colon, consistent with its increased proliferative index. Thus, these protein changes induced by Rb loss are coupled with proliferation but uncoupled from transcription. The proteomic changes in common between Rb(KO) tissues showed a striking decrease in proteins with mitochondrial functions. Accordingly, RB1 inactivation in human cells decreased both mitochondrial mass and oxidative phosphorylation (OXPHOS) function. RB(KO) cells showed decreased mitochondrial respiratory capacity and the accumulation of hypopolarized mitochondria. Additionally, RB/Rb loss altered mitochondrial pyruvate oxidation from (13)C-glucose through the TCA cycle in mouse tissues and cultured cells. Consequently, RB(KO) cells have an enhanced sensitivity to mitochondrial stress conditions. In summary, proteomic analyses provide a new perspective on Rb/RB1 mutation, highlighting the importance of pRb for mitochondrial function and suggesting vulnerabilities for treatment.

  9. Blindness and vision loss

    Science.gov (United States)

    ... means you cannot see anything and DO NOT see light. (Most people who use the term "blindness" mean ... the vision loss. For long-term vision loss, see a low-vision specialist, who can help you learn to care for yourself and ... of vision; No light perception (NLP); Low vision; Vision loss and blindness ...

  10. "Color-Blind" Racism.

    Science.gov (United States)

    Carr, Leslie G.

    Examining race relations in the United States from a historical perspective, this book explains how the constitution is racist and how color blindness is actually a racist ideology. It is argued that Justice Harlan, in his dissenting opinion in Plessy v. Ferguson, meant that the constitution and the law must remain blind to the existence of race…

  11. Blind Pre-School.

    Science.gov (United States)

    Taylor, Billie, Comp.

    Articles pertinent to aiding the pre-school blind child are collected in this publication. Topics include discussion of attitudes and emotional reactions important for parents and teachers of blind children, and optimal development in regard to early motor behavior and emotional and social needs. Common areas of parental concern such as discipline…

  12. Blindness%失明

    Institute of Scientific and Technical Information of China (English)

    李同良

    2009-01-01

    @@ There was a blind girl who hated herself because she was blind. She hated everyone,except her loving boyfriend who was always there for her. She told her boyfriend, "If I could only see the World, I will marry you."

  13. Blindness and Yoga

    Science.gov (United States)

    Heyes, Anthony David

    1974-01-01

    Evidence is presented to support the claims that, among many blind persons, physical inactivity leads to poor physical fitness; that a state of anxiety is often a concomitant of unguided blind mobility; and that Yogic practices offer a solution to both difficulties. (GW)

  14. "Color-Blind" Racism.

    Science.gov (United States)

    Carr, Leslie G.

    Examining race relations in the United States from a historical perspective, this book explains how the constitution is racist and how color blindness is actually a racist ideology. It is argued that Justice Harlan, in his dissenting opinion in Plessy v. Ferguson, meant that the constitution and the law must remain blind to the existence of race…

  15. Ginsenoside Rb1 directly scavenges hydroxyl radical and hypochlorous acid.

    Science.gov (United States)

    Lü, Jian-Ming; Weakley, Sarah M; Yang, Zhen; Hu, Ming; Yao, Qizhi; Chen, Changyi

    2012-01-01

    Reactive oxygen species (ROS) have been implicated in a variety of inflammatory diseases including cardiovascular disease (CVD), cancer, diabetes, Alzheimer's disease, autism, cataracts and aging. When endogenous mechanisms for the maintenance of redox homeostasis are overwhelmed, dietary intake of antioxidants contributes substantially to balancing the body's oxidant/antioxidant status. Ginsenosides are thought to be primarily responsible for the pharmacological effect of P. ginseng root extracts on oxidative stress and inflammation. However, little is known about the underlying antioxidant mechanisms of individual ginsenoside; specifically, the reactivity of ginsenoside Rb1 with ROS has not been well studied. We found that Rb1 can significantly and selectively reduce hydroxyl radical (●OH) and hypochlorous acid (HOCl), two of the strongest ROS, with unique molecular mechanisms in a cell-free system. Rb1 directly scavenges the ●OH and protects plasmid DNA from damage induced by ●OH. ●OH likely attacks the double bond on the side chain of Rb1 as well as hydrogen atoms adjacent to the -OH groups, including those of sugar moieties. Rb1 also shows a high reactivity to HOCl and effectively inhibits HOCl-induced tyrosine chlorination in a cell free system. HOCl is added to the double bond of Rb1; the -Cl group and -OH group of HOCl possibly bond at C-24 and C-25 of Rb1 based on the regioselectivity of Markovnikov's Rule. To our knowledge, this is the first demonstration that ginsenoside Rb1 scavenges HOCl and protects tyrosine from HOCl-induced chlorination. Thus, this study reveals unique antioxidant mechanisms of individual ginsenoside Rb1, which may contribute to the pharmacological effect of P. ginseng and to the development of effective strategies for clinical applications of ginsenosides.

  16. Digital repetitive control under varying frequency conditions

    CERN Document Server

    Ramos, Germán A; Olm, Josep M

    2013-01-01

    The tracking/rejection of periodic signals constitutes a wide field of research in the control theory and applications area. Repetitive Control has proven to be an efficient way to face this topic. However, in some applications the frequency of the reference/disturbance signal is time-varying or uncertain. This causes an important performance degradation in the standard Repetitive Control scheme. This book presents some solutions to apply Repetitive Control in varying frequency conditions without loosing steady-state performance. It also includes a complete theoretical development and experimental results in two representative systems. The presented solutions are organized in two complementary branches: varying sampling period Repetitive Control and High Order Repetitive Control. The first approach allows dealing with large range frequency variations while the second allows dealing with small range frequency variations. The book also presents applications of the described techniques to a Roto-magnet plant and...

  17. Models for the blind

    DEFF Research Database (Denmark)

    Olsén, Jan-Eric

    2014-01-01

    When displayed in museum cabinets, tactile objects that were once used in the education of blind and visually impaired people, appear to us, sighted visitors, as anything but tactile. We cannot touch them due to museum policies and we can hardly imagine what it would have been like for a blind...... person to touch them in their historical context. And yet these objects are all about touch, from the concrete act of touching something to the norms that assigned touch a specific pedagogical role in nineteenth-century blind schools. The aim of this article is twofold. First, I provide a historical...... background to the tactile objects of the blind. When did they appear as a specific category of pedagogical aid and how did they help determine the relation between blindness, vision, and touch? Second, I address the tactile objects from the point of view of empirical sources and historical evidence. Material...

  18. Strategies for Using Repetition as a Powerful Teaching Tool

    Science.gov (United States)

    Saville, Kirt

    2011-01-01

    Brain research indicates that repetition is of vital importance in the learning process. Repetition is an especially useful tool in the area of music education. The success of repetition can be enhanced by accurate and timely feedback. From "simple repetition" to "repetition with the addition or subtraction of degrees of freedom," there are many…

  19. Strategies for Using Repetition as a Powerful Teaching Tool

    Science.gov (United States)

    Saville, Kirt

    2011-01-01

    Brain research indicates that repetition is of vital importance in the learning process. Repetition is an especially useful tool in the area of music education. The success of repetition can be enhanced by accurate and timely feedback. From "simple repetition" to "repetition with the addition or subtraction of degrees of freedom," there are many…

  20. Effects of inspiratory muscle training upon recovery time during high intensity, repetitive sprint activity.

    Science.gov (United States)

    Romer, L M; McConnell, A K; Jones, D A

    2002-07-01

    The present study examined the influence of specific inspiratory muscle training (IMT) upon recovery time during repetitive sprint activity, as well as the physiological and perceptual responses to fixed intensity shuttle running. Using a double-blind placebo-controlled design, 24 male repetitive sprint athletes were assigned randomly to either an IMT (n = 12) or placebo (n = 12) group. The self-selected recovery time during a repetitive sprint test and the physiological response to submaximal endurance exercise were determined. Following completion of baseline and pre-intervention measures, the IMT group performed 30 inspiratory efforts twice daily against a resistance equivalent to 50 % maximum inspiratory mouth pressure (MIP) for 6 wk. The placebo group performed 60 breaths once daily, for 6 wk, at a resistance equivalent to 15 % MIP, a load known to elicit negligible changes in respiratory muscle function. The IMT group improved total recovery time during the repetitive sprint test by 6.2 +/- 1.1 % (mean +/- SEM) above the changes noted for the placebo group (p = 0.006). Blood lactate and perceptual responses to submaximal exercise were also significantly attenuated following IMT (p attenuates the blood lactate and perceptual responses to submaximal endurance exercise. In addition, the present study provides new evidence that IMT improves recovery time during high intensity, intermittent exercise in repetitive sprint athletes.

  1. Silencing of RB1 and RB2/P130 during adipogenesis of bone marrow stromal cells results in dysregulated differentiation.

    Science.gov (United States)

    Capasso, Stefania; Alessio, Nicola; Di Bernardo, Giovanni; Cipollaro, Marilena; Melone, Mariarosa Ab; Peluso, Gianfranco; Giordano, Antonio; Galderisi, Umberto

    2014-01-01

    Bone marrow adipose tissue (BMAT) is different from fat found elsewhere in the body, and only recently have some of its functions been investigated. BMAT may regulate bone marrow stem cell niche and plays a role in energy storage and thermogenesis. BMAT may be involved also in obesity and osteoporosis onset. Given the paramount functions of BMAT, we decided to better clarify the human bone marrow adipogenesis by analyzing the role of the retinoblastoma gene family, which are key players in cell cycle regulation. Our data provide evidence that the inactivation of RB1 or RB2/P130 in uncommitted bone marrow stromal cells (BMSC) facilitates the first steps of adipogenesis. In cultures with silenced RB1 or RB2/P130, we observed an increase of clones with adipogenic potential and a higher percentage of cells accumulating lipid droplets. Nevertheless, the absence of RB1 or RB2/P130 impaired the terminal adipocyte differentiation and gave rise to dysregulated adipose cells, with alteration in lipid uptake and release. For the first time, we evidenced that RB2/P130 plays a role in bone marrow adipogenesis. Our data suggest that while the inactivation of retinoblastoma proteins may delay the onset of last cell division and allow more BMSC to be committed to adipocyte, it did not allow a permanent cell cycle exit, which is a prerequisite for adipocyte terminal maturation.

  2. Repetition priming from moving faces.

    Science.gov (United States)

    Lander, Karen; Bruce, Vicki

    2004-06-01

    Recent experiments have suggested that seeing a familiar face move provides additional dynamic information to the viewer, useful in the recognition of identity. In four experiments, repetition priming was used to investigate whether dynamic information is intrinsic to the underlying face representations. The results suggest that a moving image primes more effectively than a static image, even when the same static image is shown in the prime and the test phases (Experiment 1). Furthermore, when moving images are presented in the test phase (Experiment 2), there is an advantage for moving prime images. The most priming advantage is found with naturally moving faces, rather than with those shown in slow motion (Experiment 3). Finally, showing the same moving sequence at prime and test produced more priming than that found when different moving sequences were shown (Experiment 4). The results suggest that dynamic information is intrinsic to the face representations and that there is an advantage to viewing the same moving sequence at prime and test.

  3. RB1 mutation spectrum in a comprehensive nationwide cohort of retinoblastoma patients

    NARCIS (Netherlands)

    Dommering, Charlotte J.; Mol, Berber M.; Moll, Annette C.; Burton, Margaret; Cloos, Jacqueline; Dorsman, Josephine C.; Meijers-Heijboer, Hanne; van der Hout, Annemarie H.

    2014-01-01

    Background Retinoblastoma (Rb) is a childhood cancer of the retina, commonly initiated by biallelic inactivation of the RB1 gene. Knowledge of the presence of a heritable RB1 mutation can help in risk management and reproductive decision making. We report here on RB1 mutation scanning in a unique na

  4. Precision markedly attenuates repetitive lift capacity.

    Science.gov (United States)

    Collier, Brooke R; Holland, Laura; McGhee, Deirdre; Sampson, John A; Bell, Alison; Stapley, Paul J; Groeller, Herbert

    2014-01-01

    This study investigated the effect of precision on time to task failure in a repetitive whole-body manual handling task. Twelve participants were required to repetitively lift a box weighing 65% of their single repetition maximum to shoulder height using either precise or unconstrained box placement. Muscle activity, forces exerted at the ground, 2D body kinematics, box acceleration and psychophysical measures of performance were recorded until task failure was reached. With precision, time to task failure for repetitive lifting was reduced by 72%, whereas the duration taken to complete a single lift and anterior deltoid muscle activation increased by 39% and 25%, respectively. Yet, no significant difference was observed in ratings of perceived exertion or heart rate at task failure. In conclusion, our results suggest that when accuracy is a characteristic of a repetitive manual handling task, physical work capacity will decline markedly. The capacity to lift repetitively to shoulder height was reduced by 72% when increased accuracy was required to place a box upon a shelf. Lifting strategy and muscle activity were also modified, confirming practitioners should take into consideration movement precision when evaluating the demands of repetitive manual handling tasks.

  5. Radioactivity Measurement of Short Life Nuclide 89Rb

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>The radioactivity of short life nuclide 89Rb produced by fast radiochemical separation was measured by the digital coincidence counting (DCC) system. In this experiment, there were a large quantity of impurities

  6. A Compact, Transportable, Microchip-Based System for High Repetition Rate Production of Bose-Einstein Condensates

    CERN Document Server

    Farkas, Daniel M; Salim, Evan A; Segal, Stephen R; Squires, Matthew B; Anderson, Dana Z

    2009-01-01

    We present a compact, transportable system that produces Bose-Einstein condensates (BECs) near the surface of an integrated atom microchip. The system occupies a volume of 0.4 m^3 and operates at a repetition rate as high as 0.3 Hz. Evaporative cooling in a chip trap with trap frequencies of several kHz leads to nearly pure condensates containing 1.9x10^4 87Rb atoms. Partial condensates are observed at a temperature of 1.58(8) \\mu K, close to the theoretical transition temperature of 1.1 \\mu K.

  7. The blind hens’ challenge

    DEFF Research Database (Denmark)

    Sandøe, Peter; Hocking, Paul M.; Forkman, Björn

    2014-01-01

    about breeding blind hens. But we also argue that alternative views, which (for example) claim that it is important to respect the telos or rights of an animal, do not offer a more convincing solution to questions raised by the possibility of disenhancing animals for their own benefit.......Animal ethicists have recently debated the ethical questions raised by disenhancing animals to improve their welfare. Here, we focus on the particular case of breeding blind hens for commercial egg-laying systems, in order to benefit their welfare. Many people find breeding blind hens intuitively...

  8. Static analysis for blinding

    DEFF Research Database (Denmark)

    Nielsen, Christoffer Rosenkilde; Nielson, Hanne Riis

    2006-01-01

    operation blinding. In this paper we study the theoretical foundations for one of the successful approaches to validating cryptographic protocols and we extend it to handle the blinding primitive. Our static analysis approach is based on Flow Logic; this gives us a clean separation between the specification...... of the analysis and its realisation in an automatic tool. We concentrate on the former in the present paper and provide the semantic foundation for our analysis of protocols using blinding - also in the presence of malicious attackers....

  9. Blind Collective Signature Protocol

    Directory of Open Access Journals (Sweden)

    Nikolay A. Moldovyan

    2011-06-01

    Full Text Available Using the digital signature (DS scheme specified by Belarusian DS standard there are designed the collective and blind collective DS protocols. Signature formation is performed simultaneously by all of the assigned signers, therefore the proposed protocols can be used also as protocols for simultaneous signing a contract. The proposed blind collective DS protocol represents a particular implementation of the blind multisignature schemes that is a novel type of the signature schemes. The proposed protocols are the first implementations of the multisignature schemes based on Belarusian signature standard.

  10. Scattering lengths in isotopologues of the RbYb system

    CERN Document Server

    Borkowski, Mateusz; Ciuryło, Roman; Julienne, Paul S; K{\\ke}dziera, Dariusz; Mentel, Łukasz; Tecmer, Paweł; Münchow, Frank; Bruni, Christian; Görlitz, Axel

    2013-01-01

    We model the binding energies of rovibrational levels of the RbYb molecule using experimental data from two-color photoassociation spectroscopy in mixtures of ultracold $^{87}$Rb with various Yb isotopes. The model uses a theoretical potential based on state-of-the-art \\emph{ab initio} potentials, further improved by least-squares fitting to the experimental data. We have fixed the number of bound states supported by the potential curve, so that the model is mass scaled, that is, it accurately describes the bound state energies for all measured isotopic combinations. Such a model enables an accurate prediction of the s-wave scattering lengths of all isotopic combinations of the RbYb system. The reduced mass range is broad enough to cover the full scattering lengths range from $-\\infty$ to $+\\infty$. For example, the $^{87}$Rb$^{174}$Yb system is characterized by a large positive scattering length of $+880(120)$~a.u., while $^{87}$Rb$^{173}$Yb has $a=-626(88)$~a.u.. On the other hand $^{87}$Rb$^{170}$Yb has a ...

  11. Immune Response of Calves Vaccinated with Brucella abortus S19 or RB51 and Revaccinated with RB51

    Science.gov (United States)

    Dorneles, Elaine M. S.; Lima, Graciela K.; Teixeira-Carvalho, Andréa; Araújo, Márcio S. S.; Martins-Filho, Olindo A.; Sriranganathan, Nammalwar; Al Qublan, Hamzeh; Heinemann, Marcos B.; Lage, Andrey P.

    2015-01-01

    Brucella abortus S19 and RB51 strains have been successfully used to control bovine brucellosis worldwide; however, currently, most of our understanding of the protective immune response induced by vaccination comes from studies in mice. The aim of this study was to characterize and compare the immune responses induced in cattle prime-immunized with B. abortus S19 or RB51 and revaccinated with RB51. Female calves, aged 4 to 8 months, were vaccinated with either vaccine S19 (0.6–1.2 x 1011 CFU) or RB51 (1.3 x 1010 CFU) on day 0, and revaccinated with RB51 (1.3 x 1010 CFU) on day 365 of the experiment. Characterization of the immune response was performed using serum and peripheral blood mononuclear cells. Blood samples were collected on days 0, 28, 210, 365, 393 and 575 post-immunization. Results showed that S19 and RB51 vaccination induced an immune response characterized by proliferation of CD4+ and CD8+ T-cells; IFN-ɣ and IL-17A production by CD4+ T-cells; cytotoxic CD8+ T-cells; IL-6 secretion; CD4+ and CD8+ memory cells; antibodies of IgG1 class; and expression of the phenotypes of activation in T-cells. However, the immune response stimulated by S19 compared to RB51 showed higher persistency of IFN-ɣ and CD4+ memory cells, induction of CD21+ memory cells and higher secretion of IL-6. After RB51 revaccination, the immune response was chiefly characterized by increase in IFN-ɣ expression, proliferation of antigen-specific CD4+ and CD8+ T-cells, cytotoxic CD8+ T-cells and decrease of IL-6 production in both groups. Nevertheless, a different polarization of the immune response, CD4+- or CD8+-dominant, was observed after the booster with RB51 for S19 and RB51 prime-vaccinated animals, respectively. Our results indicate that after prime vaccination both vaccine strains induce a strong and complex Th1 immune response, although after RB51 revaccination the differences between immune profiles induced by prime-vaccination become accentuated. PMID:26352261

  12. Immune Response of Calves Vaccinated with Brucella abortus S19 or RB51 and Revaccinated with RB51.

    Science.gov (United States)

    Dorneles, Elaine M S; Lima, Graciela K; Teixeira-Carvalho, Andréa; Araújo, Márcio S S; Martins-Filho, Olindo A; Sriranganathan, Nammalwar; Al Qublan, Hamzeh; Heinemann, Marcos B; Lage, Andrey P

    2015-01-01

    Brucella abortus S19 and RB51 strains have been successfully used to control bovine brucellosis worldwide; however, currently, most of our understanding of the protective immune response induced by vaccination comes from studies in mice. The aim of this study was to characterize and compare the immune responses induced in cattle prime-immunized with B. abortus S19 or RB51 and revaccinated with RB51. Female calves, aged 4 to 8 months, were vaccinated with either vaccine S19 (0.6-1.2 x 1011 CFU) or RB51 (1.3 x 1010 CFU) on day 0, and revaccinated with RB51 (1.3 x 1010 CFU) on day 365 of the experiment. Characterization of the immune response was performed using serum and peripheral blood mononuclear cells. Blood samples were collected on days 0, 28, 210, 365, 393 and 575 post-immunization. Results showed that S19 and RB51 vaccination induced an immune response characterized by proliferation of CD4+ and CD8+ T-cells; IFN-ɣ and IL-17A production by CD4+ T-cells; cytotoxic CD8+ T-cells; IL-6 secretion; CD4+ and CD8+ memory cells; antibodies of IgG1 class; and expression of the phenotypes of activation in T-cells. However, the immune response stimulated by S19 compared to RB51 showed higher persistency of IFN-ɣ and CD4+ memory cells, induction of CD21+ memory cells and higher secretion of IL-6. After RB51 revaccination, the immune response was chiefly characterized by increase in IFN-ɣ expression, proliferation of antigen-specific CD4+ and CD8+ T-cells, cytotoxic CD8+ T-cells and decrease of IL-6 production in both groups. Nevertheless, a different polarization of the immune response, CD4+- or CD8+-dominant, was observed after the booster with RB51 for S19 and RB51 prime-vaccinated animals, respectively. Our results indicate that after prime vaccination both vaccine strains induce a strong and complex Th1 immune response, although after RB51 revaccination the differences between immune profiles induced by prime-vaccination become accentuated.

  13. Blind loop syndrome

    Science.gov (United States)

    ... part of the stomach) and operations for extreme obesity As a complication of inflammatory bowel disease Diseases such as diabetes or scleroderma may slow down movement in a segment of the intestine, leading to blind loop syndrome.

  14. Vision - night blindness

    Science.gov (United States)

    ... People with night blindness often have trouble seeing stars on a clear night or walking through a ... certain drugs Vitamin A deficiency (rare) Nontreatable causes: Birth defects Retinitis pigmentosa

  15. Visual Impairment, Including Blindness

    Science.gov (United States)

    ... Who Knows What? Survey Item Bank Search for: Visual Impairment, Including Blindness Links updated, April 2017 En ... doesn’t wear his glasses. Back to top Visual Impairments in Children Vision is one of our ...

  16. A Blind Date

    Institute of Scientific and Technical Information of China (English)

    周立

    2003-01-01

    英语对话:A: Talking about girls, I still remember my first time to meet my girlfriend. Iwas so clumsy and very nervous.B: That’s the same case with me. I had the jitters at my blind date, too.A: Did you also meet your girlfriend at a blind date?B: Yeah. I was actually very shy of speaking to girls, you know?

  17. Repetitive Bibliographical Information in Relational Databases.

    Science.gov (United States)

    Brooks, Terrence A.

    1988-01-01

    Proposes a solution to the problem of loading repetitive bibliographic information in a microcomputer-based relational database management system. The alternative design described is based on a representational redundancy design and normalization theory. (12 references) (Author/CLB)

  18. Computer-Related Repetitive Stress Injuries

    Science.gov (United States)

    ... on the shoulder Epicondylitis: elbow soreness often called "tennis elbow" Ganglion cyst: swelling or lump in the wrist ... Bones, Muscles, and Joints Carpal Tunnel Syndrome Medial Epicondylitis Repetitive Stress Injuries Contact Us Print Resources Send ...

  19. Models for the Blind

    Directory of Open Access Journals (Sweden)

    Jan Eric Olsén

    2014-10-01

    Full Text Available When displayed in museum cabinets, tactile objects that were once used in the education of blind and visually impaired people, appear to us, sighted visitors, as anything but tactile. We cannot touch them due to museum policies and we can hardly imagine what it would have been like for a blind person to touch them in their historical context. And yet these objects are all about touch, from the concrete act of touching something to the norms that assigned touch a specific pedagogical role in nineteenth-century blind schools. The aim of this article is twofold. First, I provide a historical background to the tactile objects of the blind. When did they appear as a specific category of pedagogical aid and how did they help determine the relation between blindness, vision, and touch? Second, I address the tactile objects from the point of view of empirical sources and historical evidence. Material objects are rarely used as historical testimonies for the simple reason that they, unlike archival material, do not present historians with written documents that can be held as evidence of the past. However, as I point out, certain historical questions of which archives remain silent could be approached by other means such as the use of material objects. Rather than delivering concrete methodological suggestions, this second part reflects upon the historical use of material objects - both their possibilities and their limits - within the context of blindness.

  20. Digital repetitive control under varying frequency conditions

    OpenAIRE

    Ramos Fuentes, Germán Andrés

    2012-01-01

    Premi extraordinari doctorat curs 2011-2012, àmbit d’Enginyeria Industrial The tracking/rejection of periodic signals constitutes a wide field of research in the control theory and applications area and Repetitive Control has proven to be an efficient way to face this topic; however, in some applications the period of the signal to be tracked/rejected changes in time or is uncertain, which causes and important performance degradation in the standard repetitive controller. This the...

  1. A New Rb Lamp Exciter Circuit for Rb atomic clocks and Studies on Transition from Ring to Red mode

    CERN Document Server

    Singh, Savita; Saxena, G M

    2010-01-01

    In this paper we describe the development of novel RF exciter circuit for electrode less Rb lamp. The lamp exciter circuit is a RF oscillator with a a new configuration operating at 60 to 65 MHz frequency with 3 to 4 watt power. The Rb lamp is used in exciting the ground state hyperfine transitions in Rb atom in a glass cell placed inside a tuned microwave cavity, As the frequency of these hyperfine transitions is very stable it is used in the development of Rb atomic clock by phase locking the oven controlled crystal oscillator (OCXO) to this atomic transition frequency. The details of the Rb lamp exciter are presented in the paper.The Lamp is ideally operated in ring mode as in this mode the linewidth is narrow and there is no self reversal. However, high temperature and RF excitation power may drive the Rb lamp to red mode which gives rise to line broadening and self reversal. It is the experience that mode change from ring to red deteriorates the atomic signal strength and S/N. In this paper the reasons o...

  2. Loss of heterozygosity for Rb locus and pRb immunostaining in laryngeal cancer: a clinicopathologic, molecular and immunohistochemical study.

    Directory of Open Access Journals (Sweden)

    Andrzej Borzecki

    2009-01-01

    Full Text Available Several risk factors for the development of laryngeal cancer have been identified, such as smoking and alcohol consumption, but the molecular mechanisms related to the carcinogenesis in the larynx remain under investigation. In this context, deregulations of the cell-cycle-controling mechanisms, Rb-pathway in particular, have been suggested to be involved in the pathogenesis of laryngeal carcinoma. Our purpose was to investigate 13q14 LOH and the expression of Rb protein and their possible prognostic value in laryngeal cancer. The group of 67 patients with laryngeal cancer, surgically treated with minimum 5 years observation, was multi-variously analysed. LOH for Rb was investigated by PCR-based techniques using two microsatellite markers, D13S263 and D13S126, flanking the Rb locus. Amplification products from each polymorphism were fractionated by denaturing gel electrophoresis and detected by audioradiography. Immunohistochemical staining of paraffin specimens of laryngeal cancers was supervised by the use of monoclonal mouse antibodies IgG1 (Anti-Human Retinoblastoma Gene Product of Dako in dilution of 1:50. Inactivation of Rb protein was assumed to represent the expression in < or =10% tumour cells. The results of each examined individual factor were compared with clinicopathologic features and the results were statistically transformed (Chi-square test with Yates' correction, Mann-Whitney test. The Kaplan and Meier model was used for overall and disease free survival curves. Only p value of less than 0,05 was considered significant. 13q14 LOH was detected in 7/67 (10,4% of informative tumours. No correlations were found between Rb genetic alteration (LOH and gender, age, TNM staging, histological differentiation, nodal and local recurrences (p>0.05. There was a strong association between the loss of Rb and supraglottic localisation of tumour in the larynx (p<0.01. By univariate analysis 13q14 LOH proved to be significantly related to the

  3. Overlapping and distinct pRb pathways in the mammalian auditory and vestibular organs.

    Science.gov (United States)

    Huang, Mingqian; Sage, Cyrille; Tang, Yong; Lee, Sang Goo; Petrillo, Marco; Hinds, Philip W; Chen, Zheng-Yi

    2011-01-15

    Retinoblastoma gene (Rb1) is required for proper cell cycle exit in the developing mouse inner ear and its deletion in the embryo leads to proliferation of sensory progenitor cells that differentiate into hair cells and supporting cells. In a conditional hair cell Rb1 knockout mouse, Pou4f3-Cre-pRb(-/-), pRb(-/-) utricular hair cells differentiate and survive into adulthood whereas differentiation and survival of pRb(-/-) cochlear hair cells are impaired. To comprehensively survey the pRb pathway in the mammalian inner ear, we performed microarray analysis of (pRb(-/-) cochlea and utricle. The comparative analysis shows that the core pathway shared between pRb(-/-) cochlea and utricle is centered on E2F, the key pathway that mediates pRb function. A majority of differentially expressed genes and enriched pathways are not shared but uniquely associated with pRb(-/-) cochlea or utricle. In pRb(-/-) cochlea, pathways involved in early inner ear development such as Wnt/β-catenin and Notch were enriched, whereas pathways involving in proliferation and survival are enriched in pRb(-/-) utricle. Clustering analysis showed that the pRb(-/-) inner ear has characteristics of a younger control inner ear, an indication of delayed differentiation. We created a transgenic mouse model (ER-Cre-pRb(flox/flox)) in which Rb1 can be acutely deleted postnatally. Acute Rb1 deletion in the adult mouse fails to induce proliferation or cell death in inner ear, strongly indicating that Rb1 loss in these postmitotic tissues can be effectively compensated for, or that pRb-mediated changes in the postmitotic compartment result in events that are functionally irreversible once enacted. This study thus supports the concept that pRb-regulated pathways relevant to hair cell development, encompassing proliferation, differentiation and survival, act predominantly during early development.

  4. Compensations to auditory feedback perturbations in congenitally blind and sighted speakers: Acoustic and articulatory data.

    Science.gov (United States)

    Trudeau-Fisette, Pamela; Tiede, Mark; Ménard, Lucie

    2017-01-01

    This study investigated the effects of visual deprivation on the relationship between speech perception and production by examining compensatory responses to real-time perturbations in auditory feedback. Specifically, acoustic and articulatory data were recorded while sighted and congenitally blind French speakers produced several repetitions of the vowel /ø/. At the acoustic level, blind speakers produced larger compensatory responses to altered vowels than their sighted peers. At the articulatory level, blind speakers also produced larger displacements of the upper lip, the tongue tip, and the tongue dorsum in compensatory responses. These findings suggest that blind speakers tolerate less discrepancy between actual and expected auditory feedback than sighted speakers. The study also suggests that sighted speakers have acquired more constrained somatosensory goals through the influence of visual cues perceived in face-to-face conversation, leading them to tolerate less discrepancy between expected and altered articulatory positions compared to blind speakers and thus resulting in smaller observed compensatory responses.

  5. SUSY effects in Rb: Revisited under current experimental constraints

    Science.gov (United States)

    Su, Wei; Yang, Jin Min

    2016-06-01

    In this note we revisit the SUSY effects in Rb under current experimental constraints including the LHC Higgs data, the B-physics measurements, the dark matter relic density and direct detection limits, as well as the precision electroweak data. We first perform a scan to figure out the currently allowed parameter space and then display the SUSY effects in Rb. We find that although the SUSY parameter space has been severely restrained by current experimental data, both the general MSSM and the natural-SUSY scenario can still alter Rb with a magnitude sizable enough to be observed at future Z-factories (ILC, CEPC, FCC-ee, Super Z-factory) which produce 109-1012Z-bosons. To be specific, assuming a precise measurement δRb = 2.0 ×10-5 at FCC-ee, we can probe a right-handed stop up to 530 GeV through chargino-stop loops, probe a sbottom to 850 GeV through neutralino-sbottom loops and a charged Higgs to 770 GeV through the Higgs-top quark loops for a large tan ⁡ β. The full one-loop SUSY correction to Rb can reach 1 ×10-4 in natural SUSY and 2 ×10-4 in the general MSSM.

  6. Spectroscopy of ultracold LiRb molecules using ionization detection

    Science.gov (United States)

    Altaf, Adeel

    We present spectroscopic studies of ultracold LiRb molecules using ionization detection. The molecules are created by cooling and trapping Li and Rb atoms in overlapping magneto-optical traps (MOTs) and using light resonant with a free-bound transition to create weakly bound excited state molecules in a process known as photoassociation (PA). We explore weakly bound vibrational levels of LiRb with PA spectroscopy using ionization detection and, where possible, compare our results with earlier measurements performed in our lab using trap-loss spectroscopy. In addition, we also probe vibrational levels of the ground triplet electronic state and excited electronic states using resonantly enhanced multiphoton ionization (REMPI) spectroscopy. We identify several vibrational levels of the alpha3Sigma+, (3)3piO and (4)3Sigma + states and compare our observations with theoretical calculations. As LiRb is one of the least studied heteronuclear diatomic molecules, these studies are aimed towards exploring the molecular structure. The spectroscopic work is also in line with the long-term project goals of transferring ultracold LiRb molecules into the lowest rotational and vibrational levels of the ground singlet electronic state. Molecules in this rovibronic ground state possess a large electric dipole moment, which is essential for application of ultracold molecules in various quantum computation schemes. The rovibronic ground state will also be an ideal starting point for investigating molecular entangled states.

  7. Ginsenoside Rb1 attenuates activated microglia-induced neuronal damage

    Institute of Scientific and Technical Information of China (English)

    Lining Ke; Wei Guo; Jianwen Xu; Guodong Zhang; Wei Wang; Wenhua Huang

    2014-01-01

    The microglia-mediated inlfammatory reaction promotes neuronal damage under cerebral isch-emia/hypoxia conditions. We therefore speculated that inhibition of hypoxia-induced microglial activation may alleviate neuronal damage. To test this hypothesis, we co-cultured ginsenoside Rb1, an active component of ginseng, and cortical neurons. Ginsenoside Rb1 protected neuronal morphology and structure in a single hypoxic culture system and in a hypoxic co-culture system with microglia, and reduced neuronal apoptosis and caspase-3 production. The protective effect was observable prior to placing in co-culture. Additionally, ginsenoside Rb1 inhibited levels of tumor necrosis factor-αin a co-culture system containing activated N9 microglial cells. Ginse-noside Rb1 also signiifcantly decreased nitric oxide and superoxide production induced by N9 microglia. Our ifndings indicate that ginsenoside Rb1 attenuates damage to cerebral cortex neu-rons by downregulation of nitric oxide, superoxide, and tumor necrosis factor-αexpression in hypoxia-activated microglia.

  8. Low-frequency excitations in Rb{sub 3}C{sub 60} and Rb{sub 6}C{sub 60}

    Energy Technology Data Exchange (ETDEWEB)

    Schober, H. [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France); Renker, B. [INFP, Forschungszentrum Karlsruhe, D-76021 Karlsruhe (Germany); Gompf, F. [INFP, Forschungszentrum Karlsruhe, D-76021 Karlsruhe (Germany)

    1996-04-01

    We present inelastic neutron scattering results for Rb{sub 3}C{sub 60} and Rb{sub 6}C{sub 60} covering the energy region from 0.5 to 14 meV. The different contributions to the spectra (translational, libronic, Rb-vibrations) are discussed on the basis of their Q and temperature dependence. In superconducting Rb{sub 3}C{sub 60} the scattering intensity observed in the range from 1.5 to 3.5 meV changes anomalously with temperature. No such behaviour is found in insulating Rb{sub 6}C{sub 60}. (orig.).

  9. Development of the new RB26DETT engine. Shingata RB26DETT engine no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Ura, S.; Nakamura, K.; Fujita, H.; Eto, T.; Yamanaka, J. (Nissan Motor Co. Ltd., Tokyo (Japan))

    1989-12-25

    This paper introduces the RB26DETT engine which was developed by Nissan Motor Co., Ltd., for use in the new high-performance Skyline GT-R sports coupe. This is 2.6 liter DOHC twin-turbo engine developed for the aim to built the world {prime} s best mass-produced in-line 6-cylinder engine by integrating the most advanced techniques. It features the adaptation of twin ceramic turbochargers which vastly reduce the interference between exhaust gas flows, and the equipment of large-capacity air-cooled intercooler system which greatly improves the cooling capacity. Other features include the applying of six throttle butterflies for improved intake air response during acceleration and a lighter weight valvetrain. As the result, high output, excellent throttle response and an impressive rotation speed were attained and world-top-class performance surpassing that of sports car engines was obtained. 14 figs., 3 tabs.

  10. The Prevalence and Phenomenology of Repetitive Behavior in Genetic Syndromes

    Science.gov (United States)

    Moss, Joanna; Oliver, Chris; Arron, Kate; Burbidge, Cheryl; Berg, Katy

    2009-01-01

    We investigated the prevalence and phenomenology of repetitive behavior in genetic syndromes to detail profiles of behavior. The Repetitive Behaviour Questionnaire (RBQ) provides fine-grained identification of repetitive behaviors. The RBQ was employed to examine repetitive behavior in Angelman (N = 104), Cornelia de Lange (N = 101), Cri-du-Chat…

  11. Likelihood methods and classical burster repetition

    CERN Document Server

    Graziani, C; Graziani, Carlo; Lamb, Donald Q

    1995-01-01

    We develop a likelihood methodology which can be used to search for evidence of burst repetition in the BATSE catalog, and to study the properties of the repetition signal. We use a simplified model of burst repetition in which a number N_{\\rm r} of sources which repeat a fixed number of times N_{\\rm rep} are superposed upon a number N_{\\rm nr} of non-repeating sources. The instrument exposure is explicitly taken into account. By computing the likelihood for the data, we construct a probability distribution in parameter space that may be used to infer the probability that a repetition signal is present, and to estimate the values of the repetition parameters. The likelihood function contains contributions from all the bursts, irrespective of the size of their positional errors --- the more uncertain a burst's position is, the less constraining is its contribution. Thus this approach makes maximal use of the data, and avoids the ambiguities of sample selection associated with data cuts on error circle size. We...

  12. Detection of Tumor Suppressor Gene and Oncogene in SO-Rb_(50) Human Retinoblastoma Cell Line

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    Retinoblastoma (Rb) is the most common malignant'cancer of eye. So-Rb_(50) is the first Rb cell line established in China in 1988. It has passed to the 387th passage now. We collected cells of the 327th passage of SO-Rb_(50), purified its genomic DNA and detected it with Rb and c-myc cDNA probes respectively (normal human white blood cells DNA was the control). We found the Rb gene was deleted while c-myc gene was amplified three times. This provides a basis for further study of the regulation of tumor ...

  13. Diffusion of Rb atoms in paraffin - coated resonant vapor cells

    CERN Document Server

    Atutov, S N; Plekhanov, A I; Sorokin, V A; Yakovlev, A V

    2016-01-01

    We present the results of a study of the diffusion of Rb atoms in paraffin - coated resonant vapor cells. We have modeled the Rb diffusion both in the cell and in the coating, assuming that the main loss of Rb atoms is due to the physical absorption of the atoms by the glass substrate. It is demonstrated that the equilibrium atomic density in the cell is a monotonic function of the thickness of the paraffin coating: the density increases with an increase in the thickness of the coating. The diffusion coefficient for rubidium in paraffin thin films has been determined to be equal to 4,7*10^-7 cm^2/s. The results of the experiment might be useful for a better understanding of the details involved in the processes of the interaction of alkali atoms with a paraffin coating.

  14. Models for the Blind

    OpenAIRE

    Jan Eric Olsén

    2014-01-01

    When displayed in museum cabinets, tactile objects that were once used in the education of blind and visually impaired people, appear to us, sighted visitors, as anything but tactile. We cannot touch them due to museum policies and we can hardly imagine what it would have been like for a blind person to touch them in their historical context. And yet these objects are all about touch, from the concrete act of touching something to the norms that assigned touch a specific pedagogical role in n...

  15. \\textit{Ab initio} study of reactive collisions between Rb($^{2}S$) or Rb($^{2}P$) and OH$^{-}$($^{1}\\Sigma^{+}$)

    CERN Document Server

    Kas, Milaim; Liévin, Jacques; Vaeck, Nathalie

    2016-01-01

    A theoretical rate constant for the associative detachment reaction Rb($^{2}S$)$+$OH$^{-}$($^{1}\\Sigma^{+}$)$\\rightarrow \\,$ RbOH($^{1}\\Sigma^{+}$)$+\\,e^{-}$ of 4$\\,\\times$10$^{-10}$cm$^{3}$s$^{-1}$ at 300 K has been calculated. This result agrees with the experimental rate constant of 2$^{+2}_{-1}\\,\\times10^{-10}$cm$^{3}$s$^{-1}$ obtained by Deiglmayr \\textit{et al.} (Phys. Rev. A 86, 2012) for a temperature between 200 K and 600 K. A Langevin-based dynamics which depends on the crossing point between the anion (RbOH$^{-}$) and neutral (RbOH) potential energy surfaces has been used. The calculation were performed using the ECP28MDF effective core potential to describe the rubidium atom at the CCSD(T) level of theory and extended basis sets. The effect of ECPs and basis set on the height of the crossing point, and hence the rate constant, has been investigated. The temperature dependence of the latter is also discussed. Preliminary work on the potential energy surface for the excited reaction channel Rb($^{2}...

  16. A Measurement of $R_b$ using Mutually Exclusive Tags

    CERN Document Server

    Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Casado, M P; Chmeissani, M; Comas, P; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Miquel, R; Mir, L M; Orteu, S; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Becker, U; Bazarko, A O; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rensing, P E; Rizzo, G; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Candlin, D J; Parsons, M I; Focardi, E; Parrini, G; Zachariadou, K; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Turnbull, R M; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Schmidt, M; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Moutoussi, A; Nash, J; Sedgbeer, J K; Stacey, A M; Williams, M D; Dissertori, G; Ghete, V M; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Sloan, Terence; Williams, M I; Galla, A; Giehl, I; Greene, A M; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Coyle, P; Diaconu, C A; Etienne, F; Konstantinidis, N P; Leroy, O; Motsch, F; Payre, P; Rousseau, D; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Ragusa, F; Berlich, R; Blum, Walter; Brown, D; Büscher, V; Dietl, H; Dydak, Friedrich; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Choi, Y; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Schune, M H; Simion, S; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Spagnolo, P; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Böhrer, A; Brandt, S; Cowan, G D; Grupen, Claus; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y S; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G

    1997-01-01

    A measurement of $R_b$ using five mutually exclusive hemisphere tags has been pe rformed by ALEPH using the full LEP1 statistics. Three tags are designed to sele ct the decay of the $Z^0$ to $b$ quarks, while the remaining two select $Z^0$ decays to $c$ and light quarks, and are used to measure the tagging efficiencies. The result, {$R_b~=~0.2159~\\pm~0.0009\\mbox{(stat)}~\\pm 0.0011\\mbox{(syst)}$}, is in agreement with the electroweak theory prediction of $0.2158 \\pm 0.0003$.

  17. Measurement of $R_{b}$ using a Vertex Mass Tag

    CERN Document Server

    Abe, K; Akagi, T; Allen, N J; Ash, W W; Aston, D; Baird, K G; Baltay, C; Band, H R; Barakat, M B; Baranko, G; Bardon, O; Barklow, T L; Bashindzhagian, G L; Bazarko, A O; Ben-David, R; Benvenuti, Alberto C; Bilei, G M; Bisello, D; Blaylock, G; Bogart, J R; Bolen, B; Bolton, T; Bower, G R; Brau, J E; Breidenbach, M; Bugg, W M; Burke, D; Burnett, T H; Burrows, P N; Busza, W; Calcaterra, A; Caldwell, D O; Calloway, D; Camanzi, B; Carpinelli, M; Cassell, R; Castaldi, R; Castro, A; Cavalli-Sforza, M; Chou, A; Church, E; Cohn, H O; Coller, J A; Cook, V; Cotton, R; Cowan, R F; Coyne, D G; Crawford, G; de Oliveira, A; Damerell, C J S; Daoudi, M; De Groot, N; De Sangro, R; Dell'Orso, R; Dervan, P J; Dima, M; Dong, D N; Du, P Y C; Dubois, R; Eisenstein, B I; Elia, R; Etzion, E; Fahey, S; Falciai, D; Fan, C; Fernández, J P; Fero, M J; Frey, R; Gillman, T; Gladding, G; González, S; Hart, E L; Harton, J L; Hasan, A; Hasegawa, Y; Hasuko, K; Hedges, S J; Hertzbach, S S; Hildreth, M D; Huber, J; Huffer, M E; Hughes, E W; Hwang, H; Iwasaki, Y; Jackson, D J; Jacques, P; Jaros, J A; Jiang, Z Y; Johnson, A S; Johnson, J R; Johnson, R A; Junk, T R; Kajikawa, R; Kalelkar, M; Kang, H J; Karliner, I; Kawahara, H; Kendall, H W; Kim, Y D; King, M E; King, R; Kofler, R R; Krishna, N M; Kroeger, R S; Labs, J F; Langston, M; Lath, A; Lauber, J A; Leith, D W G S; Lia, V; Liu, M X; Liu, X; Loreti, M; Lu, A; Lynch, H L; Ma, J; Mancinelli, G; Manly, S; Mantovani, G C; Markiewicz, T W; Maruyama, T; Masuda, H; Mazzucato, E; McKemey, A K; Meadows, B T; Messner, R; Mockett, P M; Moffeit, K C; Moore, T B; Müller, D; Nagamine, T; Narita, S; Nauenberg, U; Neal, H; Nussbaum, M; Ohnishi, Y; Oishi, N; Onoprienko, D; Osborne, L S; Panvini, R S; Park, C H; Park, H; Pavel, T J; Peruzzi, I; Piccolo, M; Piemontese, L; Pieroni, E; Pitts, K T; Plano, R J; Prepost, R; Prescott, C Y; Punkar, G D; Quigley, J; Ratcliff, B N; Reeves, T W; Reidy, J; Reinertsen, P L; Rensing, P E; Rochester, L S; Rowson, P C; Russell, J J; Saxton, O H; Schalk, T; Schindler, R H; Schumm, B A; Schwiening, J; Sen, S; Serbo, V V; Shaevitz, M H; Shank, J T; Shapiro, G; Sherden, D J; Shmakov, K D; Simopoulos, C; Sinev, N B; Smith, S R; Smy, M B; Snyder, J A; Stängle, H; Stamer, P; Steiner, H; Steiner, R; Strauss, M G; Su, D; Suekane, F; Sugiyama, A; Suzuki, S; Swartz, M; Szumilo, A; Takahashi, T; Taylor, F E; Torrence, E; Trandafir, A I; Turk, J D; Usher, T; Vavra, J; Vannini, C; Vella, E; Venuti, J P; Verdier, R; Verdini, P G; Wagner, D L; Wagner, S R; Waite, A P; Watts, S J; Weidemann, A W; Weiss, E R; Whitaker, J S; White, S L; Wickens, F J; Williams, D C; Williams, S H; Willocq, S; Wilson, R J; Wisniewski, W J; Woods, M; Word, G B; Wyss, J; Yamamoto, R K; Yamartino, J M; Yang, X; Yashima, J; Yellin, S J; Young, C C; Yuta, H; Zapalac, G; Zdarko, R W; Zhou, J

    1998-01-01

    We report a new measurement of Rb = Gamma(Z0->b-bbar) / Gamma(Z0->hadrons) using a double tag technique, where the b hemisphere selection is based on the reconstructed mass of the B hadron decay vertex. The measurement was performed using a sample of 130k hadronic Z0 events, collected with the SLD at the SLC. The method utilizes the 3-D vertexing abilities of the CCD pixel vertex detector and the small stable SLC beams to obtain a high b-tagging efficiency and purity. We obtain Rb=0.2142+/-0.0034(stat.)+/-0.0015(syst.)+/-0.0002(R_c).

  18. An artistic exploration of inattention blindness.

    Science.gov (United States)

    Levy, Ellen K

    2011-01-01

    An experiment about inattention blindness was conducted within the context of an art exhibition as opposed to a laboratory context in order to investigate the potential of art as a vehicle to study attention and its disorders. The project utilized a flash animation, Stealing Attention, that was modeled after the movie by Simons and Chabris (1999) but with significant experimental differences, involving context and staging, the emotional salience of the objects depicted, and the prior art viewing experience of participants. The study involved two components: observing if viewers watching an animation in a gallery could be distracted from noticing the disappearance of stolen museum antiquities (the targets) by the overlaid flashing images of a card game (the distractors) and then observing whether repetition of the depicted targets throughout the gallery installation could facilitate a re-direction of attention that allowed viewers to perceive the targets not initially noted in the animation. My findings were that, after viewing the entire installation and then re-viewing the animation, 64% of the viewers who did not initially remark on the targets in the animation were then able to see them. The discussion elaborates on these findings and then considers ways in which the implications of inattention blindness paradigms might be more fully rendered by uniting insights from the two disciplines of art and neuroscience than by either alone.

  19. Oplysnigens blinde vinkler

    DEFF Research Database (Denmark)

    Hendricks, Vincent Fella; Hansen, Pelle Guldborg

    manipulation og fordrejning, til at påvirke menneskers overvejelser, beslutninger og handlinger, både individuelt og kollektivt, hvilket i sidste ende kan få betydning for de demokratiske processer. Oplysningens blinde vinkler gennemgår en række informationsfænomener, som optræder i vores dagligdag, og den...

  20. Oplysningens blinde vinkler

    DEFF Research Database (Denmark)

    Hansen, Pelle Guldborg; Hendricks, Vincent Fella

    manipulation og fordrejning, til at påvirke menneskers overvejelser, beslutninger og handlinger, både individuelt og kollektivt, hvilket i sidste ende kan få betydning for de demokratiske processer. Oplysningens blinde vinkler gennemgår en række informationsfænomener, som optræder i vores dagligdag, og den...

  1. Testing Children for Color Blindness

    Science.gov (United States)

    ... Stories Español Eye Health / News Testing Children for Color Blindness Written By: Shirley Dang Apr. 03, 2014 New study shows that kids can be tested for color blindness as soon as age 4, finds Caucasian boys ...

  2. Postural control in blind subjects

    Directory of Open Access Journals (Sweden)

    Antonio Vinicius Soares

    2011-12-01

    Full Text Available Objective: To analyze postural control in acquired and congenitally blind adults. Methods: A total of 40 visually impaired adults participated in the research, divided into 2 groups, 20 with acquired blindness and 20 with congenital blindness - 21 males and 19 females, mean age 35.8 ± 10.8. The Brazilian version of Berg Balance Scale and the motor domain of functional independence measure were utilized. Results: On Berg Balance Scale the mean for acquired blindness was 54.0 ± 2.4 and 54.4 ± 2.5 for congenitally blind subjects; on functional independence measure the mean for acquired blind group was 87.1 ± 4.8 and 87.3 ± 2.3 for congenitally blind group. Conclusion: Based upon the scale used the results suggest the ability to control posture can be developed by compensatory mechanisms and it is not affected by visual loss in congenitally and acquired blindness.

  3. Repetitive transcranial magnetic stimulation in cervical dystonia: effect of site and repetition in a randomized pilot trial.

    Directory of Open Access Journals (Sweden)

    Sarah Pirio Richardson

    Full Text Available Dystonia is characterized by abnormal posturing due to sustained muscle contraction, which leads to pain and significant disability. New therapeutic targets are needed in this disorder. The objective of this randomized, sham-controlled, blinded exploratory study is to identify a specific motor system target for non-invasive neuromodulation and to evaluate this target in terms of safety and tolerability in the cervical dystonia (CD population. Eight CD subjects were given 15-minute sessions of low-frequency (0.2 Hz repetitive transcranial magnetic stimulation (rTMS over the primary motor cortex (MC, dorsal premotor cortex (dPM, supplementary motor area (SMA, anterior cingulate cortex (ACC and a sham condition with each session separated by at least two days. The Toronto Western Spasmodic Torticollis Rating Scale (TWSTRS score was rated in a blinded fashion immediately pre- and post-intervention. Secondary outcomes included physiology and tolerability ratings. The mean change in TWSTRS severity score by site was 0.25 ± 1.7 (ACC, -2.9 ± 3.4 (dPM, -3.0 ± 4.8 (MC, -0.5 ± 1.1 (SHAM, and -1.5 ± 3.2 (SMA with negative numbers indicating improvement in symptom control. TWSTRS scores decreased from Session 1 (15.1 ± 5.1 to Session 5 (11.0 ± 7.6. The treatment was tolerable and safe. Physiology data were acquired on 6 of 8 subjects and showed no change over time. These results suggest rTMS can modulate CD symptoms. Both dPM and MC are areas to be targeted in further rTMS studies. The improvement in TWSTRS scores over time with multiple rTMS sessions deserves further evaluation.

  4. Corneal blindness and xenotransplantation.

    Science.gov (United States)

    Lamm, Vladimir; Hara, Hidetaka; Mammen, Alex; Dhaliwal, Deepinder; Cooper, David K C

    2014-01-01

    Approximately 39 million people are blind worldwide, with an estimated 285 million visually impaired. The developing world shoulders 90% of the world's blindness, with 80% of causative diseases being preventable or treatable. Blindness has a major detrimental impact on the patient, community, and healthcare spending. Corneal diseases are significant causes of blindness, affecting at least 4 million people worldwide. The prevalence of corneal disease varies between parts of the world. Trachoma, for instance, is the second leading cause of blindness in Africa, after cataracts, but is rarely found today in developed nations. When preventive strategies have failed, corneal transplantation is the most effective treatment for advanced corneal disease. The major surgical techniques for corneal transplantation include penetrating keratoplasty (PK), anterior lamellar keratoplasty, and endothelial keratoplasty (EK). Indications for corneal transplantation vary between countries, with Fuchs' dystrophy being the leading indication in the USA and keratoconus in Australia. With the exception of the USA, where EK will soon overtake PK as the most common surgical procedure, PK is the overwhelming procedure of choice. Success using corneal grafts in developing nations, such as Nepal, demonstrates the feasibility of corneal transplantation on a global scale. The number of suitable corneas from deceased human donors that becomes available will never be sufficient, and so research into various alternatives, for example stem cells, amniotic membrane transplantation, synthetic and biosynthetic corneas, and xenotransplantation, is progressing. While each of these has potential, we suggest that xenotransplantation holds the greatest potential for a corneal replacement. With the increasing availability of genetically engineered pigs, pig corneas may alleviate the global shortage of corneas in the near future.

  5. Certificate Revocation System's Based on RB_Tree%基于RB_Tree的证书吊销系统

    Institute of Scientific and Technical Information of China (English)

    周海岩

    2009-01-01

    提出了公钥基础设施(Public Key Infrastructure,PKI)中证书吊销问题的一种解决方案--RB_搜索树解决方案(Certificate Revocation RB_Tree,CRRBT).该方案在查询与更新时最大时间复杂度始终保持在O(log2n)量级,对工程实现具有一定的指导意义.

  6. The willed blindness of humans

    DEFF Research Database (Denmark)

    Gjerris, Mickey

    2012-01-01

    This paper describes how we seem to live in a willed blindness towards the effects that our meat production and consumption have on animals, the environment and the climate. It is a willed blindness that cannot be explained by either lack of knowledge or scientific uncertainty. The blindness...

  7. The neurobiology of repetitive behavior : of mice…

    NARCIS (Netherlands)

    Langen, Marieke; Kas, Martien J H; Staal, Wouter G; van Engeland, Herman; Durston, Sarah

    2011-01-01

    Repetitive and stereotyped behavior is a prominent element of both animal and human behavior. Similar behavior is seen across species, in diverse neuropsychiatric disorders and in key phases of typical development. This raises the question whether these similar classes of behavior are caused by simi

  8. Large-scale detection of repetitions.

    Science.gov (United States)

    Smyth, W F

    2014-05-28

    Combinatorics on words began more than a century ago with a demonstration that an infinitely long string with no repetitions could be constructed on an alphabet of only three letters. Computing all the repetitions (such as ∙∙∙TTT ∙∙∙ or ∙∙∙ CGACGA ∙∙∙ ) in a given string x of length n is one of the oldest and most important problems of computational stringology, requiring time in the worst case. About a dozen years ago, it was discovered that repetitions can be computed as a by-product of the Θ(n)-time computation of all the maximal periodicities or runs in x. However, even though the computation is linear, it is also brute force: global data structures, such as the suffix array, the longest common prefix array and the Lempel-Ziv factorization, need to be computed in a preprocessing phase. Furthermore, all of this effort is required despite the fact that the expected number of runs in a string is generally a small fraction of the string length. In this paper, I explore the possibility that repetitions (perhaps also other regularities in strings) can be computed in a manner commensurate with the size of the output.

  9. Verbal Repetitions and Echolalia in Alzheimer's Discourse

    Science.gov (United States)

    Da Cruz, Fernanda Miranda

    2010-01-01

    This article reports on an investigation of echolalic repetition in Alzheimer's disease (AD). A qualitative analysis of data from spontaneous conversations with MHI, a woman with AD, is presented. The data come from the DALI Corpus, a corpus of spontaneous conversations involving subjects with AD. This study argues that echolalic effects can be…

  10. Neurobehavioural Correlates of Abnormal Repetitive Behaviour

    Directory of Open Access Journals (Sweden)

    R. A. Ford

    1991-01-01

    Full Text Available Conditions in which echolalia and echopraxia occur are reviewed, followed by an attempt to elicit possible mechanisms of these phenomena. A brief description of stereotypical and perseverative behaviour and obsessional phenomena is given. It is suggested that abnormal repetitive behaviour may occur partly as a result of central dopaminergic dysfunction.

  11. Reducing Repetitive Speech: Effects of Strategy Instruction.

    Science.gov (United States)

    Dipipi, Caroline M.; Jitendra, Asha K.; Miller, Judith A.

    2001-01-01

    This article describes an intervention with an 18-year-old young woman with mild mental retardation and a seizure disorder, which focused on her repetitive echolalic verbalizations. The intervention included time delay, differential reinforcement of other behaviors, and self-monitoring. Overall, the intervention was successful in facilitating…

  12. Verbal Repetitions and Echolalia in Alzheimer's Discourse

    Science.gov (United States)

    Da Cruz, Fernanda Miranda

    2010-01-01

    This article reports on an investigation of echolalic repetition in Alzheimer's disease (AD). A qualitative analysis of data from spontaneous conversations with MHI, a woman with AD, is presented. The data come from the DALI Corpus, a corpus of spontaneous conversations involving subjects with AD. This study argues that echolalic effects can be…

  13. Genetic and bibliographic information: IL10RB [GenLibi

    Lifescience Database Archive (English)

    Full Text Available IL10RB interleukin 10 receptor, beta human Periodontitis (MeSH) Stomatognathic Dise...ases (C07) > Mouth Diseases (C07.465) > Periodontal Diseases (C07.465.714) > Periodontitis (C07.465.714.533) 02A0614091 ...

  14. Mass measurements of neutron-rich Rb and Sr isotopes

    CERN Document Server

    Klawitter, R; Brodeur, M; Chowdhury, U; Chausdhuri, A; Fallis, J; Gallant, A T; Grossheim, A; Kwiatkowski, A A; Lascar, D; Leach, K G; Lennarz, A; Macdonald, T D; Pearkes, J; Seeraji, S; Simon, M C; Simon, V V; Schultz, B E; Dilling, J

    2015-01-01

    We report on the mass measurements of several neutron-rich $\\mathrm{Rb}$ and $\\mathrm{Sr}$ isotopes in the $A \\approx 100$ region with the TITAN Penning-trap mass spectrometer. Using highly charged ions in the charge state $q=10+$, the masses of $^{98,99}\\mathrm{Rb}$ and $^{98-100}\\mathrm{Sr}$ have been determined with a precision of $6 - 12\\ \\mathrm{keV}$, making their uncertainty negligible for r-process nucleosynthesis network calculations. The mass of $^{101}\\mathrm{Sr}$ has been determined directly for the first time with a precision eight times higher than the previous indirect measurement and a deviation of $3\\sigma$ when compared to the Atomic Mass Evaluation. We also confirm the mass of $^{100}\\mathrm{Rb}$ from a previous measurement. Furthermore, our data indicates the existance of a low-lying isomer with $80\\ \\mathrm{keV}$ excitation energy in $^{98}\\mathrm{Rb}$. We show that our updated mass values lead to minor changes in the r-process by calculating fractional abundances in the $A\\approx 100$ re...

  15. RB962962, a sugarcane cultivar for late harvest

    Directory of Open Access Journals (Sweden)

    Luiz José Oliveira Tavares de Melo

    2014-07-01

    Full Text Available In the Northeast of Brazil, sugarcane cultivar RB962962 is harvested at the end of the cycle, between December and February, with a high sugar yield per area. Recommended for sandy soils of medium texture and fertility, it is resistant to the major diseases and fast-growing in plant and ratoon crops.

  16. Dissecting Pin1 and phospho-pRb regulation.

    Science.gov (United States)

    Rizzolio, Flavio; Caligiuri, Isabella; Lucchetti, Chiara; Fratamico, Robert; Tomei, Valentina; Gallo, Gaia; Agelan, Alexis; Ferrari, Giovanni; Toffoli, Giuseppe; Klein-Szanto, Andres J; Giordano, Antonio

    2013-01-01

    The activity of the Retinoblastoma protein, the master regulator of the cell cycle, is finely regulated by phosphorylation. CDKs and cyclins are major players in phosphorylation and it has been recently discovered that the prolyl isomerase Pin1 is an essential protein that orchestrates this process. In this article, we report new findings regarding the role of Pin1 in the pRb pathway. Our data suggest that PI3K, CDKs, and the Pin1 axis have a critical role in sustaining the complete phosphorylation of pRb. Furthermore, we analyze the correlation between Pin1 and pRb phosphorylation in vivo. We show that, in human malignant glioma tissue microarrays (TMA) and in Pin1 knockout (KO) mice, there is a positive correlation between Pin1 and pRb phosphorylation. Prospectively, our findings suggest that the synergism between CDKs, Pin1, and PI3K inhibitors hold great promise for targeted pharmacological treatment of cancer patients, with the possibility of reaching high effectiveness at tolerated doses.

  17. A remotely interrogated all-optical Rb-87 magnetometer

    NARCIS (Netherlands)

    Patton, B.; Versolato, O. O.; Hovde, D. C.; Corsini, E.; Higbie, J. M.; Budker, D.

    2012-01-01

    Atomic magnetometry was performed at Earth's magnetic field over a free-space distance of ten meters. Two laser beams aimed at a distant alkali-vapor cell excited and detected the Rb-87 magnetic resonance, allowing the magnetic field within the cell to be interrogated remotely. Operated as a driven

  18. Collection of $^{83}$Rb at low implantation energy for KATRIN

    CERN Multimedia

    Zboril, M

    KATRIN, the KArlsruhe TRItium Neutrino experiment aims to measure the neutrino mass by spectroscopy of the tritium $\\beta$-decay at the endpoint by means of Magnetic Adiabatic Collimation combined with an Electrostatic filter (MAC-E filter). To monitor the HV-system of the KATRIN-setup, we would need one or two $^{83}$Rb sources roughly every half a year.

  19. Frequent disruption of the RB1 pathway in diffuse large B cell lymphoma

    DEFF Research Database (Denmark)

    Møller, M B; Kania, Per Walter; Ino, Y

    2000-01-01

    In the present study, we analysed 34 de novo diffuse large B cell lymphoma (DLCL) from a population-based lymphoma registry for alterations of the RB1 pathway at the genetic (RB1 and CDK4) and protein (pRb, cyclin D1, cyclin D3, CDK4, and E2F-1) level. The results were correlated with the data fr...

  20. Expression of CD45RB functionally distinguishes intestinal T lymphocytes in inflammatory bowel disease.

    NARCIS (Netherlands)

    Hove, T. ten; The Olle, F.; Berkhout, M.; Bruggeman, J.P.; Vyth-Dreese, F.A.; Slors, J.F.M.; Deventer, S.J.H. van; Velde, A.A. te

    2004-01-01

    The importance of CD45RB expression on T cells was already shown in mice where CD45RB(high) expression determines pathogenic potential. In this study, we analyzed the expression of CD45RA, CD45RB, and CD45RO on CD4(+) T lymphocytes in the intestinal mucosa and in the circulation of patients with inf

  1. Treating cancer when pRb and p53 cannot be reactivated.

    Science.gov (United States)

    Zhu, Liang

    2015-01-01

    Activation of oncoproteins and inactivation of tumor suppressors induces tumorigenesis. When these events happen upstream of pRb and p53, cancer therapies may initially succeed and then fail when pRb and p53 are activated and then re-inactivated. Therapies might succeed if they remain effective when pRb and p53 are genetically inactivated.

  2. Immune responses of bison and efficacy after booster vaccination with Brucella abortus strain RB51

    Science.gov (United States)

    Thirty-one bison heifers were randomly assigned to saline (control; n=7) or single vaccination (n=24) with 1010 CFU of B. abortus strain RB51 (RB51). Some vaccinated bison were randomly selected for booster vaccination with 10**10 CFU of RB51 at 11 months after initial vaccination (n=16). When comp...

  3. [The blindness in the literature-Jose Saramago: blindness and Albert Bang: the blind witness].

    Science.gov (United States)

    Permin, H; Norn, M

    2001-01-01

    Two novels with different aspects of blindness seen through the doctors eyes. The Portuguese Nobel-prize winner José Saramago's story of a city struck by an epidemic of "white blindness", where the truth is what we cannot bear to see. The Danish author and unskilled labourer Albert Bang's (synonym with Karl E. Rasmussen) crime novel describes a blind or pretend to be blind butcher, who is a witness to a murder. Both novels are lyric, thought-provoking and insightful.

  4. Review of accident analyses of RB experimental reactor

    Directory of Open Access Journals (Sweden)

    Pešić Milan P.

    2003-01-01

    Full Text Available The RB reactor is a uranium fuel heavy water moderated critical assembly that has been put and kept in operation by the VTNCA Institute of Nuclear Sciences, Belgrade, Serbia and Montenegro, since April 1958. The first complete Safety Analysis Report of the RB reactor was prepared in 1961/62 yet, the first accident analysis had been made in late 1958 with the aim to examine a power transition and the total equivalent doses received by the staff during the reactivity accident that occurred on October 15, 1958. Since 1960, the RB reactor has been modified a few times. Beside the initial natural uranium metal fuel rods, new types of fuel (TVR-S types of Russian origin consisting of 2% enriched uranium metal and 80% enriched UO2 dispersed in aluminum matrix, have been available since 1962 and 1976 respectively. Modifications of the control and safety systems of the reactor were made occasionally. Special reactor cores were designed and constructed using all three types of fuel elements as well as the coupled fast-thermal ones. The Nuclear Safety Committee of the VINĆA Institute, an independent regulatory body, approved for usage all these modifications of the RB reactor on the basis of the Preliminary Safety Analysis Reports, which, beside proposed technical modifications and new regulation rules, included safety analyses of various possible accidents. A special attention was given (and a new safety methodology was proposed to thorough analyses of the design-based accidents related to the coupled fast-thermal cores that included central zones of the reactor filled by the fuel elements without any moderator. In this paper, an overview of some accidents, methodologies and computation tools used for the accident analyses of the RB reactor is given.

  5. Unconditionally verifiable blind computation

    CERN Document Server

    Fitzsimons, Joseph F

    2012-01-01

    Blind Quantum Computing (BQC) allows a client to have a server carry out a quantum computation for them such that the client's input, output and computation remain private. Recently the authors together with Broadbent proposed a universal unconditionally secure BQC scheme where the client only needs to be able to prepare single qubits in separable states randomly chosen from a finite set and send them to the server, who has the balance of the required quantum computational resources. A desirable property for any BQC protocol is verification, whereby the client can verify with high probability whether the server has followed the instructions of the protocol, or if there has been some deviation resulting in a corrupted output state. A verifiable BQC protocol can be viewed as an interactive proof system leading to consequences for complexity theory. In this paper we extend the BQC protocol presented in [Broadbent, Fitzsimons and Kashefi, FOCS 2009 p517] with new functionality allowing blind computational basis m...

  6. Blind Quantum Computation

    CERN Document Server

    Arrighi, P; Arrighi, Pablo; Salvail, Louis

    2003-01-01

    We investigate the possibility of having someone carry out the work of executing a function for you, but without letting him learn anything about your input. Say Alice wants Bob to compute some well-known function f upon her input x, but wants to prevent Bob from learning anything about x. The situation arises for instance if client Alice has limited computational resources in comparison with mistrusted server Bob, or if x is an inherently mobile piece of data. Could there be a protocol whereby Bob is forced to compute f(x) "blindly", i.e. without observing x? We provide such a blind computation protocol for the class of functions which admit an efficient procedure to generate random input-output pairs, e.g. factorization. The setting is quantum, the security is unconditional, the eavesdropper is as malicious as can be. Keywords: Secure Circuit Evaluation, Secure Two-party Computation, Information Hiding, Information gain vs disturbance.

  7. First-principles calculations of two cubic fluoropervskite compounds: RbFeF3 and RbNiF3

    Science.gov (United States)

    Mubarak, A. A.; Al-Omari, Saleh

    2015-05-01

    We present first-principles calculations of the structural, elastic, electronic, magnetic and optical properties for RbFeF3 and RbNiF3. The full-potential linear augmented plan wave (FP-LAPW) method within the density functional theory was utilized to perform the present calculations. We employed the generalized gradient approximation as exchange-correlation potential. It was found that the calculated analytical lattice parameters agree with previous studies. The analysis of elastic constants showed that the present compounds are elastically stable and anisotropic. Moreover, both compounds are classified as a ductile compound. The calculations of the band structure and density functional theory revealed that the RbFeF3 compound has a half-metallic behavior while the RbNiF3 compound has a semiconductor behavior with indirect (M-Γ) band gap. The ferromagnetic behavior was studied for both compounds. The optical properties were calculated for the radiation of up to 40 eV. A beneficial optics technology is predicted as revealed from the optical spectra.

  8. Postpartum cortical blindness.

    Science.gov (United States)

    Faiz, Shakeel Ahmed

    2008-09-01

    A 30-years-old third gravida with previous normal pregnancies and an unremarkable prenatal course had an emergency lower segment caesarean section at a periphery hospital for failure of labour to progress. She developed bilateral cortical blindness immediately after recovery from anesthesia due to cerebral angiopathy shown by CT and MR scan as cortical infarct cerebral angiopathy, which is a rare complication of a normal pregnancy.

  9. Color Blind Affirmative Action

    OpenAIRE

    2003-01-01

    This paper presents a conceptual framework for understanding the consequences of the widespread adoption of race-neutral alternatives' to conventional racial affirmative action policies in college admissions. A simple model of applicant competition with endogenous effort is utilized to show that, in comparison to color-conscious affirmative action, these color-blind alternatives can significantly lower the efficiency of the student selection process in equilibrium. We examine data on matricul...

  10. Stochastic Blind Motion Deblurring

    KAUST Repository

    Xiao, Lei

    2015-05-13

    Blind motion deblurring from a single image is a highly under-constrained problem with many degenerate solutions. A good approximation of the intrinsic image can therefore only be obtained with the help of prior information in the form of (often non-convex) regularization terms for both the intrinsic image and the kernel. While the best choice of image priors is still a topic of ongoing investigation, this research is made more complicated by the fact that historically each new prior requires the development of a custom optimization method. In this paper, we develop a stochastic optimization method for blind deconvolution. Since this stochastic solver does not require the explicit computation of the gradient of the objective function and uses only efficient local evaluation of the objective, new priors can be implemented and tested very quickly. We demonstrate that this framework, in combination with different image priors produces results with PSNR values that match or exceed the results obtained by much more complex state-of-the-art blind motion deblurring algorithms.

  11. 75 FR 33738 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800...

    Science.gov (United States)

    2010-06-15

    ... plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800 Series Turbofan Engines AGENCY: Federal... holidays. Fax: (202) 493-2251. Contact Rolls-Royce plc, P.O. Box 31, Derby, DE24 8BJ, United Kingdom; phone... Information Rolls-Royce plc has issued Alert Service Bulletin RB.211-72-AF964, Revision 1, dated June 6,...

  12. Deletion of Rb1 induces both hyperproliferation and cell death in murine germinal center B cells.

    Science.gov (United States)

    He, Zhiwen; O'Neal, Julie; Wilson, William C; Mahajan, Nitin; Luo, Jun; Wang, Yinan; Su, Mack Y; Lu, Lan; Skeath, James B; Bhattacharya, Deepta; Tomasson, Michael H

    2016-03-01

    The retinoblastoma gene (RB1) has been implicated as a tumor suppressor in multiple myeloma (MM), yet its role remains unclear because in the majority of cases with 13q14 deletions, un-mutated RB1 remains expressed from the retained allele. To explore the role of Rb1 in MM, we examined the functional consequences of single- and double-copy Rb1 loss in germinal center B cells, the cells of origin of MM. We generated mice without Rb1 function in germinal center B cells by crossing Rb1(Flox/Flox) with C-γ-1-Cre (Cγ1) mice expressing the Cre recombinase in class-switched B cells in a p107(-/-) background to prevent p107 from compensating for Rb1 loss (Cγ1-Rb1(F/F)-p107(-/-)). All mice developed normally, but B cells with two copies of Rb1 deleted (Cγ1-Rb1(F/F)-p107(-/-)) exhibited increased proliferation and cell death compared with Cγ1-Rb1(+/+)-p107(-/-) controls ex vivo. In vivo, Cγ1-Rb1(F/F)-p107(-/-) mice had a lower percentage of splenic B220+ cells and reduced numbers of bone marrow antigen-specific secreting cells compared with control mice. Our data indicate that Rb1 loss induces both cell proliferation and death in germinal center B cells. Because no B-cell malignancies developed after 1 year of observation, our data also suggest that Rb1 loss is not sufficient to transform post-germinal center B cells and that additional, specific mutations are likely required to cooperate with Rb1 loss to induce malignant transformation.

  13. Observation of Serum Bactericidal Activity of Brucella abortus RB51 OMPs Combined with Brucella abortus RB51 Live Vaccine

    Directory of Open Access Journals (Sweden)

    Fahime Gholizadeh

    2013-06-01

    Full Text Available Background & objectives: vaccination is vital against brucellosis. Although current vaccines have low efficiency, some cell wall compartments such as Outer Membrane Proteins could be used as an immunogenic candidate in vaccine development. By this mean, our aim in this study was to evaluate the humoral immunity of the combination of Brucella abortus RB51 OMPs with the Brucella abortus RB51 live attenuated vaccine, by Serum Bactericidal Acitivity test. Materials and Methods: In this project, first Brucella abortus RB51 was cultivated in brucella agar. The OMPs were extracted by Sodium N-Lauryl Sarcosinate method, then added to the RB51 live attenuated vaccine. Immunization was done by injection of the vaccine to mice and rabbits. The blood was drawn on days 0, 15,30, and 45 from the rabbits and the sera were seperated. Brucella abortus 544 was also injected as challenge. Spleen colony count was also performed. Results: The data from Serum Bactericidal Assay has showed, there was a very high Humoral immunity and response as a bactericidal titre of the serum against Rb51 Live vaccine. There was a significant decrease of colonies in the group vaccinated with the combined vaccine in the Spleen colony count test. Statistical analysis of groups variances showed a significant difference between groups (P<0.05.Conclusions: The Serum Bactericidal Assay results showed despite previous studies, both the combine and live vaccine are capable to stimulate the Humoral immunity. greater activity of combined vaccine to boost the humoral activity might be due to the synergistic effect of this vaccine.

  14. Electric field cancellation on quartz: a Rb adsorbate induced negative electron affinity surface

    CERN Document Server

    Sedlacek, J A; Rittenhouse, S T; Weck, P F; Sadeghpour, H R; Shaffer, J P

    2015-01-01

    We investigate the (0001) surface of single crystal quartz with a submonolayer of Rb adsorbates. Using Rydberg atom electromagnetically induced transparency, we investigate the electric fields resulting from Rb adsorbed on the quartz surface, and measure the activation energy of the Rb adsorbates. We show that the adsorbed Rb induces a negative electron affinity (NEA) on the quartz surface. The NEA surface allows low energy electrons to bind to the surface and cancel the electric field from the Rb adsorbates. Our results are important for integrating Rydberg atoms into hybrid quantum systems and the fundamental study of atom-surface interactions, as well as applications for electrons bound to a 2D surface.

  15. Rubidium isotope effect in superconducting Rb[sub 3]C[sub 60

    Energy Technology Data Exchange (ETDEWEB)

    Burk, B.; Crespi, V.H.; Zettl, A.; Cohen, M.L. (Department of Physics, University of California at Berkeley, Berkeley, California 94720 (United States) Materials Sciences Division, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States))

    1994-06-06

    We have measured the resistive supercondeucting transition temperature in C[sub 60] single crystals intercalated with isotopically pure [sup 87]Rb and [sup 85]Rb and with natural abundance rubidium. We obtain a rubidium isotope effect exponent of [alpha][sub Rb]=[minus]0.028[plus minus]0.036, a result which implies that the Rb-C[sub 60] optic phonons play at most a minor role in the pairing mechanism of Rb[sub 3]C[sub 60].

  16. Safety and Efficacy of Rice Bran Supercritical CO2 Extract for Hair Growth in Androgenic Alopecia: A 16-Week Double-Blind Randomized Controlled Trial.

    Science.gov (United States)

    Choi, Jae-Suk; Park, Jae Beom; Moon, Woi-Sook; Moon, Jin-Nam; Son, Sang Wook; Kim, Mi-Ryung

    2015-01-01

    We conducted a 16-week double-blind randomized controlled single-center trial to evaluate the safety and efficacy of dermal rice bran supercritical CO2 extract (RB-SCE) in the treatment of androgenic alopecia. Fifty alopecia patients were randomly assigned to the experimental and placebo groups. The experimental group received a dermal application of 0.5% RB-SCE (8 mL/d) to the head skin for 16 weeks while the control group received a dermal application of placebo. Changes in hair count, diameter, and density were evaluated with a Folliscope(®). Patient satisfaction was evaluated via questionnaire and clinical photographs were rated by dermatologists. The results showed that RB-SCE significantly increased hair density and hair diameter in male subjects. Patient satisfaction and the evaluation of photographs by dermatologists also confirmed the effectiveness of RB-SCE in the treatment of alopecia. No adverse reactions related to RB-SCE were reported. Therefore, RB-SCE shows promise for use in functional cosmetics and pharmaceuticals.

  17. Robust Repetitive Controller for Fast AFM Imaging

    CERN Document Server

    Necipoglu, Serkan; Has, Yunus; Guvenc, Levent; Basdogan, Cagatay

    2012-01-01

    Currently, Atomic Force Microscopy (AFM) is the most preferred Scanning Probe Microscopy (SPM) method due to its numerous advantages. However, increasing the scanning speed and reducing the interaction forces between the probe's tip and the sample surface are still the two main challenges in AFM. To meet these challenges, we take advantage of the fact that the lateral movements performed during an AFM scan is a repetitive motion and propose a Repetitive Controller (RC) for the z-axis movements of the piezo-scanner. The RC utilizes the profile of the previous scan line while scanning the current line to achieve a better scan performance. The results of the scanning experiments performed with our AFM set-up show that the proposed RC significantly outperforms a conventional PI controller that is typically used for the same task. The scan error and the average tapping forces are reduced by 66% and 58%, respectively when the scan speed is increased by 7-fold.

  18. Using Background Music to Reduce Problem Behavior during Assessment with an Adolescent Who Is Blind with Multiple Disabilities

    Science.gov (United States)

    Desrochers, Marcie N.; Oshlag, Rebecca; Kennelly, Angela M.

    2014-01-01

    Children who are visually impaired (that is, those who are blind or have low vision) commonly engage in stereotypic behaviors such as rocking and repetitive hand movements to gain sensory stimulation produced by the behavior (Gourgey, 1998; Rapp, 2004; Warren, 1984). A means of quickly and easily reducing problem behaviors is important to maximize…

  19. Ternary K2Zn5As4-type pnictides Rb2Cd5As4 and Rb2Zn5Sb4, and the solid solution Rb2Cd5(As,Sb)4.

    Science.gov (United States)

    He, Hua; Stoyko, Stanislav S; Mar, Arthur; Bobev, Svilen

    2013-05-01

    Dirubidium pentacadmium tetraarsenide, Rb2Cd5As4, dirubidium pentazinc tetraantimonide, Rb2Zn5Sb4, and the solid-solution phase dirubidium pentacadmium tetra(arsenide/antimonide), Rb2Cd5(As,Sb)4 [or Rb2Cd5As3.00(1)Sb1.00(1)], have been prepared by direct reaction of the component elements at high temperature. These compounds are charge-balanced Zintl phases and adopt the orthorhombic K2Zn5As4-type structure (Pearson symbol oC44), featuring a three-dimensional [M5Pn4](2-) framework [M = Zn or Cd; Pn is a pnicogen or Group 15 (Group V) element] built of linked MPn4 tetrahedra, and large channels extending along the b axis which host Rb(+) cations. The As and Sb atoms in Rb2Cd5(As,Sb)4 are randomly disordered over the two available pnicogen sites. Band-structure calculations predict that Rb2Cd5As4 is a small-band-gap semiconductor and Rb2Zn5Sb4 is a semimetal.

  20. Spin exchange collision mixing of the K and Rb ac Stark shifts

    CERN Document Server

    Chen, Yao; Fang, Jiancheng

    2016-01-01

    In a hybrid pumping alkali vapor cell that both K and Rb are filled, K atom spins are optically pumped by laser and Rb atom spins are polarized by the K spins through spin exchange. We find that the AC Stark shift of the Rb atoms is composed of not only the AC Stark shift of the Rb atoms caused by the far off resonant pumping laser which is tuned to the K absorption lines, but also the AC Stark shift of the K atom spins. The mixing of the light shifts through fast spin exchange between K and Rb atoms are studied in this paper and we demonstrate a K-Rb-21Ne co-magnetometer in which the AC Stark shift of the Rb atoms are reduced by the collision mixing.

  1. Desorption Dynamics of Rb_2 Molecules off the Surface of Helium Nanodroplets

    CERN Document Server

    Sieg, A; Stienkemeier, F; Dulieu, O; Mudrich, M

    2016-01-01

    The desorption dynamics of rubidium dimers (Rb_2) off the surface of helium nanodroplets induced by laser excitation is studied employing both nanosecond and femtosecond ion imaging spectroscopy. Similarly to alkali metal atoms, we find that the Rb_2 desorption process resembles the dissociation of a diatomic molecule. However, both angular and energy distributions of detected Rb_2^+ ions appear to be most crucially determined by the Rb_2 intramolecular degrees of freedom rather than by those of the Rb_2He_N complex. The pump-probe dynamics of Rb_2^+ is found to be slower than that of Rb^+ pointing at a weaker effective guest-host repulsion for excited molecules than for single atoms.

  2. Frequency Stability of Atomic Clocks Based on Coherent Population Trapping Resonance in 85Rb

    Institute of Scientific and Technical Information of China (English)

    LIU Lu; GUO Tao; DENG Ke; LIU Xin-Yuan; CHEN Xu-Zong; WANG Zhong

    2007-01-01

    An atomic clock system based on coherent population trapping (CPT) resonance in 85Rb is reported, while most past works about the CPT clock are in 87Rb. A new modulation method (full-hyperfine-frequency-splitting modulation) is presented to reduce the effect of light shift to improve the frequency stability of the CPT clock in 85Rb. The experimental results show that the short-term frequency stability of the CPT clock in 85Rb is in the order of 10-10/s and the long-term frequency stability can achieve 1.5 × 10-11 /80000s, which performs as well as 87Rb in CPT resonance. This very good frequency stability performance associated with the low-cost and low-power properties of 85Rb indicates that an atomic clock based on CPT in 85 Rb should be a promising candidate for making the chip scale atomic clock.

  3. A repetitive elements perspective in Polycomb epigenetics.

    Directory of Open Access Journals (Sweden)

    Valentina eCasa

    2012-10-01

    Full Text Available Repetitive elements comprise over two-thirds of the human genome. For a long time, these elements have received little attention since they were considered non functional. On the contrary, recent evidence indicates that they play central roles in genome integrity, gene expression and disease. Indeed, repeats display meiotic instability associated with disease and are located within common fragile sites, which are hotspots of chromosome rearrangements in tumors. Moreover, a variety of diseases have been associated with aberrant transcription of repetitive elements. Overall this indicates that appropriate regulation of repetitive elements’ activity is fundamental.Polycomb group (PcG proteins are epigenetic regulators that are essential for the normal development of multicellular organisms. Mammalian PcG proteins are involved in fundamental processes, such as cellular memory, cell proliferation, genomic imprinting, X-inactivation, and cancer development. PcG proteins can convey their activity through long-distance interactions also on different chromosomes. This indicates that the 3D organization of PcG proteins contributes significantly to their function. However, it is still unclear how these complex mechanisms are orchestrated and which role PcG proteins play in the multi-level organization of gene regulation. Intriguingly, the greatest proportion of Polycomb-mediated chromatin modifications is located in genomic repeats and it has been suggested that they could provide a binding platform for Polycomb proteins.Here, these lines of evidence are woven together to discuss how repetitive elements could contribute to chromatin organization in the 3D nuclear space.

  4. Emotional arousal enhances word repetition priming

    OpenAIRE

    Thomas, Laura A.; LaBar, Kevin S.

    2005-01-01

    Three experiments were conducted to determine if emotional content increases repetition priming magnitude. In the study phase of Experiment 1, participants rated high-arousing negative (taboo) words and neutral words for concreteness. In the test phase, they made lexical decision judgements for the studied words intermixed with novel words (half taboo, half neutral) and pseudowords. In Experiment 2, low-arousing negative (LAN) words were substituted for the taboo words, and in Experiment 3 al...

  5. The Rhythms of Echo. Variations on Repetition

    Directory of Open Access Journals (Sweden)

    Rosa María Aradra Sánchez

    2015-04-01

    Full Text Available This paper presents a study on the echo as metric and rhetorical procedure. It makes a brief tour through some of the poetic manifestations of echo in the Spanish literary tradition, and a brief tour through the attention that metric theory has paid to this phenomenon. Then it stops at the possibilities that rhetoric offers for its analysis from the generic approach of the discursive repetition phenomena.

  6. Repetitive behaviour in autism: Imaging pathways and trajectories

    NARCIS (Netherlands)

    Langen, M.J.G.

    2009-01-01

    Repetitive behaviour in autism: Imaging pathways and trajectories Repetitive and rigid behaviour is one of the core symptoms of autism, a severe and lifelong child psychiatric disorder. Although repetitive behaviour symptoms often form a significant impairment for affected individuals, systematic st

  7. Neural Correlates of Restricted, Repetitive Behaviors in Autism Spectrum Disorders

    Science.gov (United States)

    2014-12-01

    Restrictive Repetitive Behaviors in Autism Spectrum Disorder . Authors: T.Q.Nguyen, B...Manoach. Functional Connectivity of the Dorsal Anterior Cingulate Cortex Predicts Restrictive Repetitive Behaviors in Autism Spectrum Disorder We...Introduction: Although restricted , repetitive behaviors (RRBs) are a highly disabling core feature of Autism Spectrum Disorders (ASDs), they

  8. Lingual Kinematics during Rapid Syllable Repetition in Parkinson's Disease

    Science.gov (United States)

    Wong, Min Ney; Murdoch, Bruce E.; Whelan, Brooke-Mai

    2012-01-01

    Background: Rapid syllable repetition tasks are commonly used in the assessment of motor speech disorders. However, little is known about the articulatory kinematics during rapid syllable repetition in individuals with Parkinson's disease (PD). Aims: To investigate and compare lingual kinematics during rapid syllable repetition in dysarthric…

  9. Repetitive Elements in Mycoplasma hyopneumoniae Transcriptional Regulation

    Science.gov (United States)

    Cattani, Amanda Malvessi; Siqueira, Franciele Maboni; Guedes, Rafael Lucas Muniz; Schrank, Irene Silveira

    2016-01-01

    Transcriptional regulation, a multiple-step process, is still poorly understood in the important pig pathogen Mycoplasma hyopneumoniae. Basic motifs like promoters and terminators have already been described, but no other cis-regulatory elements have been found. DNA repeat sequences have been shown to be an interesting potential source of cis-regulatory elements. In this work, a genome-wide search for tandem and palindromic repetitive elements was performed in the intergenic regions of all coding sequences from M. hyopneumoniae strain 7448. Computational analysis demonstrated the presence of 144 tandem repeats and 1,171 palindromic elements. The DNA repeat sequences were distributed within the 5’ upstream regions of 86% of transcriptional units of M. hyopneumoniae strain 7448. Comparative analysis between distinct repetitive sequences found in related mycoplasma genomes demonstrated different percentages of conservation among pathogenic and nonpathogenic strains. qPCR assays revealed differential expression among genes showing variable numbers of repetitive elements. In addition, repeats found in 206 genes already described to be differentially regulated under different culture conditions of M. hyopneumoniae strain 232 showed almost 80% conservation in relation to M. hyopneumoniae strain 7448 repeats. Altogether, these findings suggest a potential regulatory role of tandem and palindromic DNA repeats in the M. hyopneumoniae transcriptional profile. PMID:28005945

  10. Modeling repetitive motions using structured light.

    Science.gov (United States)

    Xu, Yi; Aliaga, Daniel G

    2010-01-01

    Obtaining models of dynamic 3D objects is an important part of content generation for computer graphics. Numerous methods have been extended from static scenarios to model dynamic scenes. If the states or poses of the dynamic object repeat often during a sequence (but not necessarily periodically), we call such a repetitive motion. There are many objects, such as toys, machines, and humans, undergoing repetitive motions. Our key observation is that when a motion-state repeats, we can sample the scene under the same motion state again but using a different set of parameters; thus, providing more information of each motion state. This enables robustly acquiring dense 3D information difficult for objects with repetitive motions using only simple hardware. After the motion sequence, we group temporally disjoint observations of the same motion state together and produce a smooth space-time reconstruction of the scene. Effectively, the dynamic scene modeling problem is converted to a series of static scene reconstructions, which are easier to tackle. The varying sampling parameters can be, for example, structured-light patterns, illumination directions, and viewpoints resulting in different modeling techniques. Based on this observation, we present an image-based motion-state framework and demonstrate our paradigm using either a synchronized or an unsynchronized structured-light acquisition method.

  11. Repetitive element hypermethylation in multiple sclerosis patients.

    Science.gov (United States)

    Neven, K Y; Piola, M; Angelici, L; Cortini, F; Fenoglio, C; Galimberti, D; Pesatori, A C; Scarpini, E; Bollati, V

    2016-06-18

    Multiple sclerosis (MS) is a complex disorder of the central nervous system whose cause is currently unknown. Evidence is increasing that DNA methylation alterations could be involved in inflammatory and neurodegenerative diseases and could contribute to MS pathogenesis. Repetitive elements Alu, LINE-1 and SAT-α, are widely known as estimators of global DNA methylation. We investigated Alu, LINE-1 and SAT-α methylation levels to evaluate their difference in a case-control setup and their role as a marker of disability. We obtained blood samples from 51 MS patients and 137 healthy volunteers matched by gender, age and smoking. Methylation was assessed using bisulfite-PCR-pyrosequencing. For all participants, medical history, physical and neurological examinations and screening laboratory tests were collected. All repetitive elements were hypermethylated in MS patients compared to healthy controls. A lower Expanded Disability Status Scale (EDSS) score was associated with a lower levels of LINE-1 methylation for 'EDSS = 1.0' and '1.5 ≤ EDSS ≤ 2.5' compared to an EDSS higher than 3, while Alu was associated with a higher level of methylation in these groups: 'EDSS = 1.0' and '1.5 ≤ EDSS ≤ 2.5'. MS patients exhibit an hypermethylation in repetitive elements compared to healthy controls. Alu and LINE-1 were associated with degree of EDSS score. Forthcoming studies focusing on epigenetics and the multifactorial pathogenetic mechanism of MS could elucidate these links further.

  12. FRB repetition and non-Poissonian statistics

    CERN Document Server

    Connor, Liam; Oppermann, Niels

    2016-01-01

    We discuss some of the claims that have been made regarding the statistics of fast radio bursts (FRBs). In an earlier paper \\citep{2015arXiv150505535C} we conjectured that flicker noise associated with FRB repetition could show up in non-cataclysmic neutron star emission models, like supergiant pulses. We show how the current limits of repetition would be significantly weakened if their repeat rate really were non-Poissonian and had a pink or red spectrum. Repetition and its statistics have implications for observing strategy, generally favouring shallow wide-field surveys, since in the non-repeating scenario survey depth is unimportant. We also discuss the statistics of the apparent latitudinal dependence of FRBs, and offer a simple method for calculating the significance of this effect. We provide a generalized Bayesian framework for addressing this problem, which allows for direct model comparison. It is shown how the evidence for a steep latitudinal gradient of the FRB rate is less strong than initially s...

  13. A subset of malignant phyllodes tumors harbors alterations in the Rb/p16 pathway.

    Science.gov (United States)

    Cimino-Mathews, Ashley; Hicks, Jessica L; Sharma, Rajni; Vang, Russell; Illei, Peter B; De Marzo, Angelo; Emens, Leisha A; Argani, Pedram

    2013-11-01

    Breast phyllodes tumors are fibroepithelial neoplasms with variable risk of aggressive local recurrence and distant metastasis, and the molecular pathogenesis is unclear. Here, we systematically study p16 and Rb expression in 34 phyllodes tumors in relation to proliferation. Tissue microarrays were constructed from 10 benign, 10 borderline, and 14 malignant phyllodes (5 cores/tumor) and from 10 fibroadenomas (2 cores/tumor). Tissue microarrays were labeled by immunohistochemistry for p16, Rb, and Ki-67 and by in situ hybridization for high-risk human papillomavirus. Cytoplasmic and nuclear p16 were scored by percentage labeling (0%-100%, diffuse >95%) and intensity. Nuclear Rb was scored by percentage labeling (0%-100%, diffuse >75%) and intensity. p16 and Rb labeling were repeated on whole sections of cases with Rb loss on the tissue microarray. Twenty-nine percent (4/14) malignant phyllodes showed diffuse strong p16 labeling with Rb loss in malignant cells (diffuse p16+/Rb-), whereas 21% (3/14) malignant phyllodes showed the reverse pattern of p16 loss with diffuse strong Rb (p16-/diffuse Rb+). Results were consistent between tissue microarrays and whole sections. No borderline phyllodes, benign phyllodes, or fibroadenoma showed diffuse p16+/Rb- or p16-/diffuse Rb+ phenotypes. No cases contained high-risk human papillomavirus. Average Ki-67 proliferation indices were 15% in malignant phyllodes, 1.7% in borderline phyllodes, 0.5% in benign phyllodes, and 0% in fibroadenoma. Ki-67 was highest in malignant phyllodes with diffuse p16+/Rb- labeling. In summary, 50% malignant phyllodes display evidence of Rb/p16 pathway alterations, likely reflecting p16 or Rb inactivation. These and other mechanisms may contribute to the increased proliferation in malignant phyllodes relative to other fibroepithelial neoplasms.

  14. Charge transfer in the cold Yb$^+$ + Rb collisions

    CERN Document Server

    Sayfutyarova, Elvira R; Yakovleva, Svetlana A; Belyaev, Andrey K

    2013-01-01

    Charge-transfer cold Yb$^+$ + Rb collision dynamics is investigated theoretically using high-level {\\it ab initio} potential energy curves, dipole moment functions and nonadiabatic coupling matrix elements. Within the scalar-relativistic approximation, the radiative transitions from the entrance $A^1\\Sigma^+$ to the ground $X^1\\Sigma^+$ state are found to be the only efficient charge-transfer pathway. The spin-orbit coupling does not open other efficient pathways, but alters the potential energy curves and the transition dipole moment for the $A-X$ pair of states. The radiative, as well as the nonradiative, charge-transfer cross sections calculated within the $10^{-3}-10$ cm$^{-1}$ collision energy range exhibit all features of the Langevin ion-atom collision regime, including a rich structure associated with centrifugal barrier tunneling (orbiting) resonances. Theoretical rate coefficients for two Yb isotopes agree well with those measured by immersing Yb$^+$ ion in an ultracold Rb ensemble in a hybrid trap....

  15. Blackbody radiation shift in ^87Rb frequency standard

    Science.gov (United States)

    Safronova, Marianna; Safronova, U. I.

    2010-03-01

    The operation of atomic clocks is generally carried out at room temperature, whereas the definition of the second refers to the clock transition in an atom at absolute zero. This implies that the clock transition frequency should be corrected in practice for the effect of finite temperature of which the leading contributor is the blackbody radiation (BBR) shift. Experimental measurements of the BBR shifts are difficult. In this work, we have calculated the blackbody radiation shift of the ground-state hyperfine microwave transition in ^87Rb using the relativistic all-order method and evaluated the accuracy of our final value. Particular care is taken to accurately account for the contributions from highly-excited states. Various Rb atomic properties, including E1, E2, and E3 ground state polarizabilities, np and nd E1 polarizabilities, and hyperfine constants are also calculated. The results are compared with experiment and other theory where available.

  16. The $d \\: ^3 \\Pi$ state of LiRb

    CERN Document Server

    Stevenson, I; Altaf, A; Chen, Y P; Elliott, D S

    2016-01-01

    We report our spectroscopic studies of the $d \\ ^3\\Pi$ state of ultra-cold $^7$Li$^{85}$Rb using resonantly-enhanced multi-photon ionization and depletion spectroscopy with bound-to-bound transitions originating from the metastable $a \\ ^3\\Sigma^+$ state. We evaluate the potential of this state for use as the intermediate state in a STIRAP transfer scheme from triplet Feshbach LiRb molecules to the $X \\ ^1\\Sigma^+$ ground state, and find that the lowest several vibrational levels possess the requisite overlap with initial and final states, as well as convenient energies. Using depletion measurements, we measured the well depth and spin-orbit splitting. We suggest possible pathways for short-range photoassociation using deeply-bound vibrational levels of this electronic state.

  17. Fighting blindness with microelectronics.

    Science.gov (United States)

    Zrenner, Eberhart

    2013-11-06

    There is no approved cure for blindness caused by degeneration of the photoreceptor cells of the retina. However, there has been encouraging progress with attempts to restore vision using microelectronic retinal implant devices. Yet many questions remain to be addressed. Where is the best location to implant multielectrode arrays? How can spatial and temporal resolution be improved? What are the best ways to ensure the safety and longevity of these devices? Will color vision be possible? This Perspective discusses the current state of the art of retinal implants and attempts to address some of the outstanding questions.

  18. Coulomb effects in Fermi {beta} decay of {sup 74}Rb

    Energy Technology Data Exchange (ETDEWEB)

    Oinonen, M. [CERN, EP Div., Geneva (Switzerland)

    2003-07-01

    Coulomb effects in the {beta} decay of {sup 74}Rb have been studied at ISOLDE. The observation of the non-analog feeding in the {beta} decay allows for an estimation of the Coulomb mixing parameter {delta}{sub IM}{sup 1}. The analysis of the total Coulomb correction {delta}{sub C} is still hampered by the uncertainty in the decay energy. (orig.)

  19. Rb optical resonance inside a random porous medium

    CERN Document Server

    Villalba, S; Laliotis, A; Lenci, L; Barreiro, S; Lezama, A

    2012-01-01

    We studied absorption and fluorescence of Rb atoms confined to the interstitial cavities of a random porous glass. Due to the diffusive light propagation in the porous sample, resonant light absorption is almost entirely compensated by atomic fluorescence at low atomic densities. For higher densities, radiation trapping increases the probability of non-radiative decay via atom-wall collisions. A simple connection of the fluorescence/absorption yield to the sample porosity is given.

  20. Fullerene molecule strain in RbC 60

    Science.gov (United States)

    Aksenov, V. L.; Ossipyan, Yu. À.; Forro, L.; Khasanov, S.; Chernyshev, V. V.; Shakhmatov, V. S.

    2000-04-01

    Strain displacements of carbon atoms in a Ñ 60 molecule in the Pnnm phase of the RbC 60 fulleride are first determined by X-ray diffraction. The measurements show that the polymeric bond length between carbon atoms of two nearest molecules C 60 is equal to 1.69(1) Å, the rotation angle of the molecule about the polymeric direction is 47.0(3)°.

  1. Fullerene Molecule Strain in $RbC_{60}$

    CERN Document Server

    Aksenov, V L; Forró, L; Khasanov, S S; Chernyshev, V V; Shakhmatov, V S

    2000-01-01

    Strain displacements of carbon atoms in a C$_60$ molecule in the $Pnnm$ phase of the RbC$_60$ fulleride are first determined by X-ray diffraction. The measurements show that the polymeric bond length between carbon atoms of two nearest molecules C$_60$ is equal to 1.69(1) $\\AA$, the rotation angle of the molecule about the polymeric direction is 47.0(3)$^0$.

  2. Formation of ultracold RbCs molecules by photoassociation

    CERN Document Server

    Bouloufa-Maafa, N; Dulieu, O; Gabbanini, C

    2011-01-01

    The formation of ultracold metastable RbCs molecules is observed in a double species magneto-optical trap through photoassociation below the ^85Rb(5S_1/2)+^133Cs(6P_3/2) dissociation limit followed by spontaneous emission. The molecules are detected by resonance enhanced two-photon ionization. Using accurate quantum chemistry calculations of the potential energy curves and transition dipole moment, we interpret the observed photoassociation process as occurring at short internuclear distance, in contrast with most previous cold atom photoassociation studies. The vibrational levels excited by photoassociation belong to the 5th 0^+ or the 4th 0^- electronic states correlated to the Rb(5P_1/2,3/2)+Cs(6S_1/2) dissociation limit. The computed vibrational distribution of the produced molecules shows that they are stabilized in deeply bound vibrational states of the lowest triplet state. We also predict that a noticeable fraction of molecules is produced in the lowest level of the electronic ground state.

  3. Brucella abortus RB51 in milk of vaccinated adult cattle.

    Science.gov (United States)

    Miranda, Karina Leite; Poester, Fernando Padilla; Dorneles, Elaine Maria Seles; Resende, Thiago Magalhães; Vaz, Adil Knackfuss; Ferraz, Sandra Maria; Lage, Andrey Pereira

    2016-08-01

    The aim of this study was to evaluate the shedding of Brucella abortus in the milk of cows vaccinated with a full dose of RB51 during lactation. Eighteen cows, nine previously vaccinated with S19 as calves and nine non-vaccinated, were immunized subcutaneously with 1.3×10(10)CFU of B. abortus RB51, 30-60days after parturition. Milk samples from all animals were collected daily until day 7, and at weekly interval for the next 9 weeks after vaccination. To evaluate the shedding of B. abortus, milk samples were submitted for culture and PCR. No B. abortus was isolated from any sample tested. Only one sample, collected on first day after vaccination from a cow previously vaccinated, was faintly positive in the PCR. In conclusion, the public health hazard associated with milk consumption from cows vaccinated with RB51 in post-partum is very low, despite vaccination with the full dose and regardless of previous S19 vaccination.

  4. R$_{b}$ and new physics a comprehensive analysis

    CERN Document Server

    Bamert, P; Cline, J M; London, D; Nardi, E

    1996-01-01

    We survey the implications for new physics of the discrepancy between the LEP measurement of R_b and its Standard Model prediction. Two broad classes of models are considered: (i) those in which new Z\\bbar b couplings arise at tree level, through Z or b-quark mixing with new particles, and (ii) those in which new scalars and fermions alter the Z \\bbar b vertex at one loop. We keep our analysis as general as possible in order to systematically determine what kinds of features can produce corrections to R_b of the right sign and magnitude. We are able to identify several successful mechanisms, which include most of those which have been recently been proposed in the literature, as well as some earlier proposals (\\eg\\ supersymmetric models). By seeing how such models appear as special cases of our general treatment we are able to shed light on the reason for, and the robustness of, their ability to explain R_b.

  5. Exploring the structural and functional effect of pRB by significant nsSNP in the coding region of RB1 gene causing retinoblastoma.

    Science.gov (United States)

    Rajasekaran, R; Sethumadhavan, Rao

    2010-02-01

    In this study, we identified the most deleterious nsSNP in RB1 gene through structural and functional properties of its protein (pRB) and investigated its binding affinity with E2F-2. Out of 956 SNPs, we investigated 12 nsSNPs in coding region in which three of them (SNPids rs3092895, rs3092903 and rs3092905) are commonly found to be damaged by I-Mutant 2.0, SIFT and PolyPhen programs. With this effort, we modeled the mutant pRB proteins based on these deleterious nsSNPs. From a comparison of total energy, stabilizing residues and RMSD of these three mutant proteins with native pRB protein, we identified that the major mutation is from Glutamic acid to Glycine at the residue position of 746 of pRB. Further, we compared the binding efficiency of both native and mutant pRB (E746G) with E2F-2. We found that mutant pRB has less binding affinity with E2F-2 as compared to native type. This is due to sixteen hydrogen bonding and two salt bridges that exist between native type and E2F-2, whereas mutant type makes only thirteen hydrogen bonds and one salt bridge with E2F-2. Based on our investigation, we propose that the SNP with an id rs3092905 could be the most deleterious nsSNP in RB1 gene causing retinoblastoma.

  6. fMRI repetition suppression: neuronal adaptation or stimulus expectation?

    Science.gov (United States)

    Larsson, Jonas; Smith, Andrew T

    2012-03-01

    Measurements of repetition suppression with functional magnetic resonance imaging (fMRI adaptation) have been used widely to probe neuronal population response properties in human cerebral cortex. fMRI adaptation techniques assume that fMRI repetition suppression reflects neuronal adaptation, an assumption that has been challenged on the basis of evidence that repetition-related response changes may reflect unrelated factors, such as attention and stimulus expectation. Specifically, Summerfield et al. (Summerfield C, Trittschuh EH, Monti JM, Mesulam MM, Egner T. 2008. Neural repetition suppression reflects fulfilled perceptual expectations. Nat Neurosci. 11:1004-1006) reported that the relative frequency of stimulus repetitions and non-repetitions influenced the magnitude of repetition suppression in the fusiform face area, suggesting that stimulus expectation accounted for most of the effect of repetition. We confirm that stimulus expectation can significantly influence fMRI repetition suppression throughout visual cortex and show that it occurs with long as well as short adaptation durations. However, the effect was attention dependent: When attention was diverted away from the stimuli, the effects of stimulus expectation completely disappeared. Nonetheless, robust and significant repetition suppression was still evident. These results suggest that fMRI repetition suppression reflects a combination of neuronal adaptation and attention-dependent expectation effects that can be experimentally dissociated. This implies that with an appropriate experimental design, fMRI adaptation can provide valid measures of neuronal adaptation and hence response specificity.

  7. A 3 He-129 Xe co-magnetometer with 87 Rb magnetometry

    Science.gov (United States)

    Limes, Mark; Sheng, Dong; Romalis, Mike

    2016-05-01

    We report progress on a 3 He-129 Xe co-magnetometer detected with a 87 Rb magnetometer. The noble-gas co-magnetometer is insensitive to any long-term bias field drifts, but the presence of hot Rb can cause instability in the ratio of 3 He-129 Xe precession frequencies. We use a sequence of Rb π pulses to suppress the instability due to Rb-noble gas interactions by a factor of 104 along all three spatial axes. For detection, our 87 Rb magnetometer operates using single-axis 87 Rb π pulses with σ+ /σ- pumping-this technique decouples the 87 Rb magnetometer from bias fields, and allows for SERF operation. We are presently investigating systematic effects due to combinations of several imperfections, such as longitudinal noble gas polarization, imperfect 87 Rb π pulses, and 87 Rb pump light shifts. Thus far, our 87 Rb magnetometer has a sensitivity of 40 fT/√{Hz}, and our 3 He-129 Xe co-magnetometer has achieved a single-shot precession frequency ratio error of 20 nHz and a long-term bias drift of 8 nHz at 7 h. We are developing the co-magnetometer for use as an NMR gyro, and to search for possible spin-gravity interactions. Supported by DARPA and NSF.

  8. Deaf, blind or deaf-blind: Is touch enhanced?

    Science.gov (United States)

    Papagno, Costanza; Cecchetto, Carlo; Pisoni, Alberto; Bolognini, Nadia

    2016-02-01

    When someone looses one type of sensory input, s/he may compensate by using the sensory information conveyed by other senses. To verify whether loosing a sense or two has consequences on a spared sensory modality, namely touch, and whether these consequences depend on the type of sensory loss, we investigated the effects of deafness and blindness on temporal and spatial tactile tasks in deaf, blind and deaf-blind people. Deaf and deaf-blind people performed the spatial tactile task better than the temporal one, while blind and controls showed the opposite pattern. Deaf and deaf-blind participants were impaired in temporal discrimination as compared to controls, while deaf-blind individuals outperformed blind participants in the spatial tactile task. Overall, sensory-deprived participants did not show an enhanced tactile performance. We speculate that discriminative touch is not so relevant in humans, while social touch is. Probably, more complex tactile tasks would have revealed an increased performance in sensory-deprived people.

  9. Hydrothermal Synthesis of RbLn2F7 and VUV Spectroscopy of RbLn2F7:Eu3+(Ln=Gd, Y)

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    RbLn2F7 (Ln=Gd, Y, Er, Yb and Lu), crystallized in the hexagonal RbEr2F7 structure type, is synthesized by a hydrothermal method. The excitation spectra of Eu3+-doped RbGd(Y)2F7 suggest that the oxygen content is very low in the samples obtained by hydrothermal synthesis. Only the f-f transitions of Gd3+ ions are observed in the excitation spectrum of RbGd2F7:Eu3+ (0.5mol%), while those of Eu3+ ions do not appear. When the Gd3+ ions are excited, the absorbed energy is transferred efficiently from Gd3+ to Eu3+. The spectra show that the doped Eu3+ ions are located in non-centrosymmetric sites in hexagonal RbLn2F7.

  10. Conditional Deletion of the Retinoblastoma (Rb) Gene in Ovarian Granulosa Cells Leads to Premature Ovarian Failure

    Science.gov (United States)

    Andreu-Vieyra, Claudia; Chen, Ruihong; Matzuk, Martin M.

    2008-01-01

    The retinoblastoma protein (RB) regulates cell proliferation and survival by binding to the E2F family of transcription factors. Recent studies suggest that RB also regulates differentiation in a variety of cell types, including myocytes, neurons, adipocytes, and chondrocytes. Rb mutations have been found in ovarian cancer; however, the role of RB in normal and abnormal ovarian function remains unclear. To test the hypothesis that loss of Rb induces ovarian tumorigenesis, we generated an ovarian granulosa cell conditional knockout of Rb (Rb cKO) using the Cre/lox recombination system. Rb cKO females showed 100% survival and no ovarian tumor formation through 9 months of age, but they developed progressive infertility. Prepubertal Rb cKO females showed increased ovulation rates compared with controls, correlating with increased follicle recruitment, higher Fshr and Kitl mRNA levels, and lower anti-Müllerian hormone levels. In contrast, the ovulation rate of 6-wk-old females was similar to that of controls. Morphometric analysis of Rb cKO ovaries from 6-wk-old and older females showed increased follicular atresia and apoptosis. Rb cKO ovaries and preantral follicles had abnormal levels of known direct and indirect target genes of RB, including Rbl2/p130, E2f1, Ccne2, Myc, Fos, and Tgfb2. In addition, preantral follicles showed increased expression of the granulosa cell differentiation marker Inha, decreased levels of Foxl2 and Cyp19a1 aromatase, and abnormal expression of the nuclear receptors Nr5a1, Nr5a2, and Nr0b1. Taken together, our results suggest that RB is required for the temporal-specific pattern of expression of key genes involved in follicular development. PMID:18599617

  11. In vitro phosphorylation and acetylation of the murine pocket protein Rb2/p130.

    Directory of Open Access Journals (Sweden)

    Muhammad Saeed

    Full Text Available The retinoblastoma protein (pRb and the related proteins Rb2/p130 and 107 represent the "pocket protein" family of cell cycle regulators. A key function of these proteins is the cell cycle dependent modulation of E2F-regulated genes. The biological activity of these proteins is controlled by acetylation and phosphorylation in a cell cycle dependent manner. In this study we attempted to investigate the interdependence of acetylation and phosphorylation of Rb2/p130 in vitro. After having identified the acetyltransferase p300 among several acetyltransferases to be associated with Rb2/p130 during S-phase in NIH3T3 cells in vivo, we used this enzyme and the CDK4 protein kinase for in vitro modification of a variety of full length Rb2/p130 and truncated versions with mutations in the acetylatable lysine residues 1079, 128 and 130. Mutation of these residues results in the complete loss of Rb2/p130 acetylation. Replacement of lysines by arginines strongly inhibits phosphorylation of Rb2/p130 by CDK4; the inhibitory effect of replacement by glutamines is less pronounced. Preacetylation of Rb2/p130 strongly enhances CDK4-catalyzed phosphorylation, whereas deacetylation completely abolishes in vitro phosphorylation. In contrast, phosphorylation completely inhibits acetylation of Rb2/p130 by p300. These results suggest a mutual interdependence of modifications in a way that acetylation primes Rb2/p130 for phosphorylation and only dephosphorylated Rb2/p130 can be subject to acetylation. Human papillomavirus 16-E7 protein, which increases acetylation of Rb2/p130 by p300 strongly reduces phosphorylation of this protein by CDK4. This suggests that the balance between phosphorylation and acetylation of Rb2/p130 is essential for its biological function in cell cycle control.

  12. Generation of a Retinoblastoma (Rb)1-inducible dominant-negative (DN) mouse model.

    Science.gov (United States)

    Tarang, Shikha; Doi, Songila M S R; Gurumurthy, Channabasavaiah B; Harms, Donald; Quadros, Rolen; Rocha-Sanchez, Sonia M

    2015-01-01

    Retinoblastoma 1 (Rb1) is an essential gene regulating cellular proliferation, differentiation, and homeostasis. To exert these functions, Rb1 is recruited and physically interacts with a growing variety of signaling pathways. While Rb1 does not appear to be ubiquitously expressed, its expression has been confirmed in a variety of hematopoietic and neuronal-derived cells, including the inner ear hair cells (HCs). Studies in transgenic mice demonstrate that complete germline or conditional Rb1 deletion leads to abnormal cell proliferation, followed by massive apoptosis; making it difficult to fully address Rb1's biochemical activities. To overcome these limitations, we developed a tetracycline-inducible TetO-CB-myc6-Rb1 (CBRb) mouse model to achieve transient and inducible dominant-negative (DN) inhibition of the endogenous RB1 protein. Our strategy involved fusing the Rb1 gene to the lysosomal protease pre-procathepsin B (CB), thus allowing for further routing of the DN-CBRb fusion protein and its interacting complexes for proteolytic degradation. Moreover, reversibility of the system is achieved upon suppression of doxycycline (Dox) administration. Preliminary characterization of DN-CBRb mice bred to a ubiquitous rtTA mouse line demonstrated a significant inhibition of the endogenous RB1 protein in the inner ear and in a number of other organs where RB1 is expressed. Examination of the postnatal (P) DN-CBRb mice inner ear at P10 and P28 showed the presence of supernumerary inner HCs (IHCs) in the lower turns of the cochleae, which corresponds to the described expression domain of the endogenous Rb1 gene. Selective and reversible suppression of gene expression is both an experimental tool for defining function and a potential means to medical therapy. Given the limitations associated with Rb1-null mice lethality, this model provides a valuable resource for understanding RB1 activity, relative contribution to HC regeneration and its potential therapeutic application.

  13. Impact of visual repetition rate on intrinsic properties of low frequency fluctuations in the visual network.

    Directory of Open Access Journals (Sweden)

    Yi-Chia Li

    Full Text Available BACKGROUND: Visual processing network is one of the functional networks which have been reliably identified to consistently exist in human resting brains. In our work, we focused on this network and investigated the intrinsic properties of low frequency (0.01-0.08 Hz fluctuations (LFFs during changes of visual stimuli. There were two main questions to be discussed in this study: intrinsic properties of LFFs regarding (1 interactions between visual stimuli and resting-state; (2 impact of repetition rate of visual stimuli. METHODOLOGY/PRINCIPAL FINDINGS: We analyzed scanning sessions that contained rest and visual stimuli in various repetition rates with a novel method. The method included three numerical approaches involving ICA (Independent Component Analyses, fALFF (fractional Amplitude of Low Frequency Fluctuation, and Coherence, to respectively investigate the modulations of visual network pattern, low frequency fluctuation power, and interregional functional connectivity during changes of visual stimuli. We discovered when resting-state was replaced by visual stimuli, more areas were involved in visual processing, and both stronger low frequency fluctuations and higher interregional functional connectivity occurred in visual network. With changes of visual repetition rate, the number of areas which were involved in visual processing, low frequency fluctuation power, and interregional functional connectivity in this network were also modulated. CONCLUSIONS/SIGNIFICANCE: To combine the results of prior literatures and our discoveries, intrinsic properties of LFFs in visual network are altered not only by modulations of endogenous factors (eye-open or eye-closed condition; alcohol administration and disordered behaviors (early blind, but also exogenous sensory stimuli (visual stimuli with various repetition rates. It demonstrates that the intrinsic properties of LFFs are valuable to represent physiological states of human brains.

  14. POSTERIOR SEGMENT CAUSES OF BLINDNESS AMONG CHILDREN IN BLIND SCHOOLS

    Directory of Open Access Journals (Sweden)

    Sandhya

    2015-09-01

    Full Text Available BACKGROUND: It is estimated that there are 1.4 million irreversibly blind children in the world out of which 1 million are in Asia alone. India has the highest number of blind children than any other country. Nearly 70% of the childhood blindness is avoidable. There i s paucity of data available on the causes of childhood blindness. This study focuses on the posterior segment causes of blindness among children attending blind schools in 3 adjacent districts of Andhra Pradesh. MATERIAL & METHODS: This is a cross sectiona l study conducted among 204 blind children aged 6 - 16 years age. Detailed eye examination was done by the same investigator to avoid bias. Posterior segment examination was done using a direct and/or indirect ophthalmoscope after dilating pupil wherever nec essary. The standard WHO/PBL for blindness and low vision examination protocol was used to categorize the causes of blindness. A major anatomical site and underlying cause was selected for each child. The study was carried out during July 2014 to June 2015 . The results were analyzed using MS excel software and Epi - info 7 software version statistical software. RESULTS: Majority of the children was found to be aged 13 - 16 years (45.1% and males (63.7%. Family history of blindness was noted in 26.0% and consa nguinity was reported in 29.9% cases. A majority of them were belonged to fulfill WHO grade of blindness (73.0% and in majority of the cases, the onset of blindness was since birth (83.7%. The etiology of blindness was unknown in majority of cases (57.4% while hereditary causes constituted 25.4% cases. Posterior segment causes were responsible in 33.3% cases with retina being the most commonly involved anatomical site (19.1% followed by optic nerve (14.2%. CONCLUSIONS: There is a need for mandatory oph thalmic evaluation, refraction and assessment of low vision prior to admission into blind schools with periodic evaluation every 2 - 3 years

  15. Storytelling and Repetitive Narratives for Design Empathy

    DEFF Research Database (Denmark)

    Fritsch, Jonas; Judice, Andrea; Soini, Katja

    2007-01-01

    Today it is widely established in design research that empathy is an important part of creating a true understanding of user experience as a resource for design. A typical challenge is how to transmit the feeling of empathy acquired by user studies to designers who have not participated in the user...... study. In this paper, we show how we attained an empathic understanding through storytelling and aroused empathy to others using repetitive narratives in an experimental presentation bringing forth factual, reflective and experiential aspects of the user information. Taking as a starting point our...... experiences with the design project Suomenlinna Seclusive, we conclude with the potential of using narratives for invoking design empathy....

  16. A miniature high repetition rate shock tube.

    Science.gov (United States)

    Tranter, R S; Lynch, P T

    2013-09-01

    A miniature high repetition rate shock tube with excellent reproducibility has been constructed to facilitate high temperature, high pressure, gas phase experiments at facilities such as synchrotron light sources where space is limited and many experiments need to be averaged to obtain adequate signal levels. The shock tube is designed to generate reaction conditions of T > 600 K, P shock waves with predictable characteristics are created, repeatably. Two synchrotron-based experiments using this apparatus are also briefly described here, demonstrating the potential of the shock tube for research at synchrotron light sources.

  17. Storytelling and Repetitive Narratives for Design Empathy

    DEFF Research Database (Denmark)

    Fritsch, Jonas; Judice, Andrea; Soini, Katja

    2007-01-01

    Today it is widely established in design research that empathy is an important part of creating a true understanding of user experience as a resource for design. A typical challenge is how to transmit the feeling of empathy acquired by user studies to designers who have not participated in the user...... study. In this paper, we show how we attained an empathic understanding through storytelling and aroused empathy to others using repetitive narratives in an experimental presentation bringing forth factual, reflective and experiential aspects of the user information. Taking as a starting point our...... experiences with the design project Suomenlinna Seclusive, we conclude with the potential of using narratives for invoking design empathy....

  18. The repetitive component of the sunflower genome

    Directory of Open Access Journals (Sweden)

    T. Giordani

    2014-08-01

    Full Text Available The sunflower (Helianthus annuus and species belonging to the genus Helianthus are emerging as a model species and genus for a number of studies on genome evolution. In this review, we report on the repetitive component of the H. annuus genome at the biochemical, molecular, cytological, and genomic levels. Recent work on sunflower genome composition is described, with emphasis on different types of repeat sequences, especially LTR-retrotransposons, of which we report on isolation, characterisation, cytological localisation, transcription, dynamics of proliferation, and comparative analyses within the genus Helianthus.

  19. Justifications Shape Ethical Blind Spots

    NARCIS (Netherlands)

    Pittarello, Andrea; Leib, Margarita; Gordon-Hecker, Tom; Shalvi, Shaul

    2015-01-01

    To some extent, unethical behavior results from people's limited attention to ethical considerations, which results in an ethical blind spot. Here, we focus on the role of ambiguity in shaping people's ethical blind spots, which in turn lead to their ethical failures. We suggest that in ambiguous se

  20. Overview on Deaf-Blindness

    Science.gov (United States)

    ... build relationships and become the eventual basis for language learning. As the child who is deaf-blind becomes ... those near them, deaf-blindness fosters opportunities for learning and mutual ... M. (Eds.), (1993). Second edition. A model service delivery system for persons ...

  1. Blind Cognitive MAC Protocols

    CERN Document Server

    Mehanna, Omar; Gamal, Hesham El

    2008-01-01

    We consider the design of cognitive Medium Access Control (MAC) protocols enabling an unlicensed (secondary) transmitter-receiver pair to communicate over the idle periods of a set of licensed channels, i.e., the primary network. The objective is to maximize data throughput while maintaining the synchronization between secondary users and avoiding interference with licensed (primary) users. No statistical information about the primary traffic is assumed to be available a-priori to the secondary user. We investigate two distinct sensing scenarios. In the first, the secondary transmitter is capable of sensing all the primary channels, whereas it senses one channel only in the second scenario. In both cases, we propose MAC protocols that efficiently learn the statistics of the primary traffic online. Our simulation results demonstrate that the proposed blind protocols asymptotically achieve the throughput obtained when prior knowledge of primary traffic statistics is available.

  2. Melanin Biosynthesis Inhibition Effects of Ginsenoside Rb2 Isolated from Panax ginseng Berry.

    Science.gov (United States)

    Lee, Dae Young; Jeong, Yong Tae; Jeong, Sang Chul; Lee, Mi Kyoung; Min, Jin Woo; Lee, Jae Won; Kim, Geum Soog; Lee, Seung Eun; Ahn, Young Sup; Kang, Hee Cheol; Kim, Jin Hee

    2015-12-28

    Ginsenoside Rb2 (Gin-Rb2) was purified from the fruit extract of Panax ginseng. Its chemical structure was measured by spectroscopic analysis, including HR-FAB-MS, (1)H-NMR, and IR spectroscopy. Gin-Rb2 decreased potent melanogenesis in melan-a cells, with 23.4% at 80 μM without cytotoxicity. Gin-Rb2 also decreased tyrosinase and MITF protein expression in melan-a cells. Furthermore, Gin-Rb2 presented inhibition of the body pigmentation in the zebrafish in vivo system and reduced melanin contents and tyrosinase activity. These results show that Gin-Rb2 isolated from P. ginseng may be an effective skin-whitening agent via the in vitro and in vivo systems.

  3. Photoassociative Production and Detection of Ultracold Polar RbCs Molecules

    Institute of Scientific and Technical Information of China (English)

    JI Zhong-Hua; ZHANG Hong-Shan; WU Ji-Zhou; YUAN Jin-Peng; ZHAO Yan-Ting; MA Jie; WANG Li-Rong; XIAO Lian-Tuan; JIA Suo-Tang

    2011-01-01

    @@ We have produced Ultracold polar RbCs molecules via photoassociation starting from laser-cooled s5Rb and 133 CS atoms in a dual-species, forced dark magneto-optical trap.The formed electronically excited RbCs* molecules correlated to the Rb(5S,12)+Cs(6P1/2) dissociation limit are observed by trap loss spectroscopy.Following the decay of these excited RbCs* molecules, the formed ground state molecules are directly ionized by a two-photon single-color pulse dye laser, which is a new ionization mechanism for ground state RbCs molecules and thence detected by time-of-flight mass spectroscopy.

  4. The RB/E2F pathway and regulation of RNA processing

    Energy Technology Data Exchange (ETDEWEB)

    Ahlander, Joseph [Department of Molecular and Cellular Biology, 1007 East Lowell Street, University of Arizona, Tucson, AZ 85721 (United States); Bosco, Giovanni, E-mail: gbosco@email.arizona.edu [Department of Molecular and Cellular Biology, 1007 East Lowell Street, University of Arizona, Tucson, AZ 85721 (United States)

    2009-07-03

    The retinoblastoma tumor suppressor protein (RB) is inactivated in a majority of cancers. RB restricts cell proliferation by inhibiting the E2F family of transcription factors. The current model for RB/E2F function describes its role in regulating transcription at gene promoters. Whether the RB or E2F proteins might play a role in gene expression beyond transcription initiation is not well known. This review describes evidence that points to a novel role for the RB/E2F network in the regulation of RNA processing, and we propose a model as a framework for future research. The elucidation of a novel role of RB in RNA processing will have a profound impact on our understanding of the role of this tumor suppressor family in cell and developmental biology.

  5. Spin-exchange collision mixing of the K and Rb ac Stark shifts

    Science.gov (United States)

    Chen, Yao; Quan, Wei; Duan, Lihong; Lu, Yan; Jiang, Liwei; Fang, Jiancheng

    2016-11-01

    In a hybrid pumping alkali-metal vapor cell filled with both K and Rb atoms, the K atom spins are optically pumped by the laser and the Rb atom spins are polarized by the K spins through spin exchange. We discovered that the ac Stark shift of the Rb atom spins, caused by the far-off-resonant pumping laser tuned to the K absorption lines, was mixed together with the ac Stark shift of the K atom spins through fast spin exchange. This mixing is studied and we demonstrate a K-Rb-21Ne comagnetometer in which the ac Stark shift of the Rb atom spins is eliminated by compensating for the Rb ac Stark shift with the K ac Stark shift. An ac Stark shift elimination method has been developed.

  6. Photodissociation of Trapped Rb2+: Implications for Simultaneous Trapping of Atoms and Molecular Ions

    Science.gov (United States)

    Jyothi, S.; Ray, Tridib; Dutta, Sourav; Allouche, A. R.; Vexiau, Romain; Dulieu, Olivier; Rangwala, S. A.

    2016-11-01

    The direct photodissociation of trapped 85Rb2+ (rubidium) molecular ions by the cooling light for the 85Rb magneto-optical trap (MOT) is studied, both experimentally and theoretically. Vibrationally excited Rb2+ ions are created by photoionization of Rb2 molecules formed photoassociatively in the Rb MOT and are trapped in a modified spherical Paul trap. The decay rate of the trapped Rb2+ ion signal in the presence of the MOT cooling light is measured and agreement with our calculated rates for molecular ion photodissociation is observed. The photodissociation mechanism due to the MOT light is expected to be active and therefore universal for all homonuclear diatomic alkali metal molecular ions.

  7. Photodissociation of trapped Rb$^+_2$ : Implications for hybrid molecular ion-atom trapping

    CERN Document Server

    Jyothi, S; Dutta, Sourav; Allouche, A R; Vexiau, Romain; Dulieu, Olivier; Rangwala, S A

    2016-01-01

    We observe direct photodissociation of trapped $^{85}$Rb$_2^+$ molecular ions in the presence of cooling light for the $^{85}$Rb magneto optical trap (MOT). Vibrationally excited Rb$_{2}^{+}$ ions are created by photoionization of Rb$_{2}$ molecules formed photoassociatively in the rubidium (Rb) MOT and are trapped in a modified spherical Paul trap co-centric with the MOT. The decay rate of the trapped Rb$_{2}^{+}$ ion signal in the presence of the MOT cooling light is measured and agreement with our calculated rates for molecular ion photodissociation is established. The photodissociation mechanism due to the MOT light is expected to be active and therefore universal for all homonuclear diatomic alkali metal molecular ions.

  8. Inhibition of pRB Pathway Differentially Modulates Apoptosis in Esophageal Cancer Cells.

    Science.gov (United States)

    Soletti, Rossana C; Biasoli, Deborah; Rodrigues, Nathassya A L V; Delou, João M A; Maciel, Renata; Chagas, Vera L A; Martins, Rodrigo A P; Rehen, Stevens K; Borges, Helena L

    2017-10-01

    Esophageal cancer is the sixth most common cause of cancer-related death worldwide. Current chemotherapy regimens include a combination of 5-fluorouracil (5-FU) and cisplatin, but more efficient therapy strategies are needed to increase 5-year survival. Alterations in the signaling pathway of the tumor suppressor gene Rb-1, which encodes a phosphoprotein (pRB) that negatively regulates the G1/S transition of the cell cycle, are present in 70% of all tumors, but its role in esophageal cancer is still unclear. Most of these are alterations leading to up-regulation of the activity of cyclin-dependent kinases (CDKs) to phosphorylate pRB, which suggests that keeping the wild type pRB phosphorylated might be advantageous. Besides proliferation, pRB also regulates apoptosis induced by tumor necrosis factor-alpha (TNF-α) and DNA-damage. We investigated the status of phosphorylation of pRB along esophageal tumorigenesis stages, as well as whether hyperphosphorylation of pRB could suppress apoptosis induced by cisplatin, 5-FU, or TNF-α in esophageal cancer cells. pRB phosphorylation increased progressively from normal esophageal tissue to metaplasia and adenocarcinoma, suggesting that pRB phosphorylation increases along esophageal tumor stages. When RB-1 was knocked down or CDK inhibitors reduced the levels of phosphorylated pRB, opposite apoptotic effects were observed, depending on the combination of drugs tested: whereas TNF-α- and cisplatin-induced apoptosis increased, 5-FU-induced apoptosis decreased. Taken together, these data suggest that pRB plays a role in esophageal adenocarcinoma and that, depending on the type of anti-cancer treatment, combining CDK inhibitors and chemotherapy has the potential to increase the sensitivity of esophageal cancer cells to cell death. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  9. A kinase shRNA screen links LATS2 and the pRB tumor suppressor.

    Science.gov (United States)

    Tschöp, Katrin; Conery, Andrew R; Litovchick, Larisa; Decaprio, James A; Settleman, Jeffrey; Harlow, Ed; Dyson, Nicholas

    2011-04-15

    pRB-mediated inhibition of cell proliferation is a complex process that depends on the action of many proteins. However, little is known about the specific pathways that cooperate with the Retinoblastoma protein (pRB) and the variables that influence pRB's ability to arrest tumor cells. Here we describe two shRNA screens that identify kinases that are important for pRB to suppress cell proliferation and pRB-mediated induction of senescence markers. The results reveal an unexpected effect of LATS2, a component of the Hippo pathway, on pRB-induced phenotypes. Partial knockdown of LATS2 strongly suppresses some pRB-induced senescence markers. Further analysis shows that LATS2 cooperates with pRB to promote the silencing of E2F target genes, and that reduced levels of LATS2 lead to defects in the assembly of DREAM (DP, RB [retinoblastoma], E2F, and MuvB) repressor complexes at E2F-regulated promoters. Kinase assays show that LATS2 can phosphorylate DYRK1A, and that it enhances the ability of DYRK1A to phosphorylate the DREAM subunit LIN52. Intriguingly, the LATS2 locus is physically linked with RB1 on 13q, and this region frequently displays loss of heterozygosity in human cancers. Our results reveal a functional connection between the pRB and Hippo tumor suppressor pathways, and suggest that low levels of LATS2 may undermine the ability of pRB to induce a permanent cell cycle arrest in tumor cells.

  10. Creation of ultracold $^{87}$RbCs molecules in the rovibrational ground state

    CERN Document Server

    Molony, Peter K; Ji, Zhonghua; Lu, Bo; Köppinger, Michael P; Sueur, C Ruth Le; Blackley, Caroline L; Hutson, Jeremy M; Cornish, Simon L

    2014-01-01

    We report the creation of a sample of over 1000 ultracold $^{87}$RbCs molecules in the lowest rovibrational ground state, from an atomic mixture of $^{87}$Rb and Cs, by magnetoassociation on an interspecies Feshbach resonance followed by stimulated Raman adiabatic passage (STIRAP). We measure the binding energy of the RbCs molecule to be $h c \\times 3811.576(1)$ cm$^{-1}$ and the $|\

  11. Characterization and retinal neuron differentiation of WERI-Rb1 cancer stem cells

    OpenAIRE

    Hu, Huiling; Deng, Fei; Liu, Ying; Chen, Mengfei; Zhang, Xiulan; Sun, Xuerong; Dong, Zhizhang; Xiaohong LIU; Ge, Jian

    2012-01-01

    Purpose The evidence is increasing that cancer stem cells (CSCs) expressing embryonic and neuronal stem cell markers are present in human retinoblastoma (Rb). This study was conducted to determine whether stem-like cancer cells (SLCCs) in Rb express retinal stem cell–related genes and whether SLCCs can directly differentiate into retinal neurons. Methods The cancer stem cell characteristics in WERI-Rb1 cells were determined with Hoechst 33,342 staining, clone formation assay, and CD133 flow c...

  12. RB loss contributes to aggressive tumor phenotypes in MYC-driven triple negative breast cancer.

    Science.gov (United States)

    Knudsen, Erik S; McClendon, A Kathleen; Franco, Jorge; Ertel, Adam; Fortina, Paolo; Witkiewicz, Agnieszka K

    2015-01-01

    Triple negative breast cancer (TNBC) is characterized by multiple genetic events occurring in concert to drive pathogenic features of the disease. Here we interrogated the coordinate impact of p53, RB, and MYC in a genetic model of TNBC, in parallel with the analysis of clinical specimens. Primary mouse mammary epithelial cells (mMEC) with defined genetic features were used to delineate the combined action of RB and/or p53 in the genesis of TNBC. In this context, the deletion of either RB or p53 alone and in combination increased the proliferation of mMEC; however, the cells did not have the capacity to invade in matrigel. Gene expression profiling revealed that loss of each tumor suppressor has effects related to proliferation, but RB loss in particular leads to alterations in gene expression associated with the epithelial-to-mesenchymal transition. The overexpression of MYC in combination with p53 loss or combined RB/p53 loss drove rapid cell growth. While the effects of MYC overexpression had a dominant impact on gene expression, loss of RB further enhanced the deregulation of a gene expression signature associated with invasion. Specific RB loss lead to enhanced invasion in boyden chambers assays and gave rise to tumors with minimal epithelial characteristics relative to RB-proficient models. Therapeutic screening revealed that RB-deficient cells were particularly resistant to agents targeting PI3K and MEK pathway. Consistent with the aggressive behavior of the preclinical models of MYC overexpression and RB loss, human TNBC tumors that express high levels of MYC and are devoid of RB have a particularly poor outcome. Together these results underscore the potency of tumor suppressor pathways in specifying the biology of breast cancer. Further, they demonstrate that MYC overexpression in concert with RB can promote a particularly aggressive form of TNBC.

  13. RB1CC1 activates the p16 promoter through the interaction with hSNF5.

    Science.gov (United States)

    Ochi, Yasuko; Chano, Tokuhiro; Ikebuchi, Kaichiro; Inoue, Hirokazu; Isono, Takahiro; Arai, Akihito; Tameno, Hitosuke; Shimada, Taketoshi; Hisa, Yasuo; Okabe, Hidetoshi

    2011-10-01

    RB1-inducible coiled-coil 1 (RB1CC1, also known as FIP200) is involved in dephosphorylation and increase of retinoblastoma tumor suppressor protein (RB1), but the RB1CC1 molecular mechanism in the dephosphorylation of RB1 is not fully understood. We determined that RB1CC1 activates the expression of p16 (also called INK4a/CDKN2a) through the activation of its promoter, using chromatin immunoprecipitation (ChIP) and p16 promoter-luciferase reporter assays. In addition, RB1CC1 essentially requires binding with hSNF5 (also known as BAF47/INI1, a chromatin-remodeling factor) to activate the p16 promoter, in order to enhance the RB1 pathway and acts as a tumor suppressor. Evaluation of the RB1CC1 mechanism of action is expected to provide useful information for clinical practice and future therapeutic strategies in human cancers.

  14. pRb is an obesity suppressor in hypothalamus and high-fat diet inhibits pRb in this location.

    Science.gov (United States)

    Lu, Zhonglei; Marcelin, Genevieve; Bauzon, Frederick; Wang, Hongbo; Fu, Hao; Dun, Siok Le; Zhao, Hongling; Li, Xiaosong; Jo, Young-Hwan; Wardlaw, Sharon; Dun, Nae; Chua, Streamson; Zhu, Liang

    2013-03-20

    pRb is frequently inactivated in tumours by mutations or phosphorylation. Here, we investigated whether pRb plays a role in obesity. The Arcuate nucleus (ARC) in hypothalamus contains antagonizing POMC and AGRP/NPY neurons for negative and positive energy balance, respectively. Various aspects of ARC neurons are affected in high-fat diet (HFD)-induced obesity mouse model. Using this model, we show that HFD, as well as pharmacological activation of AMPK, induces pRb phosphorylation and E2F target gene de-repression in ARC neurons. Some affected neurons express POMC; and deleting Rb1 in POMC neurons induces E2F target gene de-repression, cell-cycle re-entry, apoptosis, and a hyperphagia-obesity-diabetes syndrome. These defects can be corrected by combined deletion of E2f1. In contrast, deleting Rb1 in the antagonizing AGRP/NPY neurons shows no effects. Thus, pRb-E2F1 is an obesity suppression mechanism in ARC POMC neurons and HFD-AMPK inhibits this mechanism by phosphorylating pRb in this location.

  15. The ancient function of RB-E2F Pathway: insights from its evolutionary history

    Directory of Open Access Journals (Sweden)

    Yang Xianmei

    2010-09-01

    Full Text Available Abstract Background The RB-E2F pathway is conserved in most eukaryotic lineages, including animals and plants. E2F and RB family proteins perform crucial functions in cycle controlling, differentiation, development and apoptosis. However, there are two kinds of E2Fs (repressive E2Fs and active E2Fs and three RB family members in human. Till now, the detail evolutionary history of these protein families and how RB-E2F pathway evolved in different organisms remain poorly explored. Results We performed a comprehensive evolutionary analysis of E2F, RB and DP (dimerization partners of E2Fs protein family in representative eukaryotic organisms. Several interesting facts were revealed. First, orthologues of RB, E2F, and DP family are present in several representative unicellular organisms and all multicellular organisms we checked. Second, ancestral E2F, RB genes duplicated before placozoans and bilaterians diverged, thus E2F family was divided into E2F4/5 subgroup (including repressive E2Fs: E2F4 and E2F5 and E2F1/2/3 subgroup (including active E2Fs: E2F1, E2F2 and E2F3, RB family was divided into RB1 subgroup (including RB1 and RBL subgroup (including RBL1 and RBL2. Third, E2F4 and E2F5 share more sequence similarity with the predicted E2F ancestral sequence than E2F1, E2F2 and E2F3; E2F4 and E2F5 also possess lower evolutionary rates and higher purification selection pressures than E2F1, E2F2 and E2F3. Fourth, for RB family, the RBL subgroup proteins possess lower evolutionary rates and higher purification selection pressures compared with RB subgroup proteins in vertebrates, Conclusions Protein evolutionary rates and purification selection pressures are usually linked with protein functions. We speculated that function conducted by E2F4/5 subgroup and RBL subgroup proteins might mainly represent the ancient function of RB-E2F pathway, and the E2F1/2/3 subgroup proteins and RB1 protein might contribute more to functional diversification in RB-E2F

  16. The ancient function of RB-E2F pathway: insights from its evolutionary history.

    Science.gov (United States)

    Cao, Lihuan; Peng, Bo; Yao, Lei; Zhang, Xinming; Sun, Kuan; Yang, Xianmei; Yu, Long

    2010-09-20

    The RB-E2F pathway is conserved in most eukaryotic lineages, including animals and plants. E2F and RB family proteins perform crucial functions in cycle controlling, differentiation, development and apoptosis. However, there are two kinds of E2Fs (repressive E2Fs and active E2Fs) and three RB family members in human. Till now, the detail evolutionary history of these protein families and how RB-E2F pathway evolved in different organisms remain poorly explored. We performed a comprehensive evolutionary analysis of E2F, RB and DP (dimerization partners of E2Fs) protein family in representative eukaryotic organisms. Several interesting facts were revealed. First, orthologues of RB, E2F, and DP family are present in several representative unicellular organisms and all multicellular organisms we checked. Second, ancestral E2F, RB genes duplicated before placozoans and bilaterians diverged, thus E2F family was divided into E2F4/5 subgroup (including repressive E2Fs: E2F4 and E2F5) and E2F1/2/3 subgroup (including active E2Fs: E2F1, E2F2 and E2F3), RB family was divided into RB1 subgroup (including RB1) and RBL subgroup (including RBL1 and RBL2). Third, E2F4 and E2F5 share more sequence similarity with the predicted E2F ancestral sequence than E2F1, E2F2 and E2F3; E2F4 and E2F5 also possess lower evolutionary rates and higher purification selection pressures than E2F1, E2F2 and E2F3. Fourth, for RB family, the RBL subgroup proteins possess lower evolutionary rates and higher purification selection pressures compared with RB subgroup proteins in vertebrates, Protein evolutionary rates and purification selection pressures are usually linked with protein functions. We speculated that function conducted by E2F4/5 subgroup and RBL subgroup proteins might mainly represent the ancient function of RB-E2F pathway, and the E2F1/2/3 subgroup proteins and RB1 protein might contribute more to functional diversification in RB-E2F pathway. Our results will enhance the current

  17. Study of Rapid Radiochemical Separation of 90Rb from Fission Product

    Institute of Scientific and Technical Information of China (English)

    YUE; Yuan-zhen; MAO; Guo-shu; YANG; Lei; DING; You-qian; MA; Peng

    2015-01-01

    90Rb is a high yield and short-lived fission product,and it is a sensitive monitor at low burnup.The decay data of 90Rb are important,however the uncertainty of the decay data of 90Rb tends to be large,such as the half-life data(58±5)s(with an uncertainty of 3.2%)from ENSDF.In order to get the half-life measured more accurately,a carrier-free 90Rb sample of

  18. Protein phosphatase 2A subunit PR70 interacts with pRb and mediates its dephosphorylation.

    Science.gov (United States)

    Magenta, Alessandra; Fasanaro, Pasquale; Romani, Sveva; Di Stefano, Valeria; Capogrossi, Maurizio C; Martelli, Fabio

    2008-01-01

    The retinoblastoma tumor suppressor protein (pRb) regulates cell proliferation and differentiation via phosphorylation-sensitive interactions with specific targets. While the role of cyclin/cyclin-dependent kinase complexes in the modulation of pRb phosphorylation has been extensively studied, relatively little is known about the molecular mechanisms regulating phosphate removal by phosphatases. Protein phosphatase 2A (PP2A) is constituted by a core dimer bearing catalytic activity and one variable B regulatory subunit conferring target specificity and subcellular localization. We previously demonstrated that PP2A core dimer binds pRb and dephosphorylates pRb upon oxidative stress. In the present study, we identified a specific PP2A-B subunit, PR70, that was associated with pRb both in vitro and in vivo. PR70 overexpression caused pRb dephosphorylation; conversely, PR70 knockdown prevented both pRb dephosphorylation and DNA synthesis inhibition induced by oxidative stress. Moreover, we found that intracellular Ca(2+) mobilization was necessary and sufficient to trigger pRb dephosphorylation and PP2A phosphatase activity of PR70 was Ca(2+) induced. These data underline the importance of PR70-Ca(2+) interaction in the signal transduction mechanisms triggered by redox imbalance and leading to pRb dephosphorylation.

  19. p21 suppresses inflammation and tumorigenesis on pRB-deficient stratified epithelia.

    Science.gov (United States)

    Saiz-Ladera, C; Lara, M F; Garín, M; Ruiz, S; Santos, M; Lorz, C; García-Escudero, R; Martínez-Fernández, M; Bravo, A; Fernández-Capetillo, O; Segrelles, C; Paramio, J M

    2014-09-11

    The retinoblastoma gene product (pRb) controls proliferation and differentiation processes in stratified epithelia. Importantly, and in contrast to other tissues, Rb deficiency does not lead to spontaneous skin tumor formation. As the cyclin-dependent kinase inhibitor p21 regulates proliferation and differentiation in the absence of pRb, we analyzed the consequences of deleting p21 in pRb-ablated stratified epithelia (hereafter pRb(ΔEpi);p21-/-). These mice display an enhancement of the phenotypic abnormalities observed in pRb(ΔEpi) animals, indicating that p21 partially compensates pRb absence. Remarkably, pRb(ΔEpi);p21-/- mice show an acute skin inflammatory phenotype and develop spontaneous epithelial tumors, particularly affecting tongue and oral tissues. Biochemical analyses and transcriptome studies reveal changes affecting multiple pathways, including DNA damage and p53-dependent signaling responses. Comparative metagenomic analyses, together with the histopathological profiles, indicate that these mice constitute a faithful model for human head and neck squamous cell carcinomas. Collectively, our findings demonstrate that p21, in conjunction with pRb, has a central role in regulating multiple epithelial processes and orchestrating specific tumor suppressor functions.

  20. Demonstration of a Dual Alkali Rb/Cs Atomic Fountain Clock

    CERN Document Server

    Guéna, J; Laurent, Ph; Abgrall, M; Rovera, D; Lours, M; Santarelli, G; Tobar, M E; Bize, S; Clairon, A; 10.1109/TUFFC.2010.1461

    2013-01-01

    We report the operation of a dual Rb/Cs atomic fountain clock. 133Cs and 87Rb atoms are cooled, launched, and detected simultaneously in LNE-SYRTE's FO2 double fountain. The dual clock operation occurs with no degradation of either the stability or the accuracy. We describe the key features for achieving such a simultaneous operation. We also report on the results of the first Rb/Cs frequency measurement campaign performed with FO2 in this dual atom clock configuration, including a new determination of the absolute 87Rb hyperfine frequency.

  1. Perfusion imaging using rubidium-82 ((82)Rb) PET in rats with myocardial infarction

    DEFF Research Database (Denmark)

    Clemmensen, Andreas Ettrup; Ghotbi, Adam Ali; Bodholdt, Rasmus Poul

    2017-01-01

    Assessing myocardial perfusion using 82Rb-PET is emerging as a valuable clinical tool.1,2 The rapid decay (T½ = 76 s) allows for absolute quantification of both rest and stress perfusion within 30 minutes. In addition to evaluation of epicardial disease with perfusion defects, also evaluation...... of balanced coronary and small vessel disease is possible. For further evaluation of how 82Rb-PET can be used clinically, pre-clinical application of the method would be valuable. However, so far no data on the use of 82Rb-PET in small animals have been published nor has the use of 82Rb-PET, to the best...

  2. Leptin-LepRb Expressed in Gastric Cancer Patients and Related to Cancer-Related Depression

    Science.gov (United States)

    He, Chenyan; Hui, Lingyun; Huang, Tianhe

    2017-01-01

    Depression is the most common psychiatric disorder among cancer patients. Studies have not only highlighted that leptin and its receptor (LepRb) are independent poor prognostic factors in gastric cancer (GC) patients but also shown that the leptin-LepRb is necessary for antidepressant-like behaviors. In this study, we examined the serum and tissue leptin-LepRb expression in GC patients. Enzyme-linked immunosorbent assay showed that depressive GC patients had significantly higher serum leptin-LepRb than healthy donors. Leptin-LepRb levels in GC tissues were also significantly higher than in matched paracarcinoma tissues using real-time RT-PCR. Moreover, we observed that both serum and tissue leptin-LepRb were significantly higher in depressive GC patients than those in nondepressive GC patients. Further, the patients with high tumor stage tend to have higher leptin-LepRb mRNA levels than that with low tumor stage. Together, our findings suggest that leptin-LepRb plays an important role in the pathogenesis and depression in GC. Leptin-LepRb therefore could be a potential diagnostic marker and therapeutic target in GC patients with depression.

  3. Immune responses of bison and efficacy after booster vaccination with Brucella abortus strain RB51.

    Science.gov (United States)

    Olsen, S C; McGill, J L; Sacco, R E; Hennager, S G

    2015-04-01

    Thirty-one bison heifers were randomly assigned to receive saline or a single vaccination with 10(10) CFU of Brucella abortus strain RB51. Some vaccinated bison were randomly selected for booster vaccination with RB51 at 11 months after the initial vaccination. Mean antibody responses to RB51 were greater (P abortus strain 2308. The incidences of abortion and infection were greater (P Brucella organisms in all tissues, except in retropharyngeal and supramammary lymph nodes. Our study suggests that RB51 booster vaccination is an effective vaccination strategy for enhancing herd immunity against brucellosis in bison.

  4. A comprehensive, sensitive and economical approach for the detection of mutations in the RB1 gene in retinoblastoma

    Indian Academy of Sciences (India)

    Vidya Latha Parsam; Chitra Kannabiran; Santosh Honavar; Geeta K. Vemuganti; Mohammad Javed Ali

    2009-12-01

    Retinoblastoma (Rb) is the most common primary intraocular malignancy in children. It is brought about by the mutational inactivation of both alleles of RB1 gene in the developing retina. To identify the RB1 mutations, we analysed 74 retinoblastoma patients by screening the exons and the promoter region of RB1. The strategy used was to detect large deletions/duplications by fluorescent quantitative multiplex PCR; small deletions/insertions by fluorescent genotyping of RB1 alleles, and point mutations by PCR-RFLP and sequencing. Genomic DNA from the peripheral blood leucocytes of 74 Rb patients (53 with bilateral Rb, 21 with unilateral Rb; 4 familial cases) was screened for mutations. Recurrent mutations were identified in five patients with bilateral Rb, large deletions in 11 patients (nine with bilateral Rb and two with unilateral Rb), small deletions/insertions were found in 12 patients all with bilateral Rb, and point mutations in 26 patients (14 nonsense, six splice site, five substitution and one silent change). Three mutations were associated with variable expressivity of the disease in different family members. Using this method, the detection rates achieved in patients with bilateral Rb were 44/53 (83%) and with unilateral Rb, 5/21 (23.8%). This approach may be feasible for clinical genetic testing and counselling of patients.

  5. The role of short-term memory impairment in nonword repetition, real word repetition, and nonword decoding: A case study.

    Science.gov (United States)

    Peter, Beate

    2017-09-21

    In a companion study, adults with dyslexia and adults with a probable history of childhood apraxia of speech showed evidence of difficulty with processing sequential information during nonword repetition, multisyllabic real word repetition and nonword decoding. Results suggested that some errors arose in visual encoding during nonword reading, all levels of processing but especially short-term memory storage/retrieval during nonword repetition, and motor planning and programming during complex real word repetition. To further investigate the role of short-term memory, a participant with short-term memory impairment (MI) was recruited. MI was confirmed with poor performance during a sentence repetition and three nonword repetition tasks, all of which have a high short-term memory load, whereas typical performance was observed during tests of reading, spelling, and static verbal knowledge, all with low short-term memory loads. Experimental results show error-free performance during multisyllabic real word repetition but high counts of sequence errors, especially migrations and assimilations, during nonword repetition, supporting short-term memory as a locus of sequential processing deficit during nonword repetition. Results are also consistent with the hypothesis that during complex real word repetition, short-term memory is bypassed as the word is recognized and retrieved from long-term memory prior to producing the word.

  6. Corneal blindness: prevention, treatment and rehabilitation

    Directory of Open Access Journals (Sweden)

    Matthew J Burton

    2009-12-01

    Full Text Available Blindness from corneal disease is a major ophthalmic public health problem. There are three important elements to addressing corneal blindness: prevention, treatment, and rehabilitation.

  7. A phonetic approach to consonant repetition in early words.

    Science.gov (United States)

    Kim, Namhee; Davis, Barbara L

    2015-08-01

    The goal of this study was to evaluate movement-based principles for understanding early speech output patterns. Consonant repetition patterns within children's actual productions of word forms were analyzed using spontaneous speech data from 10 typically developing American-English learning children between 12 and 36 months of age. Place of articulation, word level patterns, and developmental trends in CVC and CVCV repeated word forms were evaluated. Labial and coronal place repetitions dominated. Regressive repetition (e.g., [gag] for "dog") occurred frequently in CVC but not in CVCV word forms. Consonant repetition decreased over time. However, the children produced sound types available reported as being within young children's production system capabilities in consonant repetitions in all time periods. Findings suggest that a movement-based approach can provide a framework for comprehensively characterizing consonant place repetition patterns in early speech development.

  8. Repetition and Reactance in Graham’s "Underneath" Poems

    Directory of Open Access Journals (Sweden)

    Roghayeh Farsi

    2017-09-01

    Full Text Available The present paper gives a detailed analysis and interpretation of 16 poems in Jorie Graham's collection, Swarm (2000, which bear "UNDERNEATH" as their main titles. The poems are marked with different types of repetition such as graphological repetition, word, phrase, and sentential repetition, semantic repetition, and syntactic repetition. The study draws on Lakoff and Johnson's theories on metaphor and Brehm and Brehm’s reactance theory. It is argued "underneath" is a conceptual (orientational metaphor which signifies a state of being limited, lack of control and freedom, and loss of power. The paper investigates the speaker's reactant behavior in "Underneath" poems, seeking a way to restore her lost freedom. Reactance behaviors can be skepticism, inertia, aggression, and resistance. It is concluded despite her thematic inertia, representing her submission to the oppressed state, her stylistic reactance reflected in repetitions, innovations, and disruptive diction stands for her attempts to regain her lost control.

  9. Enhanced Spin Depolarization and Storage Time in a Rb Vapor

    Institute of Scientific and Technical Information of China (English)

    QI Yue-Rong; GAO Hong; ZHANG Shou-Gang

    2009-01-01

    The experiment of measuring the spin depolarized time and light storage time in a Rb vapor under different conditions is performed. Typically, these measurements are accomplished in three different containers: atoms in a bare glass ceil, atoms in a buffer gas cell, and atoms in a tetracontane (C40H82) coating cell. The increasing depolarization and storage times are observed in both the buffer gas ceil and the tetracontane coating cell. In the latter case, a storage time greater than 400 μs is obtained.

  10. Treatment of repetitive use carpal tunnel syndrome

    Science.gov (United States)

    Smith, Chadwick F.; Vangsness, C. Thomas; Anderson, Thomas; Good, Wayne

    1995-05-01

    In 1990, a randomized, double-blind study was initiated to evaluate the use of an eight-point conservative treatment program in carpal tunnel syndrome. A total of 160 patients were delineated with symptoms of carpal tunnel syndrome. These patients were then divided into two groups. Both groups were subjected to an ergonomically correct eight-point work modification program. A counterfeit low level laser therapy unit was utilized in Group A, while an actual low level laser therapy unit was utilized in Group B. The difference between Groups A and B was statistically significant in terms of return to work, conduction study improvement, and certain range of motion and strength studies.

  11. FEMA Hazard Mitigation Assistance Repetitive Flood Claims (RFC) Data

    Data.gov (United States)

    Department of Homeland Security — This dataset contains closed and obligated projects funded under the following Hazard Mitigation Assistance (HMA) grant programs: Repetitive Flood Claims (RFC). The...

  12. A review of neuroimaging findings in repetitive brain trauma.

    Science.gov (United States)

    Koerte, Inga K; Lin, Alexander P; Willems, Anna; Muehlmann, Marc; Hufschmidt, Jakob; Coleman, Michael J; Green, Isobel; Liao, Huijun; Tate, David F; Wilde, Elisabeth A; Pasternak, Ofer; Bouix, Sylvain; Rathi, Yogesh; Bigler, Erin D; Stern, Robert A; Shenton, Martha E

    2015-05-01

    Chronic traumatic encephalopathy (CTE) is a neurodegenerative disease confirmed at postmortem. Those at highest risk are professional athletes who participate in contact sports and military personnel who are exposed to repetitive blast events. All neuropathologically confirmed CTE cases, to date, have had a history of repetitive head impacts. This suggests that repetitive head impacts may be necessary for the initiation of the pathogenetic cascade that, in some cases, leads to CTE. Importantly, while all CTE appears to result from repetitive brain trauma, not all repetitive brain trauma results in CTE. Magnetic resonance imaging has great potential for understanding better the underlying mechanisms of repetitive brain trauma. In this review, we provide an overview of advanced imaging techniques currently used to investigate brain anomalies. We also provide an overview of neuroimaging findings in those exposed to repetitive head impacts in the acute/subacute and chronic phase of injury and in more neurodegenerative phases of injury, as well as in military personnel exposed to repetitive head impacts. Finally, we discuss future directions for research that will likely lead to a better understanding of the underlying mechanisms separating those who recover from repetitive brain trauma vs. those who go on to develop CTE.

  13. FEMA Hazard Mitigation Assistance Severe Repetitive Loss (SRL) Data

    Data.gov (United States)

    Department of Homeland Security — This dataset contains closed and obligated projects funded under the following Hazard Mitigation Assistance (HMA) grant programs: Severe Repetitive Loss (SRL). The...

  14. Repetitive control of electrically driven robot manipulators

    Science.gov (United States)

    Fateh, Mohammad Mehdi; Ahsani Tehrani, Hojjat; Karbassi, Seyed Mehdi

    2013-04-01

    This article presents a novel robust discrete repetitive control of electrically driven robot manipulators for tracking of a periodic trajectory. We propose a novel model, which presents the highly non-linear dynamics of robot manipulator in the form of linear discrete-time time-varying system. Based on the proposed model, we develop a two-term control law. The first term is an ordinary time-optimal and minimum-norm (TOMN) control by employing parametric controllers to guarantee stability. The second term is a novel robust control to improve the control performance in the face of uncertainties. The robust control estimates and compensates uncertainties including the parametric uncertainty, unmodelled dynamics and external disturbances. Performance of the proposed method is compared with two discrete methods, namely the TOMN control and an adaptive iterative learning (AIL) control. Simulation results confirm superiority of the proposed method in terms of the convergence speed and precision.

  15. Studies of the uncanny: the repetition factor

    Directory of Open Access Journals (Sweden)

    Julia Teitelroit Martins

    2011-06-01

    Full Text Available Freud’s essay The Uncanny (Das Unheimliche offers many indications for the comprehension of an aesthetics of the uncanny which deserve to be explored. Nonetheless, a concept traverses it from beginning to end: the return – which enables its reading under the light of Beyond the pleasure principle, written along the same span of time. Emphasis is given to the uncanny in the sense of repetition of the different – a paradox in terms, like the strangely familiar uncanny. In order to test the validity of an aesthetic reading under this perspective, follows an analysis of the brief short story “A terceira margem do rio” (“The third margin of the river”, by Guimarães Rosa.

  16. Object color affects identification and repetition priming.

    Science.gov (United States)

    Uttl, Bob; Graf, Peter; Santacruz, Pilar

    2006-10-01

    We investigated the influence of color on the identification of both non-studied and studied objects. Participants studied black and white and color photos of common objects and memory was assessed with an identification test. Consistent with our meta-analysis of prior research, we found that objects were easier to identify from color than from black and white photos. We also found substantial priming in all conditions, and study-to-test changes in an object's color reduced the magnitude of priming. Color-specific priming effects were large for color-complex objects, but minimal for color-simple objects. The pattern and magnitude of priming effects was not influenced either by the extent to which an object always appears in the same color (i.e., whether a color is symptomatic of an object) or by the object's origin (natural versus fabricated). We discuss the implications of our findings for theoretical accounts of object perception and repetition priming.

  17. Phosphorylation of pRB at Ser612 by Chk1/2 leads to a complex between pRB and E2F-1 after DNA damage.

    Science.gov (United States)

    Inoue, Yasumichi; Kitagawa, Masatoshi; Taya, Yoichi

    2007-04-18

    The retinoblastoma tumor suppressor protein (pRB) plays a critical role in the control of cell proliferation and in the DNA damage checkpoints. pRB inhibits cell cycle progression through interactions with the E2F family of transcription factors. Here, we report that DNA damage induced not only the dephosphorylation of pRB at Cdk phosphorylation sites and the binding of pRB to E2F-1, but also the phosphorylation of pRB at Ser612. Phosphorylation of pRB at Ser612 enhanced the formation of a complex between pRB and E2F-1. Substitution of Ser612 with Ala decreased pRB-E2F-1 binding and the transcriptional repression activity. Until now, Ser612 of pRB has been thought to be phosphorylated by Cdk2. However, the phosphorylation of pRB at Ser612 was conducted by Chk1/2 after DNA damage, and inhibition of ATM-Chk1/2 activity suppressed the phosphorylation of Ser612 and the binding of pRB to E2F-1. These results suggest that Ser612 is phosphorylated by Chk1/2 after DNA damage, leading to the formation of pRB-E2F-1. This is the first report that pRB is phosphorylated in vivo by a kinase other than Cdk.

  18. LOVE IS COLOR BLIND

    Institute of Scientific and Technical Information of China (English)

    陈梦扬

    2013-01-01

    <正>看完这部电影,突然想起小时候看完《辛德勒的名单》后,问过母亲一个问题:"为什么有些人要嘲笑和歧视那些与众不同的人?"母亲告诉我:"我们都是一样的,没有人应当受到责备,每个人都应当为自己而活,要始终坚信‘Love is color blind(爱无定界)’。"爱究竟有无定界?有太多故事让我们相信这句话并非纸上谈兵。《汤姆叔叔的小屋》、《美国往事》、《为黛西小姐开车》……是的,"Love"是"Listen(倾听)",是无条件无偏见地倾听对方的需求,并予以协助;是"Obligate(感恩)",需要不断地感恩,付出爱来灌

  19. Novel Method of Unambiguous Moving Target Detection in Pulse-Doppler Radar with Random Pulse Repetition Interval

    Directory of Open Access Journals (Sweden)

    Liu Zhen

    2012-03-01

    Full Text Available Blind zones and ambiguities in range and velocity measurement are two important issues in traditional pulse-Doppler radar. By generating random deviations with respect to a mean Pulse Repetition Interval (PRI, this paper proposes a novel algorithm of Moving Target Detection (MTD based on the Compressed Sensing (CS theory, in which the random deviations of the PRIare converted to the Restricted Isometry Property (RIP of the observing matrix. The ambiguities of range and velocity are eliminated by designing the signal parameters. The simulation results demonstrate that this scheme has high performance of detection, and there is no ambiguity and blind zones as well. It can also shorten the coherent processing interval compared to traditional staggered PRI mode because only one pulse train is needed instead of several trains.

  20. Expression of p16 and pRB in invasive breast cancer.

    Science.gov (United States)

    Shin, Eunah; Jung, Woo-Hee; Koo, Ja-Seung

    2015-01-01

    We aimed to assess protein expressions of p16 and pRB in breast cancer and explore the clinicopathologic implications. Tissue microarray (TMA) was constructed with 406 cases of breast cancer. The cases were subgrouped into luminal A, luminal B, HER-2, and triple negative breast cancer (TNBC) based on the results of immunohistochemical stains for ER, PR, HER-2, and Ki-67 and fluorescent in situ hybridization (FISH) for HER-2. One hundred and sixty-eight cases were allocated to the subgroup luminal A; 87 cases to the luminal B; 32 cases to the HER-2; and 119 cases to the TNBC. The TNBC group showed the highest negative rate for p16, and the luminal B and HER-2 groups showed the highest positive rate for p16 (P pRB expression rate was the highest in the HER-2 group and lowest in the luminal A group. In addition, p16(+)/pRB(+) type was the most common in the luminal B group, p16(+)/pRB(-) in the luminal A group, and p16(-)/pRB(+) in the TNBC group (P pRB(+) and non-altered p16/pRB(+) type was the most common in the luminal B, and altered p16/pRB(-) and non-altered p16/pRB(+) type was the most common in the luminal A (P pRB positivity was correlated with PR negativity (P = 0.009), HER-2 positivity (P = 0.001), and higher Ki-67 LI (P pRB differ according to the molecular subgroups of breast cancer and they subsequently correlate with clnicopathologic factors.

  1. Pandoraea sp. RB-44, A Novel Quorum Sensing Soil Bacterium

    Directory of Open Access Journals (Sweden)

    Robson Ee Han-Jen

    2013-10-01

    Full Text Available Proteobacteria are known to communicate via signaling molecules and this process is known as quorum sensing. The most commonly studied quorum sensing molecules are N-acylhomoserine lactones (AHLs that consists of a homoserine lactone moiety and an N-acyl side chain with various chain lengths and degrees of saturation at the C-3 position. We have isolated a bacterium, RB-44, from a site which was formally a landfill dumping ground. Using matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF mass spectrometry analysis, this isolate was identified as a Pandoraea sp.which was then screened for AHL production using biosensors which indicated its quorum sensing properties. To identify the AHL profile of Pandoraea sp. RB-44, we used high resolution tandem mass spectrometry confirming that this isolate produced N-octanoylhomoserine lactone (C8-HSL. To the best of our knowledge, this is the first report that showed quorum sensing activity exhibited by Pandoraea sp. Our data add Pandoraea sp. to the growing number of bacteria that possess QS systems.

  2. Short-range Photoassociation of LiRb

    CERN Document Server

    Blasing, David B; Pérez-Ríos, Jesús; Elliott, Daniel S; Chen, Yong P

    2016-01-01

    We have observed short-range photoassociation of LiRb to the two lowest vibrational states of the $d\\,^3\\Pi$ potential. These $d\\,^3\\Pi$ molecules then spontaneously decay to vibrational levels of the $a^3\\,\\Sigma^+$ state with generation rates of $\\sim10^3$ molecules per second. This is the first observation of many of these $a\\,^3\\Sigma^+$ levels. We observe an alternation of the peak heights in the rotational photoassociation spectrum that suggests a $p$-wave shape resonance in the scattering state. Franck-Condon overlap calculations predict that photoassociation to higher vibrational levels of the $d\\,^3\\Pi$, in particular the sixth vibrational level, should populate the lowest vibrational level of the $a\\,^3\\Sigma^+$ state with a rate as high as $10^4$ molecules per second. These results encourage further work to explain our observed LiRb collisional physics using PECs. This work also motivates an experimental search for short-range photoassociation to other bound molecules, such as the $c\\,^3\\Sigma^+$ o...

  3. Local structure of solid Rb at megabar pressures

    Energy Technology Data Exchange (ETDEWEB)

    De Panfilis, S. [Centre for Life Nano Science IIT@Sapienza, Istituto Italiano di Tecnologia, I-00161 Roma (Italy); Gorelli, F.; Santoro, M. [INO-CNR and LENS, I-50019 Sesto Fiorentino, Firenze (Italy); Ulivi, L. [ISC-CNR, I-50019 Sesto Fiorentino, Firenze (Italy); Gregoryanz, E. [School of Physics and Astronomy, Centre for Science Under Extreme Conditions, University of Edinburgh, Edinburgh EH9 3JZ (United Kingdom); Irifune, T.; Shinmei, T. [Geodynamics Research Center, Ehime University, Matsuyama 790-8577 (Japan); Kantor, I.; Mathon, O.; Pascarelli, S. [European Synchrotron Radiation Facility, F-38043 Grenoble (France)

    2015-06-07

    We have investigated the local and electronic structure of solid rubidium by means of x-ray absorption spectroscopy up to 101.0 GPa, thus doubling the maximum investigated experimental pressure. This study confirms the predicted stability of phase VI and was completed by the combination of two pivotal instrumental solutions. On one side, we made use of nanocrystalline diamond anvils, which, contrary to the more commonly used single crystal diamond anvils, do not generate sharp Bragg peaks (glitches) at specific energies that spoil the weak fine structure oscillations in the x-ray absorption cross section. Second, we exploited the performance of a state-of-the-art x-ray focussing device yielding a beam spot size of 5 × 5 μm{sup 2}, spatially stable over the entire energy scan. An advanced data analysis protocol was implemented to extract the pressure dependence of the structural parameters in phase VI of solid Rb from 51.2 GPa up to the highest pressure. A continuous reduction of the nearest neighbour distances was observed, reaching about 6% over the probed pressure range. We also discuss a phenomenological model based on the Einstein approximation to describe the pressure behaviour of the mean-square relative displacement. Within this simplified scheme, we estimate the Grüneisen parameter for this high pressure Rb phase to be in the 1.3–1.5 interval.

  4. A high repetition rate experimental setup for quantum non-linear optics with cold Rydberg atoms

    Science.gov (United States)

    Busche, Hannes; Ball, Simon W.; Huillery, Paul

    2016-12-01

    Using electromagnetically induced transparency and photon storage, the strong dipolar interactions between Rydberg atoms and the resulting dipole blockade can be mapped onto light fields to realise optical non-linearities and interactions at the single photon level. We report on the realisation of an experimental apparatus designed to study interactions between single photons stored as Rydberg excitations in optically trapped microscopic ensembles of ultracold 87Rb atoms. A pair of in-vacuum high numerical aperture lenses focus excitation and trapping beams down to 1 μm, well below the Rydberg blockade. Thanks to efficient magneto-optical trap (MOT) loading from an atomic beam generated by a 2D MOT and the ability to recycle the microscopic ensembles more than 20000 times without significant atom loss, we achieve effective repetition rates exceeding 110 kHz to obtain good photon counting statistics on reasonable time scales. To demonstrate the functionality of the setup, we present evidence of strong photon interactions including saturation of photon storage and the retrieval of non-classical light. Using in-vacuum antennae operating at up to 40 GHz, we perform microwave spectroscopy on photons stored as Rydberg excitations and observe an interaction induced change in lineshape depending on the number of stored photons.

  5. Simple pendulum for blind students

    Science.gov (United States)

    Goncalves, A. M. B.; Cena, C. R.; Alves, D. C. B.; Errobidart, N. C. G.; Jardim, M. I. A.; Queiros, W. P.

    2017-09-01

    Faced with the need to teach physics to the visually impaired, in this paper we propose a way to demonstrate the dependence of distance and time in a pendulum experiment to blind students. The periodic oscillation of the pendulum is translated, by an Arduino and an ultrasonic sensor, in a periodic variation of frequency in a speaker. The main advantage of this proposal is the possibility that a blind student understands the movement without necessity of touching it.

  6. 视肉膜母细胞瘤(RB)抑癌基因治疗原理及策略%Principles and Strategies for Approaching Retinoblastoma (RB) Tumor Suppressor Gene Therapy

    Institute of Scientific and Technical Information of China (English)

    徐洪基; 缪庆; 胡诗学; 刘秉慈

    1999-01-01

    The retinoblastoma (RB) gene was the first tumor suppressor gene identified.It encodes a nuclear phosphoprotein which is differentially phosphorylated during the cell cycle.And the RB gene apparently plays a key role in cell growth regulation.Mutations in RB are seen in virtually all cases of retinoblastoma,and loss of RB gene function has been implicated in the progression of many common human cancers.A number of studies have indicated that replacement of the normal RB gene in RB-defective tumor cells could suppress their tumorigenic activity in nude mice.Preclinical studies also demonstrated that treatment of established human xenograft tumors in nude mice by recombinant adenovirus vectors expressing RB protein resulted in regression of the treated tumor.These studies make the emerging RB gene therapy even more attraction.

  7. The golden ratio of gait harmony: repetitive proportions of repetitive gait phases.

    Science.gov (United States)

    Iosa, Marco; Fusco, Augusto; Marchetti, Fabio; Morone, Giovanni; Caltagirone, Carlo; Paolucci, Stefano; Peppe, Antonella

    2013-01-01

    In nature, many physical and biological systems have structures showing harmonic properties. Some of them were found related to the irrational number φ known as the golden ratio that has important symmetric and harmonic properties. In this study, the spatiotemporal gait parameters of 25 healthy subjects were analyzed using a stereophotogrammetric system with 25 retroreflective markers located on their skin. The proportions of gait phases were compared with φ, the value of which is about 1.6180. The ratio between the entire gait cycle and stance phase resulted in 1.620 ± 0.058, that between stance and the swing phase was 1.629 ± 0.173, and that between swing and the double support phase was 1.684 ± 0.357. All these ratios did not differ significantly from each other (F = 0.870, P = 0.422, repeated measure analysis of variance) or from φ (P = 0.670, 0.820, 0.422, resp., t-tests). The repetitive gait phases of physiological walking were found in turn in repetitive proportions with each other, revealing an intrinsic harmonic structure. Harmony could be the key for facilitating the control of repetitive walking. Harmony is a powerful unifying factor between seemingly disparate fields of nature, including human gait.

  8. The Golden Ratio of Gait Harmony: Repetitive Proportions of Repetitive Gait Phases

    Directory of Open Access Journals (Sweden)

    Marco Iosa

    2013-01-01

    Full Text Available In nature, many physical and biological systems have structures showing harmonic properties. Some of them were found related to the irrational number known as the golden ratio that has important symmetric and harmonic properties. In this study, the spatiotemporal gait parameters of 25 healthy subjects were analyzed using a stereophotogrammetric system with 25 retroreflective markers located on their skin. The proportions of gait phases were compared with , the value of which is about 1.6180. The ratio between the entire gait cycle and stance phase resulted in 1.620 ± 0.058, that between stance and the swing phase was 1.629 ± 0.173, and that between swing and the double support phase was 1.684 ± 0.357. All these ratios did not differ significantly from each other (, , repeated measure analysis of variance or from (, resp., t-tests. The repetitive gait phases of physiological walking were found in turn in repetitive proportions with each other, revealing an intrinsic harmonic structure. Harmony could be the key for facilitating the control of repetitive walking. Harmony is a powerful unifying factor between seemingly disparate fields of nature, including human gait.

  9. Exploring the structural and functional effect of pRB by significant nsSNP in the coding region of RB1 gene causing retinoblastoma

    Institute of Scientific and Technical Information of China (English)

    Rajasekaran; R; Rao; Sethumadhavan

    2010-01-01

    In this study,we identified the most deleterious nsSNP in RB1 gene through structural and functional properties of its protein (pRB) and investigated its binding affinity with E2F-2.Out of 956 SNPs,we investigated 12 nsSNPs in coding region in which three of them (SNPids rs3092895,rs3092903 and rs3092905) are commonly found to be damaged by I-Mutant 2.0,SIFT and PolyPhen programs.With this effort,we modeled the mutant pRB proteins based on these deleterious nsSNPs.From a comparison of total energy,stabilizing residues and RMSD of these three mutant proteins with native pRB protein,we identified that the major mutation is from Glutamic acid to Glycine at the residue position of 746 of pRB.Further,we compared the binding efficiency of both native and mutant pRB (E746G) with E2F-2.We found that mutant pRB has less binding affinity with E2F-2 as compared to native type.This is due to sixteen hydrogen bonding and two salt bridges that exist between native type and E2F-2,whereas mutant type makes only thirteen hydrogen bonds and one salt bridge with E2F-2.Based on our investigation,we propose that the SNP with an id rs3092905 could be the most deleterious nsSNP in RB1 gene causing retinoblastoma.

  10. Blinded trials taken to the test

    DEFF Research Database (Denmark)

    Hróbjartsson, A; Forfang, E; Haahr, M T

    2007-01-01

    Blinding can reduce bias in randomized clinical trials, but blinding procedures may be unsuccessful. Our aim was to assess how often randomized clinical trials test the success of blinding, the methods involved and how often blinding is reported as being successful....

  11. What It's Like to Be Color Blind

    Science.gov (United States)

    ... los dientes Video: Getting an X-ray What It's Like to Be Color Blind KidsHealth > For Kids > What It's Like to Be Color Blind Print A A ... blind. But some people really are color blind. It doesn't mean they can't see any ...

  12. Rb and p53 Liver Functions Are Essential for Xenobiotic Metabolism and Tumor Suppression

    NARCIS (Netherlands)

    Nantasanti, Sathidpak; Toussaint, Mathilda J. M.; Youssef, Sameh A.; Tooten, Peter C. J.; de Bruin, Alain

    2016-01-01

    The tumor suppressors Retinoblastoma (Rb) and p53 are frequently inactivated in liver diseases, such as hepatocellular carcinomas (HCC) or infections with Hepatitis B or C viruses. Here, we discovered a novel role for Rb and p53 in xenobiotic metabolism, which represent a key function of the liver f

  13. Intermediate-range chemical ordering of cations in molten RbCl-AgCl

    Energy Technology Data Exchange (ETDEWEB)

    Tahara, S. [Department of Physics and Earth Sciences, Faculty of Science, University of the Ryukyus, Okinawa 903-0213 (Japan); Research and Utilization Division, Japan Synchrotron Radiation Research Institute (JASRI, SPring-8), Hyogo 679-5198 (Japan); Kawakita, Y. [J-PARC Center, Japan Atomic Energy Agency (JAEA), Ibaraki 319-1195 (Japan); Shimakura, H. [Faculty of Pharmacy, Niigata University of Pharmacy and Applied Life Sciences, Niigata 956-8603 (Japan); Ohara, K. [Research and Utilization Division, Japan Synchrotron Radiation Research Institute (JASRI, SPring-8), Hyogo 679-5198 (Japan); Fukami, T. [Department of Physics and Earth Sciences, Faculty of Science, University of the Ryukyus, Okinawa 903-0213 (Japan); Takeda, S. [Department of Physics, Faculty of Sciences, Kyushu University, Fukuoka 812-8581 (Japan)

    2015-07-28

    A first sharp diffraction peak (FSDP) is observed in the X-ray total structure factor of a molten mixture of RbCl-AgCl, while both pure melts of RbCl and AgCl do not exhibit FSDP individually. Molecular dynamics simulations were performed to investigate the origin of the FSDP with the polarizable ion model (PIM). Coexistence of covalent Ag–Cl and ionic Rb–Cl bonds leads the system to evolve intermediate range ordering, which is simulated by introducing the induced polarization in different ways between Ag–Cl with fully polarizable treatment based on Vashishta-Raman potential and Rb–Cl with suppression over-polarization in the nearest neighbor contribution based on Born-Meyer potential. The partial structure factors for both the Ag–Ag and Rb–Rb correlations, S{sub AgAg}(Q) and S{sub RbRb}(Q), show a positive contribution to the FSDP, while S{sub AgRb}(Q) for the Ag–Rb correlation exhibits a negative contribution, indicating that Ag and Rb ions are distributed in an alternating manner within the intermediate-range length scale. The origin of the intermediate-range chemical ordering of cations can be ascribed to the preferred direction of the dipole moments of anions in the PIM.

  14. Mutational screening of the RB1 gene in Italian patients with retinoblastoma reveals 11 novel mutations.

    Science.gov (United States)

    Sampieri, Katia; Hadjistilianou, Theodora; Mari, Francesca; Speciale, Caterina; Mencarelli, Maria Antonietta; Cetta, Francesco; Manoukian, Siranoush; Peissel, Bernard; Giachino, Daniela; Pasini, Barbara; Acquaviva, Antonio; Caporossi, Aldo; Frezzotti, Renato; Renieri, Alessandra; Bruttini, Mirella

    2006-01-01

    Retinoblastoma (RB, OMIM#180200) is the most common intraocular tumour in infancy and early childhood. Constituent mutations in the RB1 gene predispose individuals to RB development. We performed a mutational screening of the RB1 gene in Italian patients affected by RB referred to the Medical Genetics of the University of Siena. In 35 unrelated patients, we identified germline RB1 mutations in 6 out of 9 familial cases (66%) and in 7 out of 26 with no family history of RB (27%). Using the single-strand conformational polymorphism (SSCP) technique, 11 novel mutations were detected, including 3 nonsense, 5 frameshift and 4 splice-site mutations. Only two of these mutations (1 splice site and 1 missense) were previously reported. The mutation spectrum reflects the published literature, encompassing predominately nonsense or frameshift and splicing mutations. RB1 germline mutation was detected in 37% of our cases. Gross rearrangements outside the investigated region, altered DNA methylation, or mutations in non-coding regions, may be the cause of disease in the remainder of the patients. Some cases, e.g. a case of incomplete penetrance, or variable expressivity ranging from retinoma to multiple tumours, are discussed in detail. In addition, a case of pre-conception genetic counselling resolved by rescue of banked cordonal blood of the affected deceased child is described.

  15. Experimental research of RB94 gene transfection into retinoblastoma cells using ultrasound-targeted microbubble destruction.

    Science.gov (United States)

    Zheng, Min-Ming; Zhou, Xi-Yuan; Wang, Li-Ping; Wang, Zhi-Gang

    2012-06-01

    The purpose of this study was to explore the transfection of the recombinant expression plasmid pEGFP-C1/RB94 into human retinoblastoma cells (HXO-Rb44) using ultrasound-targeted microbubble destruction (UTMD). pEGFP-C1/RB94 was transfected into HXO-Rb44 in vitro by UTMD, with liposome as the positive control. After 24 to 72 h, the expression of the reporter gene enhanced green fluorescent protein (EGFP) was observed using fluorescent microscopy and flow cytometry. The cell viability of HXO-Rb44 was measured by a MTT assay. The mRNA and proteins of RB94, caspase-3 and Bax were analyzed by reverse transcription polymerase chain reaction (RT-PCR) and Western blot. Moreover, the apoptosis rate and cell cycle progression of the cells were detected by flow cytometry. This study demonstrated that UTMD can enhance the transfection efficiency of RB94, which has an obvious impact on the inhibition of the growth process of retinoblastoma cells, suggesting that the combination of UTMD and RB94 compounds might be a useful tool for use in the gene therapy of retinoblastoma.

  16. Deregulation of the RB pathway in human testicular germ cell tumours

    DEFF Research Database (Denmark)

    Bartkova, Jirina; Lukas, Claudia; Sørensen, Claus S

    2003-01-01

    RB was expressed throughout adult spermatogenesis and was detectable in teratomas, but was absent or grossly reduced in carcinoma in situ (CIS) and most seminomas and embryonal carcinomas. Unexpectedly, we also found that pRB was absent from fetal human gonocytes, the candidate target cell for all types of TGCTs...

  17. The role of p53 and pRB in apoptosis and cancer

    DEFF Research Database (Denmark)

    Hickman, Emma S; Moroni, M Cristina; Helin, Kristian

    2002-01-01

    Loss of function of both the p53 pathway and the retinoblastoma protein (pRB) pathway plays a significant role in the development of most human cancers. Loss of pRB results in deregulated cell proliferation and apoptosis, whereas loss of p53 desensitizes cells to checkpoint signals, including...

  18. Immunohistochemical study of p53, pRb, p16 in esophageal cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zo, Jae Ill; Zo, Kyung Ja; Park, Jong Ho; Kim, Mi Hee [Korea Cancer Center Hospital, Seoul (Korea, Republic of)

    1998-01-01

    To confirm the expression of molecular genetic alterations of p53, pRb, p16 in esophageal cancer and to investigate the expression of p53, pRb, p16 in esophageal cancer according to the pathologic steps of carcinogenesis, immuno-histochemistry was performed in 15 resected esophageal cancer specimens with multiple separated lesions after pathologic mapping. The accumulation of mutant p53 was observed in 60 % of dysplasia and 47 % of invasive cancer, while pRb was not detected in 91 % of dysplasia and 72.7 % of invasive cancer. But p16 was not observed in 0 % in dysplasia and 7 % of invasive cancer. But p16 was not observed in 0 % in dysplasia and 28.6 % in invasive cancer. There was no simultaneous negative pRb and p16 expression. There was no relations between p53 and p16, pRb. As a results, the expression of p53, pRb, p16 was co-related well with molecular genetic changes and inactivation of p53, pRb, p16 was co-related well with molecular genetic changes and inactivation of p53 and pRb was common and early event in esophageal carcinogenesis in Korea, but inactivation of p16 was a infrequent change. (author). 17 refs., 2 tabs., 7 figs

  19. THE ROLE OF RECOMBINANT Rb GENE ADENOVIRUS VECTOR IN THE GROWTH OF LUNG ADENOCARCINOMA CELLS

    Institute of Scientific and Technical Information of China (English)

    Li Jian; Jiang Lei; Xia Yongjing; Li Hongxia; Hu Yajun; Hu Shixue; Xu Hongji

    1998-01-01

    Objective:To study the role of the most extensively studied tumor suppressor gene, retinoblastoma (Rb) gene,on the growth of lung adenocarcinoma cell line GLC-82 and explore a gene therapy approach for lung adenocarcinoma. Methods: The recombinant Rb gene adenovirus vector was constructed, the control virus which carries LacZ gene was producted by the same method. Infection effects were detected by biochemical staining of β-gal and immunohistochemical analysis of Rb protein. The Rb cDNA of infected cells were determined by PCR. The cell growth rate and cell cycle were observed by cell-counting and flow cytometry. Results: The constructed recombinant adenovirus vector could infect effectively the cells with high level expression of Rb cDNA and Rb protein. The transfection of wild-type Rb gene could suppress GLC-82 cell proliferation and decrease the cellular DNA synthesis. Conclusions: These results showed the possibility of using recombinant Rb gene adenovirus vector in the gene therapy of cancer to inhibit the growth of cancer.

  20. RB1CC1 Protein Suppresses Type II Collagen Synthesis in Chondrocytes and Causes Dwarfism*

    Science.gov (United States)

    Nishimura, Ichiro; Chano, Tokuhiro; Kita, Hiroko; Matsusue, Yoshitaka; Okabe, Hidetoshi

    2011-01-01

    RB1-inducible coiled-coil 1 (RB1CC1) functions in various processes, such as cell growth, differentiation, senescence, apoptosis, and autophagy. The conditional transgenic mice with cartilage-specific RB1CC1 excess that were used in the present study were made for the first time by the Cre-loxP system. Cartilage-specific RB1CC1 excess caused dwarfism in mice without causing obvious abnormalities in endochondral ossification and subsequent skeletal development from embryo to adult. In vitro and in vivo analysis revealed that the dwarf phenotype in cartilaginous RB1CC1 excess was induced by reductions in the total amount of cartilage and the number of cartilaginous cells, following suppressions of type II collagen synthesis and Erk1/2 signals. In addition, we have demonstrated that two kinds of SNPs (T-547C and C-468T) in the human RB1CC1 promoter have significant influence on the self-transcriptional level. Accordingly, human genotypic variants of RB1CC1 that either stimulate or inhibit RB1CC1 transcription in vivo may cause body size variations. PMID:22049074

  1. An accurate Rb density measurement method for a plasma wakefield accelerator experiment using a novel Rb reservoir

    Energy Technology Data Exchange (ETDEWEB)

    Öz, E.; Batsch, F.; Muggli, P.

    2016-09-01

    A method to accurately measure the density of Rb vapor is described. We plan on using this method for the Advanced Wakefield (AWAKE) (Assmann et al., 2014 [1]) project at CERN , which will be the world's first proton driven plasma wakefield experiment. The method is similar to the hook (Marlow, 1967 [2]) method and has been described in great detail in the work by Hill et al. (1986) [3]. In this method a cosine fit is applied to the interferogram to obtain a relative accuracy on the order of 1% for the vapor density–length product. A single-mode, fiber-based, Mach–Zenhder interferometer will be built and used near the ends of the 10 meter-long AWAKE plasma source to be able to make accurate relative density measurement between these two locations. This can then be used to infer the vapor density gradient along the AWAKE plasma source and also change it to the value desired for the plasma wakefield experiment. Here we describe the plan in detail and show preliminary results obtained using a prototype 8 cm long novel Rb vapor cell.

  2. An accurate Rb density measurement method for a plasma wakefield accelerator experiment using a novel Rb reservoir

    Science.gov (United States)

    Öz, E.; Batsch, F.; Muggli, P.

    2016-09-01

    A method to accurately measure the density of Rb vapor is described. We plan on using this method for the Advanced Wakefield (AWAKE) (Assmann et al., 2014 [1]) project at CERN , which will be the world's first proton driven plasma wakefield experiment. The method is similar to the hook (Marlow, 1967 [2]) method and has been described in great detail in the work by Hill et al. (1986) [3]. In this method a cosine fit is applied to the interferogram to obtain a relative accuracy on the order of 1% for the vapor density-length product. A single-mode, fiber-based, Mach-Zenhder interferometer will be built and used near the ends of the 10 meter-long AWAKE plasma source to be able to make accurate relative density measurement between these two locations. This can then be used to infer the vapor density gradient along the AWAKE plasma source and also change it to the value desired for the plasma wakefield experiment. Here we describe the plan in detail and show preliminary results obtained using a prototype 8 cm long novel Rb vapor cell.

  3. Blindness in children: a worldwide perspective

    Directory of Open Access Journals (Sweden)

    Clare Gilber

    2007-06-01

    Full Text Available Many of the causes of childhood blindness are avoidable, being either preventable or treatable. Only three per cent of the world's blind population are children. However, because children have a lifetime of blindness ahead of them, the number of ‘blind person years’ resulting from blindness starting in childhood is second only to cataract. Controlling blindness in children is a priority of VISION 20203,4; however, as its causes differ from that of blindness in adults, different strategies, personnel, infrastructure, and equipment are required to combat it. There is also a greater urgency when managing children, as delays in treatment can lead to amblyopia (lazy eye.

  4. Iconicity in Discourse: The Case of Repetition in Japanese.

    Science.gov (United States)

    Ishikawa, Minako

    This analysis of repeated utterances in Japanese conversational discourse focuses on repetition as an expression of iconicity. In the analysis of a 30-minute conversation among 4 Japanese speakers, the iconic meanings expressed by both reduplication and conversational repetition are highlighted. The iconicity characteristic of conversational data…

  5. Evidence-Based Behavioral Interventions for Repetitive Behaviors in Autism

    Science.gov (United States)

    Boyd, Brian A.; McDonough, Stephen G.; Bodfish, James W.

    2012-01-01

    Restricted and repetitive behaviors (RRBs) are a core symptom of autism spectrum disorders (ASD). There has been an increased research emphasis on repetitive behaviors; however, this research primarily has focused on phenomenology and mechanisms. Thus, the knowledge base on interventions is lagging behind other areas of research. The literature…

  6. Visual attention to advertising : The impact of motivation and repetition

    NARCIS (Netherlands)

    Pieters, RGM; Rosbergen, E; Hartog, M; Corfman, KP; Lynch, JG

    1996-01-01

    Using eye-tracking data, we examine the impact of motivation and repetition on visual attention to advertisements differing in argument quality. Our analyses indicate that repetition leads to an overall decrease in the amount of attention. However, while at first high motivation subjects attend to t

  7. On the Functions of Lexical Repetition in English Texts

    Institute of Scientific and Technical Information of China (English)

    XIAO Fuliang

    2016-01-01

    Lexical repetition, as a cohesive device of an English text, can help make up a cohesive and coherent text. Therefore, in English textual learning, it is helpful for students to know about different patterns and functions of lexical repetition to improve their English level and ability.

  8. Formation of ultracold LiRb molecules by photoassociation near the Li(2s 2S1/2) + Rb(5p 2P1/2) asymptote

    Science.gov (United States)

    Dutta, Sourav; Elliott, Daniel S.; Chen, Yong P.

    2013-12-01

    We report the production of ultracold 7Li85Rb molecules by photoassociation (PA) below the Li (2s 2S1/2) + Rb(5p 2P1/2) asymptote. We perform PA spectroscopy in a dual-species 7Li-85Rb magneto-optical trap (MOT) and detect the PA resonances using trap loss spectroscopy. We observe several strong PA resonances corresponding to the last few bound states, assign the lines and derive the long-range C6 dispersion coefficients for the Li (2s 2S1/2) + Rb(5p 2P1/2) asymptote. We also report an excited-state molecule formation rate (P_{\\textit{LiRb}}) of {\\sim}10^{7}\\ \\text{s}^{-1} and a PA rate coefficient (K_{PA}) of {\\sim}4\\times10^{-11}\\ \\text{cm}^3/\\text{s} , which are both among the highest observed for heteronuclear bi-alkali molecules. These suggest that PA is a promising route for the creation of ultracold ground-state LiRb molecules.

  9. Formation of ultracold LiRb molecules by photoassociation near the Li (2s 2S1/2) + Rb (5p 2P1/2) asymptote

    CERN Document Server

    Dutta, Sourav; Chen, Yong P

    2013-01-01

    We report the production of ultracold 7Li85Rb molecules by photoassociation (PA) below the Li (2s 2S1/2) + Rb (5p 2P1/2) asymptote. We perform PA spectroscopy in a dual-species 7Li-85Rb magneto-optical trap (MOT) and detect the PA resonances using trap loss spectroscopy. We observe several strong PA resonances corresponding to the last few bound states, assign the lines and derive the long range C6 dispersion coefficients for the Li (2s 2S1/2) + Rb (5p 2P1/2) asymptote. We also report an excited-state molecule formation rate (P_LiRb) of ~10^7 s^-1 and a PA rate coefficient (K_PA) of ~4x10^-11 cm^3/s, which are both among the highest observed for heteronuclear bi-alkali molecules. These suggest that PA is a promising route for the creation of ultracold ground state LiRb molecules.

  10. New molybdenum(VI) phosphates: synthesis, characterization, and calculations of centrosymmetric RbMoO2PO4 and noncentrosymmetric Rb4Mo5P2O22.

    Science.gov (United States)

    Wang, Ying; Pan, Shilie; Su, Xin; Yang, Zhihua; Dong, Lingyun; Zhang, Min

    2013-02-04

    Two new molybdenum(VI) phosphates, RbMoO(2)PO(4) and Rb(4)Mo(5)P(2)O(22), have been synthesized by standard solid-state reactions, and their structures were determined by single-crystal X-ray diffraction. The former is centrosymmetric, whereas the latter is noncentrosymmetric and chiral. Their crystal structures both consist of corner- and edge-shared MoO(6) octahedra, PO(4) tetrahedra, and RbO(n) (n = 8 or 10) polyhedra and exhibit three- and one-dimensional structures, respectively. Powder second-harmonic generation (SHG) measurements revealed an SHG efficiency of approximately 1.4 × KH(2)PO(4) (KDP) for Rb(4)Mo(5)P(2)O(22). Thermal analysis, infrared and UV-vis-NIR diffuse reflectance spectroscopy, and electronic band structure calculations were also performed on the reported materials. Crystal data are the following: RbMoO(2)PO(4), orthorhombic, space group Fddd (No. 70), a = 11.012(5) Å, b = 12.403(5) Å, c = 15.839(7) Å, V = 2163.3(16) Å(3), and Z = 16; Rb(4)Mo(5)P(2)O(22), orthorhombic, space group C222(1) (No. 20), a = 6.5300(5) Å, b = 19.7834(18) Å, c = 17.3451(15) Å, V = 2240.7(3) Å(3), and Z = 4.

  11. Biotransformation of ginsenosides Rb1, Rg3 and Rh2 in rat gastrointestinal tracts

    Directory of Open Access Journals (Sweden)

    Qian Tianxiu

    2010-05-01

    Full Text Available Abstract Background Ginsenosides such as Rb1, Rg3 and Rh2 are major bioactive components of Panax ginseng. This in vivo study investigates the metabolic pathways of ginsenosides Rb1, Rg3 and Rh2 orally administered to rats. Methods High performance liquid chromatography-mass spectrometry (LC-MS and tandem mass spectrometry (MS-MS techniques, particularly liquid chromatography electrospray ionization mass spectrometry (LC-ESI-MS, were used to identify the metabolites. Results Six metabolites of Rb1, six metabolites of Rg3 and three metabolites of Rh2 were detected in the feces samples of the rats. Rh2 was a metabolite of Rb1 and Rg3, whereas Rg3 was a metabolite of Rb1. Some metabolites such as protopanaxadiol and monooxygenated protopanaxadiol are metabolites of all three ginsenosides. Conclusion Oxygenation and deglycosylation are two major metabolic pathways of the ginsenosides in rat gastrointestinal tracts.

  12. Electric field cancellation on quartz by Rb adsorbate-induced negative electron affinity

    Science.gov (United States)

    Shaffer, James

    2016-05-01

    We investigate the (0001) surface of single crystal quartz with a submonolayer of Rb adsorbates. Using Rydberg atom electromagnetically induced transparency, we investigate the electric fields resulting from Rb adsorbed on the quartz surface, and measure the activation energy of the Rb adsorbates. We show that the adsorbed Rb induces a negative electron affinity (NEA) on the quartz surface. The NEA surface allows low energy electrons to bind to the surface and cancel the electric field from the Rb adsorbates. Our results are important for integrating Rydberg atoms into hybrid quantum systems and the fundamental study of atom-surface interactions, as well as applications for electrons bound to a 2D surface. This work was supported by the DARPA Quasar program by a Grant through ARO (60181-PH-DRP) and the AFOSR (FA9550-12-1-0282),.

  13. Ultralong-Range Rb-KRb Rydberg Molecules: Selected Aspects of Electronic Structure, Orientation and Alignment

    Science.gov (United States)

    Aguilera-Fernández, Javier; Sadeghpour, H. R.; Schmelcher, Peter; González-Férez, Rosario

    2015-09-01

    We investigate the structure and features of an ultralong-range triatomic Rydberg molecule formed by a Rb Rydberg atom and a KRb diatomic molecule. In our numerical description, we perform a realistic treatment of the internal rotational motion of the diatomic molecule, and take into account the Rb(n, l ≥ 3) Rydberg degenerate manifold and the energetically closest neighboring levels with principal quantum numbers n' > n and orbital quantum number l ≤ 2. We focus here on the adiabatic electronic potentials evolving from the Rb(n,l ≥ 3) and Rb(n = 26, l = 2) manifolds. The directional properties of the KRb diatomic molecule within the Rb-KRb triatomic Rydberg molecule are also analyzed in detail.

  14. Immiscibility in a Quantum Degenerate Mixture of $^{87}$Rb and $^{133}$Cs

    CERN Document Server

    McCarron, D J; Jenkin, D L; Köppinger, M P; Cornish, S L

    2011-01-01

    We report a new method for the production of Bose-Einstein condensates of $^{133}$Cs and demonstrate the formation of a quantum degenerate mixture of $^{87}$Rb and $^{133}$Cs. The approach exploits efficient sympathetic cooling of $^{133}$Cs via $^{87}$Rb in a magnetic quadrupole trap prior to further evaporative cooling in a levitated optical trap. Sacrificing all the $^{87}$Rb during the cooling, we create single species $^{133}$Cs condensates of up to $6\\times10^{4}$ atoms. Tailoring the evaporation to retain some $^{87}$Rb, we simultaneously create condensates of $^{87}$Rb and $^{133}$Cs in the same trapping potential, each containing up to $2\\times10^{4}$ atoms. We observe a striking phase separation of the two species revealing the mixture to be immiscible due to strong repulsive interspecies interactions.

  15. Studies of rubidium selenate with secondary phase of RbOH under humidified reducing atmosphere

    DEFF Research Database (Denmark)

    Beyribey, Berceste; Hallinder, Jonathan; Poulsen, Finn Willy;

    2012-01-01

    The high temperature properties of Rb2SeO4 have been studied by calorimetry, impedance spectroscopy and X-ray powder diffraction. As synthesized, Rb2SeO4 includes a second phase of Rb2SeO3, which can be eliminated upon heating the compound. As expected, no conductivity is observed in dry (pH2O ....001 bar) air. By changing to humidified (pH2O = 0.1 bar) air at 176 deg. C, the conductivity increases sharply from 8.6·10-8 to 1.7·10-6 S cm-1. Under humidified (pH2O = 0.1 bar) reducing atmosphere (9%H2 in N2), the conductivity increases to 2.0·10-4 S cm-1 at 317 C. Degradation of Rb2SeO3 and Rb2SeO4...

  16. Ultralong-Range Rb-KRb Rydberg Molecules: Selected Aspects of Electronic Structure, Orientation and Alignment

    CERN Document Server

    Aguilera-Fernández, Javier; Schmelcher, Peter; González-Férez, Rosario

    2015-01-01

    We investigate the structure and features of an ultralong-range triatomic Rydberg molecule formed by a Rb Rydberg atom and a KRb diatomic molecule. In our numerical description, we perform a realistic treatment of the internal rotational motion of the diatomic molecule, and take into account the Rb($n, l\\ge 3$) Rydberg degenerate manifold and the energetically closest neighboring levels with principal quantum numbers $n'>n$ and orbital quantum number $l\\le2$. We focus here on the adiabatic electronic potentials evolving from the Rb($n, l\\ge 3$) and Rb($n=26, l=2$) manifolds. The directional properties of the KRb diatomic molecule within the Rb-KRb triatomic Rydberg molecule are also analyzed in detail.

  17. Repetitive DNA Sequences in Wheat and Its Relatives

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xue-yong; LI Da-yong

    2001-01-01

    Repetitive DNA sequences form a large portion of eukaryote genomes. Using wheat ( Triticum )as a model, the classification, features and functions of repetitive DNA sequences in the Tritieeae grass tribe is reviewed as well as the role of these sequences in genome differentiation, control and regulation of homologous chromosome synapsis and pairing. Transposable elements, as an important portion of dispersed repetitives,may play an essential role in gene mutation of the host. Dynamic models for change of copy number and sequences of the repetitive family are also presented after the models of Charlesworth et al. Application of repetitive DNA sequences in the study of evolution, chromosome fingerprinting and marker assisted gene transfer and breeding are described by taking wheat as an example.

  18. Nonword Repetition and Speech Motor Control in Children

    Directory of Open Access Journals (Sweden)

    Christina Reuterskiöld

    2015-01-01

    Full Text Available This study examined how familiarity of word structures influenced articulatory control in children and adolescents during repetition of real words (RWs and nonwords (NWs. A passive reflective marker system was used to track articulator movement. Measures of accuracy were obtained during repetition of RWs and NWs, and kinematic analysis of movement duration and variability was conducted. Participants showed greater consonant and vowel accuracy during RW than NW repetition. Jaw movement duration was longer in NWs compared to RWs across age groups, and younger children produced utterances with longer jaw movement duration compared to older children. Jaw movement variability was consistently greater during repetition of NWs than RWs in both groups of participants. The results indicate that increases in phonological short-term memory demands affect articulator movement. This effect is most pronounced in younger children. A range of skills may develop during childhood, which supports NW repetition skills.

  19. Soliton repetition rate in a silicon-nitride microresonator

    CERN Document Server

    Bao, Chengying; Wang, Cong; Jaramillo-Villegas, Jose A; Leaird, Daniel E; Qi, Minghao; Weiner, Andrew M

    2016-01-01

    The repetition rate of a Kerr comb comprising a single soliton in an anomalous dispersion silicon nitride microcavity is measured as a function of pump frequency tuning. The contributions from the Raman soliton self-frequency shift (SSFS) and from thermal effects are evaluated both experimentally and theoretically; the SSFS is found to dominate the changes in repetition rate. The relationship between the changes in repetition rate and pump frequency detuning is found to be independent of the nonlinearity coefficient and dispersion of the cavity. Modeling of the repetition rate change by using the generalized Lugiato-Lefever equation is discussed; the Kerr shock is found to have only a minor effect on repetition rate for cavity solitons with duration down to ~50 fs.

  20. Transgenerational effects of environmental enrichment on repetitive motor behavior development.

    Science.gov (United States)

    Bechard, Allison R; Lewis, Mark H

    2016-07-01

    The favorable consequences of environmental enrichment (EE) on brain and behavior development are well documented. Much less is known, however, about transgenerational benefits of EE on non-enriched offspring. We explored whether transgenerational effects of EE might extend to the development of repetitive motor behaviors in deer mice. Repetitive motor behaviors are invariant patterns of movement that, across species, can be reduced by EE. We found that EE not only attenuated the development of repetitive behavior in dams, but also in their non-enriched offspring. Moreover, maternal behavior did not seem to mediate the transgenerational effect we found, although repetitive behavior was affected by reproductive experience. These data support a beneficial transgenerational effect of EE on repetitive behavior development and suggest a novel benefit of reproductive experience.

  1. Soliton repetition rate in a silicon-nitride microresonator.

    Science.gov (United States)

    Bao, Chengying; Xuan, Yi; Wang, Cong; Jaramillo-Villegas, Jose A; Leaird, Daniel E; Qi, Minghao; Weiner, Andrew M

    2017-02-15

    The repetition rate of a Kerr comb composed of a single soliton in an anomalous group velocity dispersion silicon-nitride microcavity is measured as a function of pump frequency. By comparing operation in the soliton and non-soliton states, the contributions from the Raman soliton self-frequency shift (SSFS) and the thermal effects are evaluated; the SSFS is found to dominate the changes in the repetition rate, similar to silica cavities. The relationship between the changes in the repetition rate and the pump frequency detuning is found to be independent of the nonlinearity coefficient and dispersion of the cavity. Modeling of the repetition rate change by using the generalized Lugiato-Lefever equation is discussed; the Kerr shock is found to have only a minor effect on repetition rate for cavity solitons with duration down to ∼50  fs.

  2. Self-controlled KR schedules: does repetition order matter?

    Science.gov (United States)

    Patterson, Jae T; Carter, Michael J; Hansen, Steve

    2013-08-01

    The impact of an experimenter-defined repetition schedule on the utility of a self-controlled KR context during motor skill acquisition was examined. Participants were required to learn three novel spatial-temporal tasks in either a random or blocked repetition schedule with or without the opportunity to control their KR. Results from the retention period showed that participants provided control over their KR schedule in a random repetition schedule demonstrated superior learning. However, performance measures from the transfer test showed that, independent of repetition schedule, learners provided the opportunity to control their KR schedule demonstrated superior transfer performance compared to their yoked counterparts. The dissociated impact of repetition schedule and self-controlled KR schedules on retention and transfer is discussed.

  3. Impaired speech repetition and left parietal lobe damage.

    Science.gov (United States)

    Fridriksson, Julius; Kjartansson, Olafur; Morgan, Paul S; Hjaltason, Haukur; Magnusdottir, Sigridur; Bonilha, Leonardo; Rorden, Christopher

    2010-08-18

    Patients with left hemisphere damage and concomitant aphasia usually have difficulty repeating others' speech. Although impaired speech repetition, the primary symptom of conduction aphasia, has been associated with involvement of the left arcuate fasciculus, its specific lesion correlate remains elusive. This research examined speech repetition among 45 stroke patients who underwent aphasia testing and MRI examination. Based on lesion-behavior mapping, the primary structural damage most closely associated with impaired speech repetition was found in the posterior portion of the left arcuate fasciculus. However, perfusion-weighted MRI revealed that tissue dysfunction, in the form of either frank damage or hypoperfusion, to the left inferior parietal lobe, rather than the underlying white matter, was associated with impaired speech repetition. This latter result suggests that integrity of the left inferior parietal lobe is important for speech repetition and, as importantly, highlights the importance of examining cerebral perfusion for the purpose of lesion-behavior mapping in acute stroke.

  4. Repetition and Emotive Communication in Music Versus Speech

    Directory of Open Access Journals (Sweden)

    Elizabeth Hellmuth eMargulis

    2013-04-01

    Full Text Available Music and speech are often placed alongside one another as comparative cases. Their relative overlaps and disassociations have been well explored (e.g. Patel, 2010. But one key attribute distinguishing these two domains has often been overlooked: the greater preponderance of repetition in music in comparison to speech. Recent fMRI studies have shown that familiarity – achieved through repetition – is a critical component of emotional engagement with music (Pereira et al., 2011. If repetition is fundamental to emotional responses to music, and repetition is a key distinguisher between the domains of music and speech, then close examination of the phenomenon of repetition might help clarify the ways that music elicits emotion differently than speech.

  5. Physical Characteristics Underpinning Repetitive Lunging in Fencing.

    Science.gov (United States)

    Turner, Anthony N; Marshall, Geoff; Phillips, James; Noto, Angelo; Buttigieg, Conor; Chavda, Shyam; Downing, William; Atlay, Nathan; Dimitriou, Lygeri; Kilduff, Laim

    2016-11-01

    Turner, AN, Marshall, G, Phillips, J, Noto, A, Buttigieg, C, Chavda, S, Downing, W, Atlay, N, Dimitriou, L, and Kilduff, L. Physical characteristics underpinning repetitive lunging in fencing. J Strength Cond Res 30(11): 3134-3139, 2016-Given the repetitive demand to execute lunging and changes in direction within fencing, the ability to sustain these at maximal capacity is fundamental to performance. The aim of this study was threefold. First, to provide normative values for this variable referred to as repeat lunge ability (RLA) and second to identify the physical characteristics that underpin it. Third, was to establish if a cause and effect relationship existed by training the associated characteristics. Assessment of lower-body power, reactive strength, speed, change of direction speed (CODS), and a sport-specific RLA were conducted on senior and junior elite male fencers (n = 36). Fencers were on average (±SD) 18.9 ± 3.2 years of age, 174.35 ± 10.42 cm tall, 70.67 ± 7.35 kg in mass, and 8.5 ± 4.2 years fencing experience. The RLA test had average work times of 16.03 ± 1.40 seconds and demonstrated "large" to "very large" associations with all tested variables, but in particular CODS (r = 0.70) and standing broad jump (SBJ; r = -0.68). Through linear regression analysis, these also provided a 2-predictor model accounting for 61% of the common variance associated with RLA. A cause and effect relationship with SBJ and CODS was confirmed by the training group, where RLA performance in these fencers improved from 15.80 ± 1.07 to 14.90 ± 0.86 seconds, with the magnitude of change reported as "moderate" (effect size (ES) = 0.93). Concurrent improvements were also noted in both SBJ (216.86 ± 17.15 vs. 221.71 ± 17.59 cm) and CODS (4.44 ± 0.29 vs. 4.31 ± 0.09 seconds) and while differences were only significant in SBJ, magnitudes of change were classed as "small" (ES = 0.28) and "moderate" (ES = 0.61), respectively. In conclusion, to improve RLA strength

  6. Multiframe Blind Super Resolution Imaging Based on Blind Deconvolution

    Institute of Scientific and Technical Information of China (English)

    元伟; 张立毅

    2016-01-01

    As an ill-posed problem, multiframe blind super resolution imaging recovers a high resolution image from a group of low resolution images with some degradations when the information of blur kernel is limited. Note that the quality of the recovered image is influenced more by the accuracy of blur estimation than an advanced regularization. We study the traditional model of the multiframe super resolution and modify it for blind deblurring. Based on the analysis, we proposed two algorithms. The first one is based on the total variation blind deconvolution algorithm and formulated as a functional for optimization with the regularization of blur. Based on the alternating minimization and the gradient descent algorithm, the high resolution image and the unknown blur kernel are esti-mated iteratively. By using the median shift and add operator, the second algorithm is more robust to the outlier influence. The MSAA initialization simplifies the interpolation process to reconstruct the blurred high resolution image for blind deblurring and improves the accuracy of blind super resolution imaging. The experimental results demonstrate the superiority and accuracy of our novel algorithms.

  7. Absence of pRb facilitates E2F1-induced apoptosis in breast cancer cells.

    Science.gov (United States)

    Sun, Baohua; Wingate, Hannah; Swisher, Stephen G; Keyomarsi, Khandan; Hunt, Kelly K

    2010-03-15

    The transcription factor E2F1 is known for its interaction with pRb, controlling cell proliferation; however, E2F1 also has a pivotal role in regulating apoptosis.  The relationship between pRb and E2F1 balances cell proliferation and apoptosis giving pRb tumor suppressive properties. The intricacies of the pRb/E2F1 relationship and thus the regulation of cell fate is cell context dependent. To explore the role of pRb in the E2F1-induced apoptosis of human breast cancer cells, we examined cell growth and apoptosis induction in isogenic cell systems of immortalized breast epithelial cells lacking either pRb (76NE7) or p53 (76NE6). We found that E2F1 caused accumulation of cells in G2 and S phases of the cell cycle along with apoptosis in 76NE7 but not 76NE6 cells.  Variants of 76NE6 cells with functional p53 did not rescue the apoptotic response in these cells, whereas knocking down pRb resulted in significant E2F1-induced apoptosis. We also determined that the effect of E2F1 overexpression in two breast cancer cell lines, MDA-MB-436 and MDA-MB-468, which lack pRb and functional p53, was accumulation of cells in G2/S phase and apoptosis. However, E2F did not cause apotosis  in MCF-7 cells which harbor a functional pRb. Therefore, we conclude that in the absence of Rb, E2F1 overexpression results in apoptosis, not proliferation, and that this effect is independent of p53.

  8. Deficiency of pRb family proteins and p53 in invasive urothelial tumorigenesis.

    Science.gov (United States)

    He, Feng; Mo, Lan; Zheng, Xiao-Yong; Hu, Changkun; Lepor, Herbert; Lee, Eva Y-H P; Sun, Tung-Tien; Wu, Xue-Ru

    2009-12-15

    Defects in pRb tumor suppressor pathway occur in approximately 50% of the deadly muscle-invasive urothelial carcinomas in humans and urothelial carcinoma is the most prevalent epithelial cancer in long-term survivors of hereditary retinoblastomas caused by loss-of-function RB1 mutations. Here, we show that conditional inactivation of both RB1 alleles in mouse urothelium failed to accelerate urothelial proliferation. Instead, it profoundly activated the p53 pathway, leading to extensive apoptosis, and selectively induced pRb family member p107. Thus, pRb loss triggered multiple fail-safe mechanisms whereby urothelial cells evade tumorigenesis. Additional loss of p53 in pRb-deficient urothelial cells removed these p53-dependent tumor barriers, resulting in late-onset hyperplasia, umbrella cell nuclear atypia, and rare-occurring low-grade, superficial papillary bladder tumors, without eliciting invasive carcinomas. Importantly, mice deficient in both pRb and p53, but not those deficient in either protein alone, were highly susceptible to subthreshold carcinogen exposure and developed invasive urothelial carcinomas that strongly resembled the human counterparts. The invasive lesions had a marked reduction of p107 but not p130 of the pRb family. Our data provide compelling evidence, indicating that urothelium, one of the slowest cycling epithelia, is remarkably resistant to transformation by pRb or p53 deficiency; that concurrent loss of these two tumor suppressors is necessary but insufficient to initiate urothelial tumorigenesis along the invasive pathway; that p107 may play a critical role in suppressing invasive urothelial tumor formation; and that replacing/restoring the function of pRb, p107, or p53 could be explored as a potential therapeutic strategy to block urothelial tumor progression.

  9. Experimental Model to Study the Role of Retinoblastoma Gene Product (pRb) for Determination of Adipocyte Differentiation.

    Science.gov (United States)

    Popov, B V; Shilo, P S; Zhidkova, O V; Zaichik, A M; Petrov, N S

    2015-06-01

    Using stable constitutive expression of retinoblastoma gene product (pRb) in polypotent mesenchymal 10T1/2 cells we obtained stable cell lines hyperexpressing functionally active or inactive mutant pRb. The cells producing active exogenous pRb demonstrated high sensitivity to adipocyte differentiation inductors, whereas production of inactive form of the exogenous protein suppressed adipocyte differentiation. The obtained lines can serve as the experimental model for studying the role of pRb in determination of adipocyte differentiation.

  10. Generation of low-timing-jitter femtosecond pulse trains with 2 GHz repetition rate via external repetition rate multiplication.

    Science.gov (United States)

    Chen, Jian; Sickler, Jason W; Fendel, Peter; Ippen, Erich P; Kärtner, Franz X; Wilken, Tobias; Holzwarth, Ronald; Hänsch, Theodor W

    2008-05-01

    Generation of low-timing-jitter 150 fs pulse trains at 1560 nm with 2 GHz repetition rate is demonstrated by locking a 200 MHz fundamental polarization additive-pulse mode-locked erbium fiber laser to high-finesse external Fabry-Perot cavities. The timing jitter and relative intensity noise of the repetition-rate multiplied pulse train are investigated.

  11. [Rehabilitation Using Repetitive Transcranial Magnetic Stimulation].

    Science.gov (United States)

    Takeuchi, Naoyuki; Izumi, Shin-Ichi

    2017-03-01

    Various novel stroke rehabilitative methods have been developed based on findings in basic science and clinical research. Recently, many reports have shown that repetitive transcranial magnetic stimulation (rTMS) improves function in stroke patients by altering the excitability of the human cortex. The interhemispheric competition model proposes that deficits in stroke patients are due to reduced output from the affected hemisphere and excessive interhemispheric inhibition from the unaffected hemisphere to the affected hemisphere. The interhemispheric competition model indicates that improvement in deficits can be achieved either by increasing the excitability of the affected hemisphere using excitatory rTMS or by decreasing the excitability of the unaffected hemisphere using inhibitory rTMS. Recovery after stroke is related to neural plasticity, which involves developing new neural connections, acquiring new functions, and compensating for impairments. Artificially modulating the neural network by rTMS may induce a more suitable environment for use-dependent plasticity and also may interfere with maladaptive neural activation, which weakens function and limits recovery. There is potential, therefore, for rTMS to be used as an adjuvant therapy for developed neurorehabilitation techniques in stroke patients.

  12. SI Engine with repetitive NS spark plug

    Science.gov (United States)

    Pancheshniy, Sergey; Nikipelov, Andrey; Anokhin, Eugeny; Starikovskiy, Andrey; Laplase Team; Mipt Team; Pu Team

    2013-09-01

    Now de-facto the only technology for fuel-air mixtures ignition in IC engines exists. It is a spark discharge of millisecond duration in a short discharge gap. The reason for such a small variety of methods of ignition initiation is very specific conditions of the engine operation. First, it is very high-pressure of fuel-air mixture - from 5-7 atmospheres in old-type engines and up to 40-50 atmospheres on the operating mode of HCCI. Second, it is a very wide range of variation of the oxidizer/fuel ratio in the mixture - from almost stoichiometric (0.8-0.9) at full load to very lean (φ = 0.3-0.5) mixtures at idle and/or economical cruising mode. Third, the high velocity of the gas in the combustion chamber (up to 30-50 m/s) resulting in a rapid compression of swirling inlet flow. The paper presents the results of tests of distributed spark ignition system powered by repetitive pulse nanosecond discharge. Dynamic pressure measurements show the increased pressure and frequency stability for nanosecond excitation in comparison with the standard spark plug. Excitation by single nanosecond high-voltage pulse and short train of pulses was examined. In all regimes the nanosecond pulsed excitation demonstrate a better performance.

  13. Repetitive transcranial magnetic stimulation and drug addiction.

    Science.gov (United States)

    Barr, Mera S; Farzan, Faranak; Wing, Victoria C; George, Tony P; Fitzgerald, Paul B; Daskalakis, Zafiris J

    2011-10-01

    Repetitive transcranial magnetic stimulation (rTMS) is a non-invasive brain stimulation technique that is now being tested for its ability to treat addiction. This review discusses current research approaches and results of studies which measured the therapeutic use of rTMS to treat tobacco, alcohol and illicit drug addiction. The research in this area is limited and therefore all studies evaluating the therapeutic use of rTMS in tobacco, alcohol or illicit drug addiction were retained including case studies through NCBI PubMed ( http://www.ncbi.nlm.nih.gov ) and manual searches. A total of eight studies were identified that examined the ability of rTMS to treat tobacco, alcohol and cocaine addiction. The results of this review indicate that rTMS is effective in reducing the level of cravings for smoking, alcohol, and cocaine when applied at high frequencies to the dorsolateral prefrontal cortex (DLPFC). Furthermore, these studies suggest that repeated sessions of high frequency rTMS over the DLPFC may be most effective in reducing the level of smoking and alcohol consumption. Although work in this area is limited, this review indicates that rTMS is a promising modality for treating drug addiction.

  14. Development of a repetitive compact torus injector

    Science.gov (United States)

    Onchi, Takumi; McColl, David; Dreval, Mykola; Rohollahi, Akbar; Xiao, Chijin; Hirose, Akira; Zushi, Hideki

    2013-10-01

    A system for Repetitive Compact Torus Injection (RCTI) has been developed at the University of Saskatchewan. CTI is a promising fuelling technology to directly fuel the core region of tokamak reactors. In addition to fuelling, CTI has also the potential for (a) optimization of density profile and thus bootstrap current and (b) momentum injection. For steady-state reactor operation, RCTI is necessary. The approach to RCTI is to charge a storage capacitor bank with a large capacitance and quickly charge the CT capacitor bank through a stack of integrated-gate bipolar transistors (IGBTs). When the CT bank is fully charged, the IGBT stack will be turned off to isolate banks, and CT formation/acceleration sequence will start. After formation of each CT, the fast bank will be replenished and a new CT will be formed and accelerated. Circuits for the formation and the acceleration in University of Saskatchewan CT Injector (USCTI) have been modified. Three CT shots at 10 Hz or eight shots at 1.7 Hz have been achieved. This work has been sponsored by the CRC and NSERC, Canada.

  15. Short-range photoassociation of LiRb

    Science.gov (United States)

    Blasing, D. B.; Stevenson, I. C.; Pérez-Ríos, J.; Elliott, D. S.; Chen, Y. P.

    2016-12-01

    We have observed short-range photoassociation of 7Li85Rb to the two lowest vibrational states of the d 3Π potential. We have also observed several a3Σ+ vibrational levels with generation rates between ˜102 and ˜103 molecules per second, resulting from the spontaneous decay of these d 3Π molecules. We observe an alternation of the peak heights in the rotational photoassociation spectrum that depends on the parity of the excited molecular state. Franck-Condon overlap calculations predict that photoassociation to higher vibrational levels of the d 3Π potential, in particular, the sixth vibrational level, should populate the lowest vibrational level of the a 3Σ+ state at a rate as high as 104 molecules per second. This work also motivates an experimental search for short-range photoassociation to other bound molecular states, such as c 3Σ+ or b 3Π , as prospects for preparing ground-state molecules.

  16. Formation of ultracold NaRb Feshbach molecules

    Science.gov (United States)

    Wang, Fudong; He, Xiaodong; Li, Xiaoke; Zhu, Bing; Chen, Jun; Wang, Dajun

    2015-03-01

    We report the creation of ultracold bosonic 23Na87Rb Feshbach molecules via magneto-association. By ramping the magnetic field across an interspecies Feshbach resonance (FR), at least 4000 molecules can be produced out of the near degenerate ultracold mixture. Fast loss due to inelastic atom-molecule collisions is observed, which limits the pure molecule number, after residual atoms removal, to 1700. The pure molecule sample can live for 21.8(8) ms in the optical trap, long enough for future molecular spectroscopy studies toward coherently transferring to the singlet ro-vibrational ground state, where these molecules are stable against chemical reaction and have a permanent electric dipole moment of 3.3 Debye. We have also measured the Feshbach molecule’s binding energy near the FR by the oscillating magnetic field method and found these molecules have a large closed-channel fraction.

  17. Formation of Ultracold NaRb Feshbach Molecules

    CERN Document Server

    Wang, Fudong; Li, Xiaoke; Zhu, Bing; Chen, Jun; Wang, Dajun

    2015-01-01

    We report the creation of ultracold bosonic $^{23}$Na$^{87}$Rb Feshbach molecules via magneto-association. By ramping the magnetic field across an interspecies Feshbach resonance, at least 4000 molecules can be produced out of the near degenerate ultracold mixture. Fast loss due to inelastic atom-molecule collisions is observed, which limits the pure molecule number, after residual atoms removal, to 1700. The pure molecule sample can live for 21.8(8) ms in the optical trap, long enough for future molecular spectroscopy studies toward coherently transferring to the singlet ro-vibrational ground state, where these molecules are stable against chemical reaction and have a permanent electric dipole moment of 3.3 Debye. We have also measured the Feshbach molecule's binding energy near the Feshbach resonance by the oscillating magnetic field method and found these molecules have a large closed-channel fraction.

  18. Radiative Decay of Proton Colliding with Rb at Low Energies

    Institute of Scientific and Technical Information of China (English)

    ZHOU Yu; QU Yi-Zhi; LIU Chun-Hua; LIU Xiao-Ju

    2011-01-01

    The radiative decay and radiative charge transfer cross sections for H++Rb(5s) collisions are calculated by using the optical potential approach, the semiclassical and the fully quantum-mechanical methods, respectively, for the energy range 10-6-10eV. The radiative association cross sections are obtained by the cross section differences between the radiative decay and radiative charge transfer processes. The relevant molecular data are calculated from the multi-reference single- and double-excitation configuration interaction approach. The emission spectra at resonant and non-resonant energies are analyzed, then the isolated sharp and broad resonances can be identified by their rotational and vibration quantum numbers.

  19. Blackbody radiation shift in 87Rb frequency standard

    CERN Document Server

    Safronova, M S; Safronova, U I

    2010-01-01

    The operation of atomic clocks is generally carried out at room temperature, whereas the definition of the second refers to the clock transition in an atom at absolute zero. This implies that the clock transition frequency should be corrected in practice for the effect of finite temperature of which the leading contributor is the blackbody radiation (BBR) shift. Experimental measurements of the BBR shifts are difficult. In this work, we have calculated the blackbody radiation shift of the ground-state hyperfine microwave transition in 87Rb using the relativistic all-order method and carried out detailed evaluation of the accuracy of our final value. Particular care is taken to accurately account for the contributions from highly-excited states. Our predicted value for the Stark coefficient, k_S=-1.240(4)\\times 10^{-10}\\text{Hz/(V/m)}^{2} is three times more accurate than the previous calculation [1].

  20. Preparation of Cs-Rb-V series sulphuric acid catalyst

    Institute of Scientific and Technical Information of China (English)

    陈振兴; 杨刚; 叶华

    2001-01-01

    Cs-Rb-V series low temperature sulphuric acid catalyst was prepared for the first time by using carbonized mother liquor containing alkali-metal salts. The results show that the conversion of SO2 on catalyst prepared directly with carbonized mother liquor could reach to 24.8% at 410℃. If n(Na)/n(V) was adjusted properly, the conversion of SO2 could be increased to 35.6% at 410℃. Refined carbonized mother liquor could make the catalytic activity even higher at low temperature, the conversion of SO2 could be increased to 36.65% at 410℃. The catalyst was examined with differential thermal analysis. It was found that both endothermic peaks and exothermic peaks of catalyst shifted forward obviously and the catalyst possessed higher activity at low temperature.

  1. Enhanced frequency up-conversion in Rb vapor

    CERN Document Server

    Vernier, A; Riis, E; Arnold, A S

    2009-01-01

    We demonstrate highly efficient generation of coherent 420 nm light via up-conversion of near-infrared lasers in a hot rubidium vapor cell. By optimizing pump polarizations and frequencies we achieve a single-pass conversion efficiency of 260%/W, significantly higher than in previous experiments. A full 2D exploration of the coherent light generation and fluorescence as a function of the pump frequencies reveals that coherent blue light is generated at 85Rb two-photon resonances, as predicted by theory, but at high vapor pressure it is suppressed in spectral regions that don't support phase matching or exhibit single-photon Kerr refraction. Favorable scaling of our current 1 mW blue beam power with additional pump power is predicted. Infrared pump polarization could be used for future intensity switching experiments.

  2. Racing to block tumorigenesis after pRb loss: an innocuous point mutation wins with synthetic lethality.

    Science.gov (United States)

    Bauzon, Frederick; Zhu, Liang

    2010-06-01

    A major goal of tumor suppressor research is to neutralize the tumorigenic effects of their loss. Since loss of pRb does not induce tumorigenesis in many types of cells, natural mechanisms may neutralize the tumorigenic effects of pRb loss in these cells. For susceptible cells, neutralizing the tumorigenic effects of pRb loss could logically be achieved by correcting the deregulated activities of pRb targets to render pRb-deficient cells less abnormal. This line of research has unexpectedly revealed that knocking out the pRb target Skp2 did not render Rb1 deficient cells less abnormal but, rather, induced apoptosis in them, thereby completely blocking tumorigenesis in Rb1+/- mice and after targeted deletion of Rb1 in pituitary intermediate lobe (IL). Skp2 is a substrate-recruiting component of the SCFSkp2 E3 biquitin ligase; one of its substrates is Thr187-phosphorylated p27Kip1. A p27T187A knockin (KI) mutation phenocopied Skp2 knockout (KO) in inducing apoptosis following Rb1 loss. Thus, Skp2 KO or p27T187A KI are synthetic lethal with pRb inactivation. Since homozygous p27T187A KI mutations show no adverse effects in mice, inhibiting p27T187 phosphorylation or p27T187p ubiquitination could be a highly therapeutic and minimally toxic intervention strategy for pRb deficiency-induced tumorigenesis.

  3. pRB and E2F4 play distinct cell-intrinsic roles in fetal erythropoiesis.

    Science.gov (United States)

    Zhang, Jing; Lee, Eunice Y; Liu, Yangang; Berman, Seth D; Lodish, Harvey F; Lees, Jacqueline A

    2010-01-15

    The retinoblastoma tumor suppressor protein pRB functions, at least in part, by directly binding to and modulating the activity of the E2F transcription factors. Previous studies have shown that both E2F4 and pRB play important roles in fetal erythropoiesis. Given that these two proteins interact directly we investigated the overlap of E2F4 and pRB function in this process by analyzing E2f4(-/-), conditional Rb knockout (Rb(1lox/1lox)), and compound E2f4(-/-);Rb(1lox/1lox) embryos. At E15.5 E2f4(-/-) and Rb(1lox/1lox) fetal erythroid cells display distinct abnormalities in their differentiation profiles. When cultured in vitro, both E2f4(-/-) and Rb(1lox/1lox) erythroid cells show defects in cell cycle progression. Surprisingly, analysis of cell cycle profiling suggests that E2F4 and pRB control cell cycle exit through different mechanisms. Moreover, only pRB, but not E2F4, promotes cell survival in erythroid cells. We observed an additive rather than a synergistic impact upon the erythroid defects in the compound E2f4(-/-);Rb(1lox/1lox) embryos. We further found that fetal liver macrophage development is largely normal regardless of genotype. Taken together, our results show that E2F4 and pRB play independent cell-intrinsic roles in fetal erythropoiesis.

  4. pRB is required for interferon-gamma-induction of the MHC class II abeta gene.

    Science.gov (United States)

    Zhu, X; Pattenden, S; Bremner, R

    1999-09-02

    pRB is required for IFN-gamma-induction of MHC class II in human tumor cell lines, providing a potential link between tumor suppressors and the immune system. However, other genes, such as cyclin D1, show pRB-dependency only in tumor cells, so by analogy, pRB may not be necessary for cII-regulation in normal cells. Here, we demonstrate that induction of the mouse MHC class II I-A heterodimer is normal in RB+/+ mouse embryonic fibroblasts (MEFs), but deficient in RB-/- MEFs. Inducibility is restored in RB-/- MEFs stably transfected with wild type RB cDNA or infected with an adenovirus expressing pRB. Thus, involvement of pRB in MHC class II expression is conserved in the mouse and is not an aberrant feature of tumorigenic, aneuploid, human tumor cells. Although cII genes are generally induced in a coordinate fashion, suggesting a common mechanism, we found that pRB was specifically required for induction of the Abeta, but not Aalpha or other MHC cII genes including Ebeta, Ii and H2-Malpha. Finally, IFN-gamma-induction of class II transactivator (CIITA), was pRB-independent, suggesting that pRB works downstream of this master-regulator of MHC class II expression.

  5. Efficacy of dart or booster vaccination with strain RB51 in protecting bison against experimental Brucella abortus challenge

    Science.gov (United States)

    Vaccination is an effective tool for reducing the prevalence of brucellosis in natural hosts. In this study, we characterized the efficacy of the Brucella abortus strain RB51 (RB51) vaccine in bison when delivered by single intramuscular vaccination (Hand RB51), single pneumatic dart delivery (Dart ...

  6. Immune Responses and Protection against Experimental Brucella suis biovar 1 Challenge in Non-vaccinated or RB51-Vaccinated Cattle

    Science.gov (United States)

    Twenty Hereford heifers, approximately 9 months of age, were vaccinated with saline (control) or 2 x 10**10 CFU of Brucella abortus strain RB51 (RB51) vaccine. Immunologic responses after inoculation demonstrated significantly greater (P<0.05) antibody and proliferative responses to RB51 antigens i...

  7. Site-specific hyperphosphorylation of pRb in HIV-induced neurotoxicity.

    Science.gov (United States)

    Akay, C; Lindl, K A; Wang, Y; White, M G; Isaacman-Beck, J; Kolson, D L; Jordan-Sciutto, K L

    2011-06-01

    HIV-Associated Neurocognitive Disorder (HAND) remains a serious complication of HIV infection, despite combined Anti-Retroviral Therapy (cART). Neuronal dysfunction and death are attributed to soluble factors released from activated and/or HIV-infected macrophages. Most of these factors affect the cell cycle machinery, determining cellular outcomes even in the absence of cell division. One of the earliest events in cell cycle activation is hyperphosphorylation of the retinoblastoma protein, pRb (ppRb). We and others have previously shown increased ppRb expression in the CNS of patients with HIV encephalitis (HIVE) and in neurons in an in vitro model of HIV-induced neurodegeneration. However, trophic factors also lead to an increase in neuronal ppRb with an absence of cell death, suggesting that, depending on the stimulus, hyperphosphorylation of pRb can have different outcomes on neuronal fate. pRb has multiple serines and threonines targeted for phosphorylation by distinct kinases, and we hypothesized that different stimuli may target separate sites for phosphorylation. Thus, to determine whether pRb is differentially phosphorylated in response to different stimuli and whether any of these sites is preferentially phosphorylated in association with HIV-induced neurotoxicity, we treated primary rat mixed cortical cultures with trophic factors, BDNF or RANTES, or with the neurotoxic factor, N-methyl-d-aspartate (NMDA), or with supernatants containing factors secreted by HIV-infected monocyte-derived macrophages (HIV-MDM), our in vitro model of HIV-induced neurodegeneration. We found that, while BDNF and RANTES phosphorylated serine807/811 and serine608 in vitro, treatment with HIV-MDM did not, even though these trophic factors are components of HIV-MDM. Rather, HIV-MDM targets a specific phosphorylation site, serine795, of pRb for phosphorylation in vitro and this ppRb isoform is also increased in HIV-infected brains in vivo. Further, overexpression of a

  8. [Aiming for zero blindness].

    Science.gov (United States)

    Nakazawa, Toru

    2015-03-01

    Glaucoma is the leading cause of acquired blindness in Japan. One reason that it often leads to blindness is that it can continue to worsen even after effective medical reduction of intraocular pressure (IOP), the only evidence-based treatment. The limitations of current treatments make it critical to identify IOP-independent factors that can cause glaucoma and develop new drugs to target these factors. This is a challenging task, as the pathology of glaucoma is thought to be very complex, with different combinations of factors underlying its development and progression in different patients. Additionally, there is a deficiency in methods to efficiently perform clinical evaluations and reliably probe the state of the disease over relatively short periods. In addition, newly developed drugs need to be evaluated with clinical trials, for which human and financial resources are limited, before they can be widely used for treatment. Taking all these issues into consideration, it is evident that there are two urgent issues to consider: the development of methods to classify glaucoma in detail based on its pathology, and the improvement of clinical evaluation methods. In this review, we discuss some of our efforts to develop new neuroprotective agents for glaucoma, with a focus on the following three areas: 1. Clinical research and development of methods to classify glaucoma in detail based on IOP-independent factors, and the exploration of possibilities for the improvement of clinical evaluation of glaucoma. 2. Pathology-based research and development of new drugs for glaucoma, focusing on comprehensive gene expression analysis and the development of molecule-targeting drugs, using murine optic nerve crush as a disease model. 3. Development of next generation in vivo imaging modalities and the establishment of infrastructure enabling "big-data" analysis. First, we discuss our clinical research and the development of methods to classify glaucoma in detail based on IOP

  9. Repetitive energy transfer from an inductive energy store

    Energy Technology Data Exchange (ETDEWEB)

    Honig, E.M.

    1984-01-01

    The theoretical and experimental results of a research program aimed at finding practical ways to transfer energy repetitively from an inductive energy store to various loads are discussed. The objectives were to investigate and develop the high power opening switches and transfer circuits needed to enable high-repetition-rate operation of such systems, including a feasibility demonstration at a current level near 10 kA and a pulse repetition rate of 1-10 kpps with a 1-ohm load. The requirements of nonlinear, time-varying loads, such as the railgun electromagnetic launcher, were also addressed. Energy storage capability is needed for proper power conditioning in systems where the duty factor of the output pulse train is low. Inductive energy storage is attractive because it has both a high energy storage density and a fast discharge capability. By producing a pulse train with a peak power of 75 MW at a pulse repetition rate of 5 kpps in a one-ohm load system, this research program was the first to demonstrate fully-controlled, high-power, high-repetition-rate operation of an inductive energy storage and transfer system with survivable switches. Success was made possible by using triggered vacuum gap switches as repetitive, current-zero opening switches and developing several new repetitive transfer circuits using the counterpulse technique.

  10. Skill learning in mirror reading: how repetition determines acquisition.

    Science.gov (United States)

    Ofen-Noy, N; Dudai, Y; Karni, A

    2003-07-01

    Practice makes perfect, but the role of repetitions in skill learning is not yet fully understood. For example, given a similar number of trials on a given task, it is debated whether repeating and non-repeating items are learned by the same neural process. When one is given training with both types of items--does one learn two separate skills, or only one? Here we show, using a mirror reading task, that practice trials with trial-unique words, and practice trials with repeated words, count towards learning to a different degree. There was no interaction between the time-course of learning repeated and unique words even within the same individuals given mixed training. While repeated words were learned faster than unique words, the repetitions-dependent gains diminished with training beyond a small number of repetitions. Moreover, the gains in performance could not be accounted for solely by the number of repetitions, as assumed by power-law models of learning; rather, the passage of time was a critical factor. Finally, our results suggest that although both repeated and new words were learned by both declarative and procedural memory mechanisms, even a single repetition of specific words could lead to the establishment of a selective differential representation in memory. The results are compatible with the notion of a repetition-sensitive process, triggered by specific repeating events. This 'repetition counter' may be a critical trigger for the effective formation of procedural as well as some type of declarative memory.

  11. Prognostic significance of cyclinD1 amplification and the co-alteration of cyclinD1/pRb/ppRb in patients with esophageal squamous cell carcinoma.

    Science.gov (United States)

    Wang, M-T; Chen, G; An, S-J; Chen, Z-H; Huang, Z-M; Xiao, P; Ben, X-S; Xie, Z; Chen, S-L; Luo, D-L; Tang, J-M; Lin, J-Y; Zhang, X-C; Wu, Y-L

    2012-01-01

    CyclinD1/pRb/ppRb is one of the most important pathways regulating the cell cycle, and related with the development of many cancers. However, the co-alteration of CyclinD1/pRb/ppRb in esophageal squamous cell carcinomas is less understood. This study aims to analyze the combined prognostic significance of cyclinD1 (CCND1) DNA amplification and the co-alteration of CCND1/pRb/ppRB in patients with esophageal squamous cell carcinoma. CCND1 DNA amplification and the protein expression of CCND1, pRb, and ppRb on 100 tumor specimens and 11 normal tissues were detected using real-time quantitative reverse transcription polymerase chain reaction and immunohistochemistry, respectively. Their prognosis significance was analyzed by Kaplan-Meier method. We found that 41% of the patients had CCND1 DNA amplification, which had a short survival time compared with the patients without CCND1 amplification (25.63 months vs. not reached, P=0.007). The patients with the co-alternation of CCND1(+) /pRb(-) /ppRb(+) protein expression levels have a poorer overall survival than the others (11.4 vs. 43.4 months, P=0.001). Cox regression analysis showed that the co-alternation of CCND1/pRb/ppRb and CyclinD1 amplification were the two most independent prognosis factors of patients with esophageal cancer. These findings suggested that CCND1 amplification and co-alternation of CCND1(+) /pRb(-) /ppRb(+) may play a crucial role in the prognostic evaluation of patients with esophageal cancer, and the patients with CCND1(+) /pRb(-) /ppRb(+) have the worst prognosis in all the patients. The results also indicated that the patients with CCND1 amplification or co-alternation of CyclinD1(+) /pRb(-) /ppRb(+) might be the preponderant people for therapy targeting the CCND1/pRb/ppRb pathway in the future.

  12. Directed PCR-free engineering of highly repetitive DNA sequences

    Directory of Open Access Journals (Sweden)

    Preissler Steffen

    2011-09-01

    Full Text Available Abstract Background Highly repetitive nucleotide sequences are commonly found in nature e.g. in telomeres, microsatellite DNA, polyadenine (poly(A tails of eukaryotic messenger RNA as well as in several inherited human disorders linked to trinucleotide repeat expansions in the genome. Therefore, studying repetitive sequences is of biological, biotechnological and medical relevance. However, cloning of such repetitive DNA sequences is challenging because specific PCR-based amplification is hampered by the lack of unique primer binding sites resulting in unspecific products. Results For the PCR-free generation of repetitive DNA sequences we used antiparallel oligonucleotides flanked by restriction sites of Type IIS endonucleases. The arrangement of recognition sites allowed for stepwise and seamless elongation of repetitive sequences. This facilitated the assembly of repetitive DNA segments and open reading frames encoding polypeptides with periodic amino acid sequences of any desired length. By this strategy we cloned a series of polyglutamine encoding sequences as well as highly repetitive polyadenine tracts. Such repetitive sequences can be used for diverse biotechnological applications. As an example, the polyglutamine sequences were expressed as His6-SUMO fusion proteins in Escherichia coli cells to study their aggregation behavior in vitro. The His6-SUMO moiety enabled affinity purification of the polyglutamine proteins, increased their solubility, and allowed controlled induction of the aggregation process. We successfully purified the fusions proteins and provide an example for their applicability in filter retardation assays. Conclusion Our seamless cloning strategy is PCR-free and allows the directed and efficient generation of highly repetitive DNA sequences of defined lengths by simple standard cloning procedures.

  13. New treatments of hereditary blindness

    DEFF Research Database (Denmark)

    Bertelsen, Mette; Rosenberg, Thomas; Larsen, Michael

    2013-01-01

    Ongoing clinical trials are targeting several previously intractable hereditary causes of blindness of congenital, childhood or early adulthood onset, mainly in the optic nerve and retina. The intended stage of initiation of the new therapeutic approaches ranges from neonatal life and a structura......Ongoing clinical trials are targeting several previously intractable hereditary causes of blindness of congenital, childhood or early adulthood onset, mainly in the optic nerve and retina. The intended stage of initiation of the new therapeutic approaches ranges from neonatal life...... and a structurally intact retinal tissue to adult life with a complete loss of photoreceptors. It must be assumed that some of the trials will succeed in producing new therapies and action must be taken to refine and accelerate diagnostics and to preserve therapeutic potential in blind people....

  14. Derivation of Apollo 14 High-Al Basalts at Discrete Times: Rb-Sr Isotopic Constraints

    Science.gov (United States)

    Hui. Hejiu; Neal, Clive, R.; Shih, Chi-Yu; Nyquist, Laurence E.

    2012-01-01

    Pristine Apollo 14 (A-14) high-Al basalts represent the oldest volcanic deposits returned from the Moon [1,2] and are relatively enriched in Al2O3 (>11 wt%) compared to other mare basalts (7-11 wt%). Literature Rb-Sr isotopic data suggest there are at least three different eruption episodes for the A-14 high-Al basalts spanning the age range approx.4.3 Ga to approx.3.95 Ga [1,3]. Therefore, the high-Al basalts may record lunar mantle evolution between the formation of lunar crust (approx.4.4 Ga) and the main basin-filling mare volcanism (basalts were originally classified into five compositional groups [5,6], and then regrouped into three with a possible fourth comprising 14072 based on the whole-rock incompatible trace element (ITE) ratios and Rb-Sr radiometric ages [7]. However, Rb-Sr ages of these basalts from different laboratories may not be consistent with each other because of the use of different 87Rb decay constants [8] and different isochron derivation methods over the last four decades. This study involved a literature search for Rb-Sr isotopic data previously reported for the high-Al basalts. With the re-calculated Rb-Sr radiometric ages, eruption episodes of A-14 high-Al basalts were determined, and their petrogenesis was investigated in light of the "new" Rb-Sr isotopic data and published trace element abundances of these basalts.

  15. The tumor suppressors pRB and p53 as regulators of adipocyte differentiation and function

    DEFF Research Database (Denmark)

    Hallenborg, Philip; Feddersen, Søren; Madsen, Lise

    2009-01-01

    BACKGROUND: The retinoblastoma protein (pRB) and p53 are crucial members of regulatory networks controlling the cell cycle and apoptosis, and a hallmark of virtually all cancers is dysregulation of expression or function of pRB or p53. Although they are best known for their role in cancer develop...... of energy metabolism and homeostasis. RESULTS/CONCLUSIONS: pRB is required for adipose conversion and also involved in determining its mitochondrial capacity. p53 inhibits adipogenesis and results suggest that it is involved in maintaining function of adipose tissue.......BACKGROUND: The retinoblastoma protein (pRB) and p53 are crucial members of regulatory networks controlling the cell cycle and apoptosis, and a hallmark of virtually all cancers is dysregulation of expression or function of pRB or p53. Although they are best known for their role in cancer...... development, it is now evident that both are implicated in metabolism and cellular development. OBJECTIVE/METHODS: To review the role of pRB and p53 in adipocyte differentiation and function emphasizing that pRB and p53, via their effects on adipocyte development and function, play a role in the regulation...

  16. Suppression of genome instability in pRB-deficient cells by enhancement of chromosome cohesion.

    Science.gov (United States)

    Manning, Amity L; Yazinski, Stephanie A; Nicolay, Brandon; Bryll, Alysia; Zou, Lee; Dyson, Nicholas J

    2014-03-20

    Chromosome instability (CIN), a common feature of solid tumors, promotes tumor evolution and increases drug resistance during therapy. We previously demonstrated that loss of the retinoblastoma protein (pRB) tumor suppressor causes changes in centromere structure and generates CIN. However, the mechanism and significance of this change was unclear. Here, we show that defects in cohesion are key to the pRB loss phenotype. pRB loss alters H4K20 methylation, a prerequisite for efficient establishment of cohesion at centromeres. Changes in cohesin regulation are evident during S phase, where they compromise replication and increase DNA damage. Ultimately, such changes compromise mitotic fidelity following pRB loss. Remarkably, increasing cohesion suppressed all of these phenotypes and dramatically reduced CIN in cancer cells lacking functional pRB. These data explain how loss of pRB undermines genomic integrity. Given the frequent functional inactivation of pRB in cancer, conditions that increase cohesion may provide a general strategy to suppress CIN.

  17. Neuroprotective effects of ginsenoside Rb1 on hippocampal neuronal injury and neurite outgrowth

    Institute of Scientific and Technical Information of China (English)

    Juan Liu; Jing He; Liang Huang; Ling Dou; Shuang Wu; Qionglan Yuan

    2014-01-01

    Ginsenoside Rb1 has been reported to exert anti-aging and anti-neurodegenerative effects. In the present study, we investigate whether ginsenoside Rb1 is involved in neurite outgrowth and neuroprotection against damage induced by amyloid beta (25-35) in cultured hippocampal neu-rons, and explore the underlying mechanisms. Ginsenoside Rb1 significantly increased neurite outgrowth in hippocampal neurons, and increased the expression of phosphorylated-Akt and phosphorylated extracellular signal-regulated kinase 1/2. These effects were abrogated by API-2 and PD98059, inhibitors of the signaling proteins Akt and MEK. Additionally, cultured hippo-campal neurons were exposed to amyloid beta (25-35) for 30 minutes; ginsenoside Rb1 prevented apoptosis induced by amyloid beta (25-35), and this effect was blocked by API-2 and PD98059. Furthermore, ginsenoside Rb1 significantly reversed the reduction in phosphorylated-Akt and phosphorylated extracellular signal-regulated kinase 1/2 levels induced by amyloid beta (25-35), and API-2 neutralized the effect of ginsenoside Rb1. The present results indicate that ginsenoside Rb1 enhances neurite outgrowth and protects against neurotoxicity induced by amyloid beta (25-35) via a mechanism involving Akt and extracellular signal-regulated kinase 1/2 signaling.

  18. Repetition-based Interactive Facade Modeling

    KAUST Repository

    AlHalawani, Sawsan

    2012-07-01

    Modeling and reconstruction of urban environments has gained researchers attention throughout the past few years. It spreads in a variety of directions across multiple disciplines such as image processing, computer graphics and computer vision as well as in architecture, geoscience and remote sensing. Having a virtual world of our real cities is very attractive in various directions such as entertainment, engineering, governments among many others. In this thesis, we address the problem of processing a single fa cade image to acquire useful information that can be utilized to manipulate the fa cade and generate variations of fa cade images which can be later used for buildings\\' texturing. Typical fa cade structures exhibit a rectilinear distribution where in windows and other elements are organized in a grid of horizontal and vertical repetitions of similar patterns. In the firt part of this thesis, we propose an efficient algorithm that exploits information obtained from a single image to identify the distribution grid of the dominant elements i.e. windows. This detection method is initially assisted with the user marking the dominant window followed by an automatic process for identifying its repeated instances which are used to define the structure grid. Given the distribution grid, we allow the user to interactively manipulate the fa cade by adding, deleting, resizing or repositioning the windows in order to generate new fa cade structures. Having the utility for the interactive fa cade is very valuable to create fa cade variations and generate new textures for building models. Ultimately, there is a wide range of interesting possibilities of interactions to be explored.

  19. Understanding communicative actions: a repetitive TMS study.

    Science.gov (United States)

    Stolk, Arjen; Noordzij, Matthijs L; Volman, Inge; Verhagen, Lennart; Overeem, Sebastiaan; van Elswijk, Gijs; Bloem, Bas; Hagoort, Peter; Toni, Ivan

    2014-02-01

    Despite the ambiguity inherent in human communication, people are remarkably efficient in establishing mutual understanding. Studying how people communicate in novel settings provides a window into the mechanisms supporting the human competence to rapidly generate and understand novel shared symbols, a fundamental property of human communication. Previous work indicates that the right posterior superior temporal sulcus (pSTS) is involved when people understand the intended meaning of novel communicative actions. Here, we set out to test whether normal functioning of this cerebral structure is required for understanding novel communicative actions using inhibitory low-frequency repetitive transcranial magnetic stimulation (rTMS). A factorial experimental design contrasted two tightly matched stimulation sites (right pSTS vs left MT+, i.e., a contiguous homotopic task-relevant region) and tasks (a communicative task vs a visual tracking task that used the same sequences of stimuli). Overall task performance was not affected by rTMS, whereas changes in task performance over time were disrupted according to TMS site and task combinations. Namely, rTMS over pSTS led to a diminished ability to improve action understanding on the basis of recent communicative history, while rTMS over MT+ perturbed improvement in visual tracking over trials. These findings qualify the contributions of the right pSTS to human communicative abilities, showing that this region might be necessary for incorporating previous knowledge, accumulated during interactions with a communicative partner, to constrain the inferential process that leads to action understanding. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Epithelial topography for repetitive tooth formation

    Directory of Open Access Journals (Sweden)

    Marcia Gaete

    2015-12-01

    Full Text Available During the formation of repetitive ectodermally derived organs such as mammary glands, lateral line and teeth, the tissue primordium iteratively initiates new structures. In the case of successional molar development, new teeth appear sequentially in the posterior region of the jaw from Sox2+ cells in association with the posterior aspect of a pre-existing tooth. The sequence of molar development is well known, however, the epithelial topography involved in the formation of a new tooth is unclear. Here, we have examined the morphology of the molar dental epithelium and its development at different stages in the mouse in vivo and in molar explants. Using regional lineage tracing we show that within the posterior tail of the first molar the primordium for the second and third molar are organized in a row, with the tail remaining in connection with the surface, where a furrow is observed. The morphology and Sox2 expression of the tail retains characteristics reminiscent of the earlier stages of tooth development, such that position along the A-P axes of the tail correlates with different temporal stages. Sox9, a stem/progenitor cell marker in other organs, is expressed mainly in the suprabasal epithelium complementary with Sox2 expression. This Sox2 and Sox9 expressing molar tail contains actively proliferating cells with mitosis following an apico-basal direction. Snail2, a transcription factor implicated in cell migration, is expressed at high levels in the tip of the molar tail while E-cadherin and laminin are decreased. In conclusion, our studies propose a model in which the epithelium of the molar tail can grow by posterior movement of epithelial cells followed by infolding and stratification involving a population of Sox2+/Sox9+ cells.

  1. Repetitive transcranial magnetic stimulation in psychiatry

    Directory of Open Access Journals (Sweden)

    Biswa Ranjan Mishra

    2011-01-01

    Full Text Available Repetitive transcranial magnetic stimulation (rTMS is a non-invasive and relatively painless tool that has been used to study various cognitive functions as well as to understand the brain-behavior relationship in normal individuals as well as in those with various neuropsychiatric disorders. It has also been used as a therapeutic tool in various neuropsychiatric disorders because of its ability to specifically modulate distinct brain areas. Studies have shown that repeated stimulation at low frequency produces long-lasting inhibition, which is called as long-term depression, whereas repeated high-frequency stimulation can produce excitation through long-term potentiation. This paper reviews the current status of rTMS as an investigative and therapeutic modality in various neuropsychiatric disorders. It has been used to study the cortical and subcortical functions, neural plasticity and brain mapping in normal individuals and in various neuropsychiatric disorders. rTMS has been most promising in the treatment of depression, with an overall milder adverse effect profile compared with electroconvulsive therapy. In other neuropsychiatric disorders such as schizophrenia, mania, epilepsy and substance abuse, it has been found to be useful, although further studies are required to establish therapeutic efficacy. It appears to be ineffective in the treatment of obsessive compulsive disorder. There is a paucity of studies of efficacy and safety of rTMS in pediatric and geriatric population. Although it appears safe, further research is required to optimize its efficacy and reduce the side-effects. Magnetic seizure therapy, which involves producing seizures akin to electroconvulsive therapy, appears to be of comparable efficacy in the treatment of depression with less cognitive adverse effects.

  2. Clinical application of repetitive transcranial magnetic stimulation in stroke rehabilitation☆

    Science.gov (United States)

    Shin, Joonho; Yang, EunJoo; Cho, KyeHee; Barcenas, Carmelo L; Kim, Woo Jin; Min, Yusun; Paik, Nam-Jong

    2012-01-01

    Proper stimulation to affected cerebral hemisphere would promote the functional recovery of patients with stroke. Effects of repetitive transcranial magnetic stimulation on cortical excitability can be can be altered by the stimulation frequency, intensity and duration. There has been no consistent recognition regarding the best stimulation frequency and intensity. This study reviews the intervention effects of repetitive transcranial stimulation on motor impairment, dysphagia, visuospatial neglect and aphasia, and summarizes the stimulation frequency, intensity and area for repetitive transcranial magnetic stimulation to yield the best therapeutic effects. PMID:25745455

  3. Clinical application of repetitive transcranial magnetic stimulation in stroke rehabilitation

    Institute of Scientific and Technical Information of China (English)

    Joonho Shin; EunJoo Yang; KyeHee Cho; Carmelo L Barcenas; Woo Jin Kim; Yusun Min; Nam-Jong Paik

    2012-01-01

    Proper stimulation to affected cerebral hemisphere would promote the functional recovery of patients with stroke. Effects of repetitive transcranial magnetic stimulation on cortical excitability can be can be altered by the stimulation frequency, intensity and duration. There has been no consistent recognition regarding the best stimulation frequency and intensity. This study reviews the intervention effects of repetitive transcranial stimulation on motor impairment, dysphagia, visuospatial neglect and aphasia, and summarizes the stimulation frequency, intensity and area for repetitive transcranial magnetic stimulation to yield the best therapeutic effects.

  4. Access to Mathematics by Blind Students: A Global Problem

    OpenAIRE

    Karshmer, Arthur I.; Daryoush D. Farsi

    2007-01-01

    The issue of blindness and legally blind is becoming a global issue. Based on the last statistics from American Foundation for the blind, there are approximately 10 million blind and visually impaired people in the United States alone. Over 45 million people around the world are completely blind. 180 million more people are legally blind, and approximately 7 million people are diagnosed as blind or legally blind every year. One of the greatest stumbling blocks in the ability of the blind to e...

  5. RB1 deficiency in triple-negative breast cancer induces mitochondrial protein translation

    Science.gov (United States)

    Jones, Robert A.; Robinson, Tyler J.; Liu, Jeff C.; Shrestha, Mariusz; Voisin, Veronique; Ju, YoungJun; Chung, Philip E.D.; Pellecchia, Giovanna; Fell, Victoria L.; Bae, SooIn; Muthuswamy, Lakshmi; Egan, Sean E.; Jiang, Zhe; Leone, Gustavo; Bader, Gary D.; Schimmer, Aaron

    2016-01-01

    Triple-negative breast cancer (TNBC) includes basal-like and claudin-low subtypes for which no specific treatment is currently available. Although the retinoblastoma tumor-suppressor gene (RB1) is frequently lost together with TP53 in TNBC, it is not directly targetable. There is thus great interest in identifying vulnerabilities downstream of RB1 that can be therapeutically exploited. Here, we determined that combined inactivation of murine Rb and p53 in diverse mammary epithelial cells induced claudin-low–like TNBC with Met, Birc2/3-Mmp13-Yap1, and Pvt1-Myc amplifications. Gene set enrichment analysis revealed that Rb/p53-deficient tumors showed elevated expression of the mitochondrial protein translation (MPT) gene pathway relative to tumors harboring p53 deletion alone. Accordingly, bioinformatic, functional, and biochemical analyses showed that RB1-E2F complexes bind to MPT gene promoters to regulate transcription and control MPT. Additionally, a screen of US Food and Drug Administration–approved (FDA-approved) drugs identified the MPT antagonist tigecycline (TIG) as a potent inhibitor of Rb/p53-deficient tumor cell proliferation. TIG preferentially suppressed RB1-deficient TNBC cell proliferation, targeted both the bulk and cancer stem cell fraction, and strongly attenuated xenograft growth. It also cooperated with sulfasalazine, an FDA-approved inhibitor of cystine xCT antiporter, in culture and xenograft assays. Our results suggest that RB1 deficiency promotes cancer cell proliferation in part by enhancing mitochondrial function and identify TIG as a clinically approved drug for RB1-deficient TNBC. PMID:27571409

  6. Whole chromosome instability resulting from the synergistic effects of pRB and p53 inactivation.

    Science.gov (United States)

    Manning, A L; Benes, C; Dyson, N J

    2014-05-01

    Whole chromosome instability (CIN) is a common feature of cancer cells and has been linked to increased tumor evolution and metastasis. Several studies have shown that the loss of the pRB tumor suppressor causes mitotic defects and chromosome mis-segregation. pRB is inactivated in many types of cancer and this raises the possibility that the loss of pRB may be a general cause of CIN in tumors. Paradoxically, retinoblastoma tumor cells have a relatively stable karyotype and currently the circumstances in which pRB inactivation causes CIN in human cancers are unclear. Here we utilize a fluorescence in situ hybridization-based approach to score numerical heterogeneity in chromosome copy number as a readout of CIN. Using this technique, we show that high levels of CIN correlate with the combined inactivation of pRB and p53 and that this association is evident in two independent panels of cancer cell lines. Retinoblastoma cell lines characteristically retain a wild-type TP53 gene, providing an opportunity to test the relevance of this functional relationship. We show that retinoblastoma cell lines display mitotic defects similar to those seen when pRB is depleted from non-transformed cells, but that the presence of wild-type p53 suppresses the accumulation of aneuploid cells. A similar synergy between pRB and p53 inactivation was observed in HCT116 cells. These results suggest that the loss of pRB promotes segregation errors, whereas loss of p53 allows tolerance and continued proliferation of the resulting, genomically unstable cancer cells. Hence, it is the cooperative effect of inactivation of both pRB and p53 tumor suppressor pathways that promotes CIN.

  7. Tissue microarray immunohistochemical profiles of p53 and pRB in hepatocellular carcinoma and hepatoblastoma.

    Science.gov (United States)

    Azlin, Abdul Hadi; Looi, Lai Meng; Cheah, Phaik Leng

    2014-01-01

    The tumour suppressor genes, p53 and pRb, are known to play important roles in neoplastic transformation. While molecular routes to the uncontrolled growth of hepatocytes, leading to primary liver cancer have generated considerable interest, the roles of p53 and pRb mutations in hepatocellular carcinoma (HCC) and hepatoblastoma (HB) remain to be clarified. We examined the immunohistochemical expression of p53 and pRb gene products in 26 HCC and 9 HB, sampled into tissue microarray blocks. 10 (38%) of 26 HCC showed > 10% tumour nuclear staining for p53 protein, 3 of these also being HbsAg positive. Conversely, none of 9 HB expressed nuclear p53 immunopositivity. Some 24 (92%) HCC and 8 (89%) HB showed loss of pRb nuclear expression. Two of the 26 HCC and one of the 9 HB showed >10% tumour nuclear staining for pRb protein. Our results suggest that p53 does not have an important role in the development of HB but may contribute in HCC. There is also loss of pRb expression in the majority of HCC and HB, supporting loss of pRb gene function in the hepatocarcinogenesis pathway. However, a comparison of the staining profiles of p53 and pRb proteins in HCC and HB did not reveal a consistent pattern to differentiate between the two types of tumours immunohistochemically. Hence the use of p53 and pRB protein expression has no contribution in the situation where there is a diagnostic difficulty in deciding between HCC and HB.

  8. Cooperative activation of tissue-specific genes by pRB and E2F1.

    Science.gov (United States)

    Flowers, Stephen; Xu, Fuhua; Moran, Elizabeth

    2013-04-01

    The retinoblastoma tumor suppressor protein pRB is conventionally regarded as an inhibitor of the E2F family of transcription factors. Conversely, pRB is also recognized as an activator of tissue-specific gene expression along various lineages including osteoblastogenesis. During osteoblast differentiation, pRB directly targets Alpl and Bglap, which encode the major markers of osteogenesis alkaline phosphatase and osteocalcin. Surprisingly, p130 and repressor E2Fs were recently found to cooccupy and repress Alpl and Bglap in proliferating osteoblast precursors before differentiation. This raises the further question of whether these genes convert to E2F activation targets when differentiation begins, which would constitute a remarkable situation wherein pRB and E2F would be cotargeting genes for activation. Chromatin immunoprecipitation analysis in an osteoblast differentiation model shows that Alpl and Bglap are indeed targeted by an activator E2F, i.e., is E2F1. Promoter occupation of Alpl and Bglap by E2F1 occurs specifically during activation, and depletion of E2F1 severely impairs their induction. Mechanistically, promoter occupation by E2F1 and pRB is mutually dependent, and without this cooperative effect, activation steps previously shown to be dependent on pRB, including recruitment of RNA polymerase II, are impaired. Myocyte- and adipocyte-specific genes are also cotargeted by E2F1 and pRB during differentiation along their respective lineages. The finding that pRB and E2F1 cooperate to activate expression of tissue-specific genes is a paradigm distinct from the classical concept of pRB as an inhibitor of E2F1, but is consistent with the observed roles of these proteins in physiological models.

  9. Rb1 gene inactivation expands satellite cell and postnatal myoblast pools.

    Science.gov (United States)

    Hosoyama, Tohru; Nishijo, Koichi; Prajapati, Suresh I; Li, Guangheng; Keller, Charles

    2011-06-03

    Satellite cells are well known as a postnatal skeletal muscle stem cell reservoir that under injury conditions participate in repair. However, mechanisms controlling satellite cell quiescence and activation are the topic of ongoing inquiry by many laboratories. In this study, we investigated whether loss of the cell cycle regulatory factor, pRb, is associated with the re-entry of quiescent satellite cells into replication and subsequent stem cell expansion. By ablation of Rb1 using a Pax7CreER,Rb1 conditional mouse line, satellite cell number was increased 5-fold over 6 months. Furthermore, myoblasts originating from satellite cells lacking Rb1 were also increased 3-fold over 6 months, while terminal differentiation was greatly diminished. Similarly, Pax7CreER,Rb1 mice exhibited muscle fiber hypotrophy in vivo under steady state conditions as well as a delay of muscle regeneration following cardiotoxin-mediated injury. These results suggest that cell cycle re-entry of quiescent satellite cells is accelerated by lack of Rb1, resulting in the expansion of both satellite cells and their progeny in adolescent muscle. Conversely, that sustained Rb1 loss in the satellite cell lineage causes a deficit of muscle fiber formation. However, we also show that pharmacological inhibition of protein phosphatase 1 activity, which will result in pRb inactivation accelerates satellite cell activation and/or expansion in a transient manner. Together, our results raise the possibility that reversible pRb inactivation in satellite cells and inhibition of protein phosphorylation may provide a new therapeutic tool for muscle atrophy by short term expansion of the muscle stem cells and myoblast pool.

  10. Computer Reader for the Blind

    Science.gov (United States)

    1990-01-01

    Optacon II uses the same basic technique of converting printed information into a tactile image as did Optacon. Optacon II can also be connected directly to a personal computer, which opens up a new range of job opportunities for the blind. Optacon II is not limited to reading printed words, it can convert any graphic image viewed by the camera. Optacon II demands extensive training for blind operators. TSI provides 60-hour training courses at its Mountain View headquarters and at training centers around the world. TeleSensory discontinued production of the Optacon as of December 1996.

  11. Night blindness and ancient remedy

    Directory of Open Access Journals (Sweden)

    H.A. Hajar Al Binali

    2014-01-01

    Full Text Available The aim of this article is to briefly review the history of night blindness and its treatment from ancient times until the present. The old Egyptians, the Babylonians, the Greeks and the Arabs used animal liver for treatment and successfully cured the disease. The author had the opportunity to observe the application of the old remedy to a patient. Now we know what the ancients did not know, that night blindness is caused by Vitamin A deficiency and the animal liver is the store house for Vitamin A.

  12. New approaches to visual rehabilitation for cortical blindness: outcomes and putative mechanisms.

    Science.gov (United States)

    Das, Anasuya; Huxlin, Krystel R

    2010-08-01

    Cortical blindness is a chronic loss of vision following damage to the primary visual cortex (V1) or its postchiasmal afferents. Such damage is followed by a brief period of spontaneous plasticity that rarely lasts beyond 6 months. Following this initial phase, the visual deficit is thought to be stable, intractable, and permanent. Cortically blind subjects demonstrate spontaneous oculomotor adaptations to their deficits that can be further improved by saccadic localization training. However, saccadic training does not improve visual sensitivity in the blind field. In contrast, recent studies by a number of independent groups suggest that localized, repetitive perceptual training can improve visual sensitivity in the blind field, although mechanisms underlying the observed recovery remain unclear. This review discusses the current literature on rehabilitative strategies used for cortical blindness with emphasis on the use of perceptual training methods. The putative mechanisms that underlie the resulting, training-induced visual improvements are then outlined, along with the special challenges posed to their elucidation by the great variability in the extent and sometimes nature of the V1 damage sustained in different individuals.

  13. MDM2/MDMX: Master negative regulators for p53 and RB.

    Science.gov (United States)

    Hu, Linshan; Zhang, Haibo; Bergholz, Johann; Sun, Shengnan; Xiao, Zhi-Xiong Jim

    2016-03-01

    MDM2 (mouse double minute 2 homolog) and MDMX (double minute X human homolog, also known as MDM4) are critical negative regulators of tumor protein p53. Our recent work shows that MDMX binds to and promotes degradation of retinoblastoma protein (RB) in an MDM2-dependent manner. In a xenograft tumor growth mouse model, silencing of MDMX results in inhibition of p53-deficient tumor growth, which can be effectively reversed by concomitant RB silencing. Thus, MDMX exerts its oncogenic activity via suppression of RB.

  14. The role of p53 and pRB in apoptosis and cancer

    DEFF Research Database (Denmark)

    Hickman, Emma S; Moroni, M Cristina; Helin, Kristian

    2002-01-01

    Loss of function of both the p53 pathway and the retinoblastoma protein (pRB) pathway plays a significant role in the development of most human cancers. Loss of pRB results in deregulated cell proliferation and apoptosis, whereas loss of p53 desensitizes cells to checkpoint signals, including...... apoptosis. In the past two years, mouse genetics and gene expression profiling have led to major advances in our understanding of how the pRB and p53 pathways regulate apoptosis and thus the development of tumours....

  15. Dual-species Bose-Einstein condensate of Rb87 and Cs133

    Science.gov (United States)

    McCarron, D. J.; Cho, H. W.; Jenkin, D. L.; Köppinger, M. P.; Cornish, S. L.

    2011-07-01

    We report the formation of a dual-species Bose-Einstein condensate of Rb87 and Cs133 in the same trapping potential. Our method exploits the efficient sympathetic cooling of Cs133 via elastic collisions with Rb87, initially in a magnetic quadrupole trap and subsequently in a levitated optical trap. The two condensates each contain up to 2×104 atoms and exhibit a striking phase separation, revealing the mixture to be immiscible due to strong repulsive interspecies interactions. Sacrificing all the Rb87 during the cooling, we create single-species Cs133 condensates of up to 6×104 atoms.

  16. Inhibitory Effects of Ginsenoside-Rb2 on Nicotinic Stimulation-Evoked Catecholamine Secretion

    Science.gov (United States)

    Lim, Hyo-Jeong; Lee, Hyun-Young

    2014-01-01

    The aim of the present study was to investigate whether ginsenoside-Rb2 (Rb2) can affect the secretion of catecholamines (CA) in the perfused model of the rat adrenal medulla. Rb2 (3~30 µM), perfused into an adrenal vein for 90 min, inhibited ACh (5.32 mM)-evoked CA secretory response in a dose- and time-dependent fashion. Rb2 (10 µM) also time-dependently inhibited the CA secretion evoked by DMPP (100 µM, a selective neuronal nicotinic receptor agonist) and high K+ (56 mM, a direct membrane depolarizer). Rb2 itself did not affect basal CA secretion (data not shown). Also, in the presence of Rb2 (50 µg/mL), the secretory responses of CA evoked by veratridine (a selective Na+ channel activator (50 µM), Bay-K-8644 (an L-type dihydropyridine Ca2+ channel activator, 10 µM), and cyclopiazonic acid (a cytoplasmic Ca2+-ATPase inhibitor, 10 µM) were significantly reduced, respectively. Interestingly, in the simultaneous presence of Rb2 (10 µM) and L-NAME (an inhibitor of NO synthase, 30 µM), the inhibitory responses of Rb2 on ACh-evoked CA secretory response was considerably recovered to the extent of the corresponding control secretion compared with the inhibitory effect of Rb2-treatment alone. Practically, the level of NO released from adrenal medulla after the treatment of Rb2 (10 µM) was greatly elevated compared to the corresponding basal released level. Collectively, these results demonstrate that Rb2 inhibits the CA secretory responses evoked by nicotinic stimulation as well as by direct membrane-depolarization from the isolated perfused rat adrenal medulla. It seems that this inhibitory effect of Rb2 is mediated by inhibiting both the influx of Ca2+ and Na+ into the adrenomedullary chromaffin cells and also by suppressing the release of Ca2+ from the cytoplasmic calcium store, at least partly through the increased NO production due to the activation of nitric oxide synthase, which is relevant to neuronal nicotinic receptor blockade. PMID:25352764

  17. Exploring strategies for the production of ultracold RbYb molecules in conservative traps

    Energy Technology Data Exchange (ETDEWEB)

    Bruni, Cristian

    2015-07-14

    Within the scope of this thesis, the production of ultracold molecules at a temperature of a few μK with various isotopes of rubidium (Rb) and ytterbium (Yb) was examined by means of photoassociation spectroscopy and magnetic Feshbach resonances in combined conservative traps. The long-term goal of this experiment is the production of ultracold RbYb molecules in the rovibronic ground state. It was possible to produce electronically excited {sup 87}Rb {sup 176}Yb molecules in a novel hybrid trap (HT) at a combined temperature of 1.7 μK by means of 1-photon photoassociation close to the Rb D1 line at 795 nm. This HT takes advantage of the different magnetic properties of Rb and Yb and allows for independent trapping and manipulation of the atomic species. It combines an Ioffe-Pritchard type magnetic trap for Rb and a near-resonant optical dipole trap for Yb. The excited molecular {sup 2}Π{sub 1/2} state could be characterized further extending previous works in a combined MOT and vibrational levels reaching binding energies up to E{sub b}=-h x 2.2 THz could be assigned by trap-loss spectroscopy. Almost every detected vibrational state consists of two resonances that could be assigned to the molecular analogue of the hyperfine structure of {sup 87}Rb. An important experimental observation is a decrease in hyperfine splitting with increasing binding energy of a vibrational level. For the deepest found vibrational state the hyperfine splitting amounts only 70 % of the atomic value (817 MHz) which emphasizes a gradual passage from weakly to tightly bound molecules. Furthermore, detailed attempts were undertaken to induce magnetic Feshbach resonances in {sup 85}Rb and different Yb isotopes, especially {sup 171}Yb in a crossed optical dipole trap at 1064 nm at temperatures of 10 μK. For this purpose, a homogeneous magnetic field was applied and scanned in small steps over the range of 495 G ∼ 640 G. Unfortunately, our efforts were without success. Additionally, well

  18. Direct production of ultracold rovibronic ground state LiRb molecules through photoassociation and spontaneous decay

    CERN Document Server

    Stevenson, I C; Chen, Y P; Elliott, D S

    2016-01-01

    We report a newly observed photoassociation resonance in $^7$Li-$^{85}$Rb, a mixed $2(1) - 4(1)$ excited state, that spontaneously decays to the rovibronic ground state. This resonance between ultracold Li and Rb is the strongest ground state molecule-forming photoassociation line observed in LiRb, and forms deeply bound $X \\: ^1\\Sigma^+$ molecules in large numbers. The production rate of the $v=0 \\ J=0$ rovibrational ground state is $\\sim 1.5 \\times 10^{4}$ molecules/s.

  19. Cortical excitatory neurons become protected from cell division during neurogenesis in an Rb family-dependent manner.

    Science.gov (United States)

    Oshikawa, Mio; Okada, Kei; Nakajima, Kazunori; Ajioka, Itsuki

    2013-06-01

    Cell cycle dysregulation leads to abnormal proliferation and cell death in a context-specific manner. Cell cycle progression driven via the Rb pathway forces neurons to undergo S-phase, resulting in cell death associated with the progression of neuronal degeneration. Nevertheless, some Rb- and Rb family (Rb, p107 and p130)-deficient differentiating neurons can proliferate and form tumors. Here, we found in mouse that differentiating cerebral cortical excitatory neurons underwent S-phase progression but not cell division after acute Rb family inactivation in differentiating neurons. However, the differentiating neurons underwent cell division and proliferated when Rb family members were inactivated in cortical progenitors. Differentiating neurons generated from Rb(-/-); p107(-/-); p130(-/-) (Rb-TKO) progenitors, but not acutely inactivated Rb-TKO differentiating neurons, activated the DNA double-strand break (DSB) repair pathway without increasing trimethylation at lysine 20 of histone H4 (H4K20), which has a role in protection against DNA damage. The activation of the DSB repair pathway was essential for the cell division of Rb-TKO differentiating neurons. These results suggest that newly born cortical neurons from progenitors become epigenetically protected from DNA damage and cell division in an Rb family-dependent manner.

  20. Irreversibility of cellular senescence: dual roles of p16INK4a/Rb-pathway in cell cycle control

    Directory of Open Access Journals (Sweden)

    Hara Eiji

    2007-03-01

    Full Text Available Abstract The retinoblastoma (Rb tumor suppressor gene product, pRb, has an established role in the implementation of cellular senescence, the state of irreversible G1 cell cycle arrest provoked by diverse oncogenic stresses. In murine cells, senescence cell cycle arrest can be reversed by subsequent inactivation of pRb, indicating that pRb is required not only for the onset of cellular senescence, but also for the maintenance of senescence program in murine cells. However, in human cells, once pRb is fully activated by p16INK4a, senescence cell cycle arrest becomes irreversible and is no longer revoked by subsequent inactivation of pRb, suggesting that p16INK4a/Rb-pathway activates an alternative mechanism to irreversibly block the cell cycle in human senescent cells. Here, we discuss the molecular mechanism underlying the irreversibility of senescence cell cycle arrest and its potential towards tumor suppression.

  1. Shortening of subjective visual intervals followed by repetitive stimulation.

    Directory of Open Access Journals (Sweden)

    Fuminori Ono

    Full Text Available Our previous research demonstrated that repetitive tone stimulation shortened the perceived duration of the preceding auditory time interval. In this study, we examined whether repetitive visual stimulation influences the perception of preceding visual time intervals. Results showed that a time interval followed by a high-frequency visual flicker was perceived as shorter than that followed by a low-frequency visual flicker. The perceived duration decreased as the frequency of the visual flicker increased. The visual flicker presented in one hemifield shortened the apparent time interval in the other hemifield. A final experiment showed that repetitive tone stimulation also shortened the perceived duration of preceding visual time intervals. We concluded that visual flicker shortened the perceived duration of preceding visual time intervals in the same way as repetitive auditory stimulation shortened the subjective duration of preceding tones.

  2. The relationship between task repetition and language proficiency

    Directory of Open Access Journals (Sweden)

    Ahmad Mojavezi

    2014-01-01

    Full Text Available Task repetition is now considered as an important task-based implementation variable which can affect complexity, accuracy, and fluency of L2 speech. However, in order to move towards theorizing the role of task repetition in second language acquisition, it is necessary that individual variables be taken into account. The present study aimed to investigate the way task repetition correlates with language proficiency and the differential effects that task repetition might have on the complexity, accuracy, and fluency of L2 learners with different levels of proficiency. Fifty language learners of different levels of proficiency, selected from two different language centers, participated in this study. They were asked to perform an oral narrative task twice with a one-week interval. Results revealed that, compared to the participants with lower L2 proficiency, participants with higher levels of L2 proficiency produced more complex, accurate, and fluent speech on the second encounter with the same task.

  3. The repetition effect in building and construction works

    DEFF Research Database (Denmark)

    Gottlieb, Stefan Christoffer; Haugbølle, Kim

    are then applied on the Public Transport Authorities' main account structure of units and costs, and a method for assessing the possibilities of achieving effects of repetition for each account is described. Finally, the report summarises the core conditions necessary to take into consideration in relation......This report summarises the results from the work undertaken for the Public Transport Authority on the effect of learning and repetition in building and construction works. The results are applied by the Public Transport Authority in a new budgeting model, while the agency investigates...... the establishment of a new railway between Copenhagen and Ringsted. Drawing on an extensive literature review, the effect of repetition is determined to be in the range of 6-12 %. Further, the report identifies a series of factors affecting the possibilities of achieving effects of repetition. These factors...

  4. Neural dynamics during repetitive visual stimulation

    Science.gov (United States)

    Tsoneva, Tsvetomira; Garcia-Molina, Gary; Desain, Peter

    2015-12-01

    Objective. Steady-state visual evoked potentials (SSVEPs), the brain responses to repetitive visual stimulation (RVS), are widely utilized in neuroscience. Their high signal-to-noise ratio and ability to entrain oscillatory brain activity are beneficial for their applications in brain-computer interfaces, investigation of neural processes underlying brain rhythmic activity (steady-state topography) and probing the causal role of brain rhythms in cognition and emotion. This paper aims at analyzing the space and time EEG dynamics in response to RVS at the frequency of stimulation and ongoing rhythms in the delta, theta, alpha, beta, and gamma bands. Approach.We used electroencephalography (EEG) to study the oscillatory brain dynamics during RVS at 10 frequencies in the gamma band (40-60 Hz). We collected an extensive EEG data set from 32 participants and analyzed the RVS evoked and induced responses in the time-frequency domain. Main results. Stable SSVEP over parieto-occipital sites was observed at each of the fundamental frequencies and their harmonics and sub-harmonics. Both the strength and the spatial propagation of the SSVEP response seem sensitive to stimulus frequency. The SSVEP was more localized around the parieto-occipital sites for higher frequencies (>54 Hz) and spread to fronto-central locations for lower frequencies. We observed a strong negative correlation between stimulation frequency and relative power change at that frequency, the first harmonic and the sub-harmonic components over occipital sites. Interestingly, over parietal sites for sub-harmonics a positive correlation of relative power change and stimulation frequency was found. A number of distinct patterns in delta (1-4 Hz), theta (4-8 Hz), alpha (8-12 Hz) and beta (15-30 Hz) bands were also observed. The transient response, from 0 to about 300 ms after stimulation onset, was accompanied by increase in delta and theta power over fronto-central and occipital sites, which returned to baseline

  5. The Blind Learning Aptitude Test.

    Science.gov (United States)

    Newland, T. Ernest

    A Blind Learning Aptitude Test (BLAT) was developed on the basis of sense of touch rather than on conventional experience, fine sensory discrimination, or verbal competency. From a pool of about 350 items, most of them used in testing intelligence in the sighted, a pool of 94 was selected and embossed after the manner of braille. A residual pool…

  6. The Blind as "Ordinary People".

    Science.gov (United States)

    Feinman, Saul

    1978-01-01

    Based on a paper presented at the 1977 Western Social Science Association Meeting in Denver, Colorado, the article reports on a study that compared major demographic features of a sample of 70 legally blind adults with the sighted adult sample studied in the 1975 National Opinion Research Center General Social Survey. (Author/DLS)

  7. Visual Product Identification for Blind

    Directory of Open Access Journals (Sweden)

    Krutarth Majithia

    2015-12-01

    Full Text Available This project is developed to make the life of blind people easy. This is a camera based system to scan the barcode behind the image and read the description of the product with the help of Id stored in the barcode. This is very beneficial in case of finding out the description of packaged goods to the blind people and thus helping them in deciding to purchase a product or not especially which are packaged. This is because it becomes very difficult for the blind people to distinguish between the packaged goods. In order to use this system, all the user needs to do is capture the image on the product in the mobile phone which then resolves the barcode which means it scans the image to find out the Id stored. Thus this application really benefits blind and visually impaired people and thus making their work of identifying products easy. This is very easy to use and affordable as it requires a scanner to scan the barcode and a camera phone to take the picture of the image containing the barcode. This is now easy to implement as most of the mobile phones today have the required resolution in order to scan the barcode to identify the Id stored in it and read out the product description. This project can be implemented in any shopping mall, supermarket, Book stores, Medical stores etc.

  8. Autism and exergaming: effects on repetitive behaviors and cognition

    OpenAIRE

    Anderson-Hanley C; Tureck K; Schneiderman RL

    2011-01-01

    Cay Anderson-Hanley, Kimberly Tureck, Robyn L Schneiderman Department of Psychology, Union College, Schenectady, NY, USA Abstract: Autism is a neurodevelopmental disorder that leads to impairment in social skills and delay in language development, and results in repetitive behaviors and restricted interests that impede academic and social involvement. Physical exercise has been shown to decrease repetitive behaviors in autistic children and improve cognitive function across the life-span. Ex...

  9. Breakdown behavior of electronics at variable pulse repetition rates

    OpenAIRE

    Korte, S.; H. Garbe

    2006-01-01

    The breakdown behavior of electronics exposed to single transient electromagnetic pulses is subject of investigations for several years. State-of-the-art pulse generators additionally provide the possibility to generate pulse sequences with variable pulse repetition rate. In this article the influence of this repetition rate variation on the breakdown behavior of electronic systems is described. For this purpose microcontroller systems are examined during line-led exposure to pulses with repe...

  10. Analysis of repetitive DNA in chromosomes by flow cytometry.

    Science.gov (United States)

    Brind'Amour, Julie; Lansdorp, Peter M

    2011-06-01

    We developed a flow cytometry method, chromosome flow fluorescence in situ hybridization (FISH), called CFF, to analyze repetitive DNA in chromosomes using FISH with directly labeled peptide nucleic acid (PNA) probes. We used CFF to measure the abundance of interstitial telomeric sequences in Chinese hamster chromosomes and major satellite sequences in mouse chromosomes. Using CFF we also identified parental homologs of human chromosome 18 with different amounts of repetitive DNA.

  11. Linear- and Repetitive-Feature Detection Within Remotely Sensed Imagery

    Science.gov (United States)

    2017-04-01

    1.1 Background The Army desires the ability to deliver cargo, equipment, and personnel to harsh locations almost anywhere on the planet . This...because the Hough transform is designed to look for straight linear features, which most real- life fea- tures are not. As mention previously, it is...repetitive features are differentiated based on their appearance in the images of interest; however, real- life repetitive features often corre- spond to

  12. Linear- and Repetitive Feature Detection Within Remotely Sensed Imagery

    Science.gov (United States)

    2017-04-01

    1.1 Background The Army desires the ability to deliver cargo, equipment, and personnel to harsh locations almost anywhere on the planet . This...because the Hough transform is designed to look for straight linear features, which most real- life fea- tures are not. As mention previously, it is...repetitive features are differentiated based on their appearance in the images of interest; however, real- life repetitive features often corre- spond to

  13. Brain Injury Following Repetitive Apnea in Newborn Piglets

    Science.gov (United States)

    Schears, Gregory; Creed, Jennifer; Antoni, Diego; Zaitseva, Tatiana; Greeley, William; Wilson, David F.; Pastuszko, Anna

    Repetitive apnea is associated with a significant increase in extracellular dopamine, generation of free radicals as determined by o-tyrosine formation and increase in Fluoro-Jade staining of degenerating neurons. This increase in extracellular dopamine and of hydroxyl radicals in striatum of newborn brain is likely to be at least partly responsible for the neuronal injury and neurological side effects of repetitive apnea.

  14. Illusory sensation of movement induced by repetitive transcranial magnetic stimulation

    DEFF Research Database (Denmark)

    Christensen, Mark Schram; Lundbye-Jensen, J.; Grey, M.J.;

    2010-01-01

    Human movement sense relies on both somatosensory feedback and on knowledge of the motor commands used to produce the movement. We have induced a movement illusion using repetitive transcranial magnetic stimulation over primary motor cortex and dorsal premotor cortex in the absence of limb moveme...... premotor cortex stimulation was less affected by sensory and motor deprivation than was primary motor cortex stimulation. We propose that repetitive transcranial magnetic stimulation over dorsal premotor cortex produces a corollary discharge that is perceived as movement....

  15. Ask a Scientist: What is Color Blindness?

    Medline Plus

    Full Text Available ... video series. Dr. Sheldon Miller answers questions about color blindness, whether it can be treated, and how people ... an optical illusion? Click to Watch What is color blindness? Click to Watch How do I become a ...

  16. Blinding in randomized clinical trials: imposed impartiality

    DEFF Research Database (Denmark)

    Hróbjartsson, A; Boutron, I

    2011-01-01

    Blinding, or "masking," is a crucial method for reducing bias in randomized clinical trials. In this paper, we review important methodological aspects of blinding, emphasizing terminology, reporting, bias mechanisms, empirical evidence, and the risk of unblinding. Theoretical considerations...

  17. Elliptic Curve Blind Digital Signature Schemes

    Institute of Scientific and Technical Information of China (English)

    YOULin; YANGYixian; WENQiaoyan

    2003-01-01

    Blind signature schemes are important cryptographic protocols in guaranteeing the privacy or anonymity of the users.Three new blind signature schemes and their corresponding generalizations are pro-posed. Moreover, their securities are simply analyzed.

  18. The Concept and Operations of Blind Number

    Institute of Scientific and Technical Information of China (English)

    PANG Yan-jun; LIU Kai-di; ZHANG Bo-wen

    2001-01-01

    This paper gives the definition and operations of blind number, and discusses its operationproperties. Blind number is a mathematical tool to express and deal with complex information with severalkinds of uncertainty.

  19. Ask a Scientist: What is Color Blindness?

    Medline Plus

    Full Text Available ... Illusions Printables Ask a Scientist Video Series Why can’t you see colors well in the dark? ... Miller answers questions about color blindness, whether it can be treated, and how people become color blind. ...

  20. Grade repetition in primary school from teachers’ perspective

    Directory of Open Access Journals (Sweden)

    Malinić Dušica

    2011-01-01

    Full Text Available School underachievement is exhibited gradually, in different forms, while grade repetition figures as one of the most prominent forms of underachievement. In order to observe this phenomenon from different perspectives, we conducted a research aimed at identifying teacher attitudes towards grade repetition and grade repeaters in primary school, based on their perceptions of: (a the cause of grade repetition; (b the responsibility for grade repetition and (c grade repetition as an educational measure. The administered questionnaire was constructed for the purposes of the research, descriptive statistics was used, and data were obtained on the sample of 136 teachers from 31 primary schools from the territory of the City of Belgrade. The results point out to the conclusion that teachers perceive grade repetition as, first and foremost, the consequence of students’ lack of interest in school and learning and undisciplined behavior in class. By treating student underachievement mainly as a consequence of laziness, lack of motivation and insufficient effort, teachers transfer responsibility to others, assessing that the personal degree of responsibility for the underachievement of their students is very low. The responsibility for underachievement is perceived more as a problem of the student, his/her family, peer group, than as the problem of teachers themselves. The concluding part points out to certain teaching procedures and methods that have proved to be useful in the prevention of student underachievement.

  1. Properties of water surface discharge at different pulse repetition rates

    Energy Technology Data Exchange (ETDEWEB)

    Ruma,; Yoshihara, K. [Graduate School of Science and Technology, Kumamoto University, Kumamoto 860-8555 (Japan); Hosseini, S. H. R., E-mail: hosseini@kumamoto-u.ac.jp; Sakugawa, T.; Akiyama, H. [Graduate School of Science and Technology, Kumamoto University, Kumamoto 860-8555 (Japan); Institute of Pulsed Power Science, Kumamoto University, Kumamoto 860-8555 (Japan); Akiyama, M. [Department of Electrical and Electronic Engineering, Kagoshima University, Kagoshima 890-0065 (Japan); Lukeš, P. [Institute of Plasma Physics, AS CR, Prague, Prague 18200 (Czech Republic)

    2014-09-28

    The properties of water surface discharge plasma for variety of pulse repetition rates are investigated. A magnetic pulse compression (MPC) pulsed power modulator able to deliver pulse repetition rates up to 1000 Hz, with 0.5 J per pulse energy output at 25 kV, was used as the pulsed power source. Positive pulse with a point-to-plane electrode configuration was used for the experiments. The concentration and production yield of hydrogen peroxide (H₂O₂) were quantitatively measured and orange II organic dye was treated, to evaluate the chemical properties of the discharge reactor. Experimental results show that the physical and chemical properties of water surface discharge are not influenced by pulse repetition rate, very different from those observed for under water discharge. The production yield of H₂O₂ and degradation rate per pulse of the dye did not significantly vary at different pulse repetition rates under a constant discharge mode on water surface. In addition, the solution temperature, pH, and conductivity for both water surface and underwater discharge reactors were measured to compare their plasma properties for different pulse repetition rates. The results confirm that surface discharge can be employed at high pulse repetition rates as a reliable and advantageous method for industrial and environmental decontamination applications.

  2. Poverty and blindness in Africa.

    Science.gov (United States)

    Naidoo, Kovin

    2007-11-01

    Africa carries a disproportionate responsibility in terms of blindness and visual impairment. With approximately 10 per cent of the world's population, Africa has 19 per cent of the world's blindness. It is no surprise that this reality also mirrors the situation in terms of the burden of world poverty. There is an increasing recognition of the need to highlight the link between poverty, development and health care. Blindness, disabling visual impairment and the overall lack of eye-care services are too often the result of social, economic and developmental challenges of the developing world. The state of eye care in Africa stands in alarming contrast to that in the rest of the world. Poor practitioner-to-patient ratios, absence of eye-care personnel, inadequate facilities, poor state funding and a lack of educational programs are the hallmarks of eye care in Africa, with preventable and treatable conditions being the leading cause of blindness. Eye diseases causing preventable blindness are often the result of a combination of factors such as poverty, lack of education and inadequate health-care services. The challenge that Vision 2020 has set itself in Africa is enormous. Africa is not a homogenous entity, the inter- and intra-country differences in economic development, prevalence of disease, delivery infrastructure and human resources amplify the challenges of meeting eye-care needs. The successful implementation of Vision 2020 programs will be hindered without the development of a comprehensive, co-ordinated strategy that is cognisant of the differences that exist and the need for comprehensive solutions that are rooted in the economic and political realities of the continent as well as the individual countries and regions within countries. This strategy should recognise the need for economic growth that results in greater state funded eye-care services that focus on health promotion to ensure the prevention of eye disease, the development of eye clinics in

  3. Speaking Clearly for the Blind: Acoustic and Articulatory Correlates of Speaking Conditions in Sighted and Congenitally Blind Speakers.

    Science.gov (United States)

    Ménard, Lucie; Trudeau-Fisette, Pamela; Côté, Dominique; Turgeon, Christine

    2016-01-01

    Compared to conversational speech, clear speech is produced with longer vowel duration, greater intensity, increased contrasts between vowel categories, and decreased dispersion within vowel categories. Those acoustic correlates are produced by larger movements of the orofacial articulators, including visible (lips) and invisible (tongue) articulators. Thus, clear speech provides the listener with audible and visual cues that are used to increase the overall intelligibility of speech produced by the speaker. It is unclear how those cues are produced by visually impaired speakers who never had access to vision. In this paper, we investigate the acoustic and articulatory correlates of vowels in clear versus conversational speech, and in sighted and congenitally blind speakers. Participants were recorded using electroarticulography while producing multiple repetitions of the ten Quebec French oral vowels in carrier sentences in both speaking conditions. Articulatory variables (lip, jaw, and tongue positions) as well as acoustic variables (contrasts between vowels, within-vowel dispersion, pitch, duration, and intensity) were measured. Lip movements were larger when going from conversational to clear speech in sighted speakers only. On the other hand, tongue movements were affected to a larger extent in blind speakers compared to their sighted peers. These findings confirm that vision plays an important role in the maintenance of speech intelligibility.

  4. Speaking Clearly for the Blind: Acoustic and Articulatory Correlates of Speaking Conditions in Sighted and Congenitally Blind Speakers

    Science.gov (United States)

    Ménard, Lucie; Trudeau-Fisette, Pamela; Côté, Dominique; Turgeon, Christine

    2016-01-01

    Compared to conversational speech, clear speech is produced with longer vowel duration, greater intensity, increased contrasts between vowel categories, and decreased dispersion within vowel categories. Those acoustic correlates are produced by larger movements of the orofacial articulators, including visible (lips) and invisible (tongue) articulators. Thus, clear speech provides the listener with audible and visual cues that are used to increase the overall intelligibility of speech produced by the speaker. It is unclear how those cues are produced by visually impaired speakers who never had access to vision. In this paper, we investigate the acoustic and articulatory correlates of vowels in clear versus conversational speech, and in sighted and congenitally blind speakers. Participants were recorded using electroarticulography while producing multiple repetitions of the ten Quebec French oral vowels in carrier sentences in both speaking conditions. Articulatory variables (lip, jaw, and tongue positions) as well as acoustic variables (contrasts between vowels, within-vowel dispersion, pitch, duration, and intensity) were measured. Lip movements were larger when going from conversational to clear speech in sighted speakers only. On the other hand, tongue movements were affected to a larger extent in blind speakers compared to their sighted peers. These findings confirm that vision plays an important role in the maintenance of speech intelligibility. PMID:27643997

  5. Partially Blind Signatures Based on Quantum Cryptography

    Science.gov (United States)

    Cai, Xiao-Qiu; Niu, Hui-Fang

    2012-12-01

    In a partially blind signature scheme, the signer explicitly includes pre-agreed common information in the blind signature, which can improve the availability and performance. We present a new partially blind signature scheme based on fundamental properties of quantum mechanics. In addition, we analyze the security of this scheme, and show it is not possible to forge valid partially blind signatures. Moreover, the comparisons between this scheme and those based on public-key cryptography are also discussed.

  6. Tactile maze solving in congenitally blind individuals

    DEFF Research Database (Denmark)

    Gagnon, Léa; Kupers, Ron; Schneider, Fabien C;

    2010-01-01

    Vision is undoubtedly important for navigation although not essential as blind individuals outperform their blindfolded seeing counterparts in a variety of navigational tasks. It is believed that the blind's superior performance is because of their efficient use of proprioceptive signals and envi......Vision is undoubtedly important for navigation although not essential as blind individuals outperform their blindfolded seeing counterparts in a variety of navigational tasks. It is believed that the blind's superior performance is because of their efficient use of proprioceptive signals...

  7. Preparation and Structural Characterization of Superionic Conductor RbAg4I5 Crystalline Grain Film

    Institute of Scientific and Technical Information of China (English)

    曹阳; 孙红三; 孙家林; 田广彦; 邢志; 郭继华

    2003-01-01

    Superionic conductor RbAg4I5 crystalline grainfilms were prepared by vacuum thermal evaporation on NaCl crystalline substrates. The surface morphology, microstructure and the electronic energy states of the films were examined by atomic force microscopy, transmission-electron microscopy, x-ray diffraction and x-ray photoelectron spectroscopy. The results show that the obtained RbAg4I5 layer has an epitaxial film of perfect crystalline structure, and the unit cell of crystalline grain RbAg4I5 films belongs to cubic crystal system. The principal x-ray diffraction peaks at d = 3.7447 and 1.8733A are related to the structure of ternary compound RbAg4I5films.

  8. Preparation and Structural Characterization of Superionic Conductor RbAg4I5 Crystalline Grain Film

    Science.gov (United States)

    Cao, Yang; Sun, Hong-San; Sun, Jia-Lin; Tian, Guang-Yan; Xing, Zhi; Guo, Ji-Hua

    2003-05-01

    Superionic conductor RbAg4I5 crystalline grain films were prepared by vacuum thermal evaporation on NaCl crystalline substrates. The surface morphology, microstructure and the electronic energy states of the films were examined by atomic force microscopy, transmission-electron microscopy, x-ray diffraction and x-ray photoelectron spectroscopy. The results show that the obtained RbAg4I5 layer has an epitaxial film of perfect crystalline structure, and the unit cell of crystalline grain RbAg4I5 films belongs to cubic crystal system. The principal x-ray diffraction peaks at d = 3.7447 and 1.8733 Å are related to the structure of ternary compound RbAg4I5 films.

  9. Observation of hyperfine interaction in photoassociation spectra of ultracold RbYb

    Science.gov (United States)

    Bruni, C.; Görlitz, A.

    2016-08-01

    We report on the creation of ultracold heteronuclear and electronically excited Rb*Yb molecules in a hybrid conservative trap by photoassociation of ultracold 87Rb and 176Yb. The molecules are formed below the Rb5 p 1(1/2 2P)+Yb6 s 2(S10) dissociation limit and the resonances are detected using trap-loss spectroscopy. By addressing vibrational levels with binding energies down to EB=-h ×2.2 THz , we study the change in hyperfine coupling of the diatomic molecule as a function of internuclear separation. We observe a decreasing hyperfine splitting for more tightly bound excited molecular states where the hyperfine splitting is reduced by more than 30 % compared to the atomic value for 87Rb.

  10. Generation of continuous-wave and pulsed squeezed light with $^{87}$Rb vapor

    CERN Document Server

    Agha, Imad H; Grangier, Philippe

    2009-01-01

    We present experimental studies on the generation of squeezed vacuum via nonlinear ellipse rotation in a $^{87}$Rb vapor. Squeezing is observed for a wide range of input powers and pump detunings on the D1 line, while only excess noise is present on the D2 line. The maximum squeezing observed is -1.4 $\\pm$0.1 dB (-2.0 dB corrected for loss). We measure -1.1 dB squeezing at the resonance frequency of the $^{85}$Rb $F=2 \\to F'=3$ transition, which may allow the storage of squeezed light generated by $^{87}$Rb in a $^{85}$Rb quantum memory. We also demonstrate a proof of principle pulsed squeezed light experiment, with -1 dB of squeezing for 200 ns pulse width.

  11. Non-centrosymmetric Rb2Mn2(MoO43

    Directory of Open Access Journals (Sweden)

    Chahira Bouzidi

    2014-07-01

    Full Text Available The title compound, dirubidium dimanganese(II tris(tetraoxomolybdate, Rb2Mn2(MoO43, was prepared by solid-state reactions. The structure can be described as being composed of MnO6 octahedra sharing corners with MoO4 tetrahedra. The three-dimensional framework contains cavities in which the rubidium ions are located. The Rb+ cations are within distorted nine- and 12-vertex polyhedra. The pairs of different Mn2+ and Rb+ cations are each located on threefold rotation axes.. Rb2Mn2(MoO43 is isotypic with compounds of the Cs2M2Mo3O12 (M = Ni, Fe family. A comparative structural description is provided between the structure of the title compound and those of related phases. Differences with structures such as alluaudite are discussed.

  12. pRb controls estrogen receptor alpha protein stability and activity.

    Science.gov (United States)

    Caligiuri, Isabella; Toffoli, Giuseppe; Giordano, Antonio; Rizzolio, Flavio

    2013-06-01

    A cross talk between the Estrogen Receptor (ESR1) and the Retinoblastoma (pRb) pathway has been demonstrated to influence the therapeutic response of breast cancer patients but the full mechanism remains poorly understood. Here we show that the N-terminal domain of pRb interacts with the CD domain of ESR1 to allow for the assembly of intermediate complex chaperone proteins HSP90 and p23. We demonstrated that a loss of pRb in human/mouse breast cells decreases the expression of the ESR1 protein through the proteasome pathway. Our work reveals a novel regulatory mechanism of ESR1 basal turnover and activity and an unanticipated relationship with the pRb tumor suppressor.

  13. Antitumor mechanisms when pRb and p53 are genetically inactivated.

    Science.gov (United States)

    Zhu, L; Lu, Z; Zhao, H

    2015-08-27

    pRb and p53 are the two major tumor suppressors. Their inactivation is frequent when cancers develop and their reactivation is rationale of most cancer therapeutics. When pRb and p53 are genetically inactivated, cells irreparably lose the antitumor mechanisms afforded by them. Cancer genome studies document recurrent genetic inactivation of RB1 and TP53, and the inactivation becomes more frequent in more advanced cancers. These findings may explain why more advanced cancers are more likely to resist current therapies. Finding successful treatments for more advanced and multi-therapy-resistant cancers will depend on finding antitumor mechanisms that remain effective when pRb and p53 are genetically inactivated. Here, we review studies that have begun to make progress in this direction.

  14. Data of evolutionary structure change: 1E1RB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RB-2HLDT 1E1R 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...T 2HLDT ALKQVAGSLKLFL2HLD T 2HLDT VAAFAQDLDAST

  15. Delayed neutron studies of separated isotopes of Br, Rb, I, and Cs

    CERN Document Server

    Reeder, R L; Wright, J F

    1976-01-01

    Discusses delayed neutron studies of separated isotopes of Br, Rb, I, and Cs are currently in progress at the Spectrometer for On-Line Analysis of Radionuclides (SOLAR) facility operated by Battelle, Pacific Northwest Laboratories. (2 refs).

  16. Decoupled Rb-Sr and Sm-Nd isotopic evolution of the continental crust

    Science.gov (United States)

    Goldstein, S. L.

    1988-01-01

    Evidence was presented that the Rb-Sr and Sm-Nd isotopic systems are decoupled in crust-mantle evolution. Rare earth element (including Sm and Nd) residue principally in silicates, and are resistant to mobilization by weathering and metamorphism. In contrast, Rb and Sr are easily fractionated by crustal processes and residue in carbonates as well as in silicates. As a result, continental Sr, but not Nd, can be recycled into the mantle by exchange of seawater with basalt at spreading ridges and by subduction of carbonates associated with ridge processes. These effects result in mean Rb-Sr ages of the continental crust and of the upper mantle that are too young. Crustal growth curves based largely on Rb-Sr data, such that of Hurley and Rand, are therefore incorrect.

  17. Thermodynamic properties of solid face centered cubic Rb3C60 at high temperature and pressure

    Science.gov (United States)

    Yang, W.; Sun, J. X.; Liu, H.; Yan, G. F.

    2014-03-01

    Analytic equation of state and thermodynamic quantities of solid fcc Rb3C60 are derived by using an analytic mean field potential method. For intermolecular forces, the double-exponential potential is utilized. Four potential parameters are determined by fitting experimental compression data of Rb3C60 up to 14 GPa at 296 K. Various physical quantities including isothermals, thermal expansion, isochoric heat capacity, Helmholtz free energy and internal energy are calculated and analyzed. Calculated results are consistent with available experimental data in literature. Furthermore, spinodal temperature for Rb3C60 is found to be 2,860 K. Results verify that analytic mean field potential method is a useful approach to consider the anharmonic effect at high temperatures. Numerous reasonable predictions and the change trend of the properties for Rb3C60 at high temperature and pressure have been given.

  18. Measurement of the Spin-Dipolar Part of the Tensor Polarizability of Rb 87

    Science.gov (United States)

    Dallal, Yehonatan; Ozeri, Roee

    2015-10-01

    We report on the measurement of the contribution of the magnetic-dipole hyperfine interaction to the tensor polarizaility of the electronic ground state in Rb 87 . This contribution was isolated by measuring the differential shift of the clock transition frequency in Rb 87 atoms that were optically trapped in the focus of an intense CO2 laser beam. By comparing to previous tensor polarizability measurements in Rb 87 , the contribution of the interaction with the nuclear electric-quadrupole moment was isolated as well. Our measurement will enable better estimation of blackbody shifts in Rb atomic clocks. The methods reported here are applicable for future spectroscopic studies of atoms and molecules under strong quasistatic fields.

  19. R.B. Kitaj (1932-2007: Warburgian Artist

    Directory of Open Access Journals (Sweden)

    Chaney, Edward

    2013-12-01

    Full Text Available This essay examines the influence of Aby Warburg and the Warburg Institute, as mediated by Edgar Wind, on R.B. Kitaj from the late 1950s until his death in 2007. It is based on research in the National Portrait Gallery, the Warburg Institute Archive, the Wind archives in Oxford, Kitaj’s unpublished autobiography and correspondence between the author and the artist dating back to 1972. It explores Kitaj’s creative response to Warburg’s brand of cultural history which encouraged his early eschewal of the prevailing focus upon formal values in favour of ‘symbolic images’ and suggestive content. This tendency was enhanced by his increasing celebration of his Jewishness and aspirations towards the creation of ‘a Jewish art like the Egyptian figurative style’. Kitaj’s portrait of Ernst Gombrich (1986 was commissioned by the National Portrait Gallery at a time when he was becoming obsessed with his Jewish project while Gombrich was confirming his rejection of the category Jewish, in other than a religious context, altogether. Discussion of Jewishness and the arts in the twentieth century is supplemented by the identification of David Allan’s Origin of Painting (done in Italy in 1775 as the inspiration for Kitaj’s Los Angeles series of pictures in which his late, lamented wife is depicted as the Hebrew deity, Shekinah.

  20. Effects of Ginsenoside Rb1 on Skin Changes

    Directory of Open Access Journals (Sweden)

    Yoshiyuki Kimura

    2012-01-01

    Full Text Available Ginseng roots (Panax ginseng CA Meyer have been used traditionally for the treatment, especially prevention, of various diseases in China, Korea, and Japan. Both experimental and clinical studies suggest ginseng roots to have pharmacological effects in patients with life-style-related diseases such as non-insulin-dependent diabetic mellitus, atherosclerosis, hyperlipidemia, and hypertension. The topical use of ginseng roots to treat skin complaints including atopic suppurative dermatitis, wounds, and inflammation is also described in ancient Chinese texts; however, there have been relatively few studies in this area. In the present paper, we describe introduce the biological and pharmacological effects of ginsenoside Rb1 isolated from Red ginseng roots on skin damage caused by burn-wounds using male Balb/c mice (in vivo and by ultraviolet B irradiation using male C57BL/6J and albino hairless (HR-1 mice (in vivo. Furthermore, to clarify the mechanisms behind these pharmacological actions, human primary keratinocytes and the human keratinocyte cell line HaCaT were used in experiments in vitro.

  1. Continuous Vibrational Cooling of Ground State Rb2

    Science.gov (United States)

    Tallant, Jonathan; Marcassa, Luis

    2014-05-01

    The process of photoassociation generally results in a distribution of vibrational levels in the electronic ground state that is energetically close to the dissociation limit. Several schemes have appeared that aim to transfer the population from the higher vibrational levels to lower ones, especially the ground vibrational state. We demonstrate continuous production of vibrationally cooled Rb2 using optical pumping. The vibrationally cooled molecules are produced in three steps. First, we use a dedicated photoassociation laser to produce molecules in high vibrational levels of the X1Σg+ state. Second, a broadband fiber laser at 1071 nm is used to transfer the molecules to lower vibrational levels via optical pumping through the A1Σu+ state. This process transfers the molecules from vibrational levels around ν ~= 113 to a distribution of levels where ν superluminescent diode near 685 nm that has its frequency spectrum shaped. The resulting vibrational distributions are probed using resonance-enhanced multiphoton ionization with a pulsed dye laser near 670 nm. The results are presented and compared with theoretical simulations. This work was supported by Fapesp and INCT-IQ.

  2. Blackbody radiation shift in the Rb87 frequency standard

    Science.gov (United States)

    Safronova, M. S.; Jiang, Dansha; Safronova, U. I.

    2010-08-01

    The operation of atomic clocks is generally carried out at room temperature, whereas the definition of the second refers to the clock transition in an atom at absolute zero. This implies that the clock transition frequency should be corrected in practice for the effect of finite temperature, of which the leading contributor is the blackbody radiation (BBR) shift. Experimental measurements of the BBR shifts are difficult. In this work, we have calculated the blackbody radiation shift of the ground-state hyperfine microwave transition in Rb87 using the relativistic all-order method and carried out a detailed evaluation of the accuracy of our final value. Particular care is taken to accurately account for the contributions from highly excited states. Our predicted value for the Stark coefficient, kS=-1.240(4)×10-10Hz/(V/m)2, is three times more accurate than the previous calculation [E. J. Angstman, V. A. Dzuba, and V. V. Flambaum, Phys. Rev. APLRAAN1050-294710.1103/PhysRevA.74.023405 74, 023405 (2006)].

  3. Signature splitting inversion and backbending in 80Rb

    CERN Document Server

    He, Chuangye; Wen, Shuxian; Zhu, Lihua; Wu, Xiaoguang; Li, Guangsheng; Zhao, Yue; Yan, Yupeng; Bai, Zhijun; Wu, Yican; Li, Yazhou; Li, Gui; Yan, Shiwei; Oshima, M; Toh, Y; Osa, A; Koizumi, M; Hatsukawa, Y; Matsuda, M; Hagakawa, T

    2012-01-01

    High spin states of 80Rb are studied via the fusion-evaporation reactions 65Cu+19F, 66Zn+18O and 68Zn+16O with the beam energies of 75 MeV, 76 MeV and 80 MeV, respectively. Twenty-three new states with twenty-eight new \\gamma transitions were added to the previously proposed level scheme, where the second negative-parity band is significantly pushed up to spins of 22^{-} and 15^{-} and two new sidebands are built on the known first negative-parity band. Two successive band crossings with frequencies 0.51 MeV and 0.61 MeV in the \\alpha=0 branch as well as another one in the \\alpha=1 branch of the second negative-parity band are observed for the first time. Signature inversions occur in the positive- and first negative-parity bands at the spins of 11\\hbar and 15\\hbar, respectively. The signature splitting is seen obviously in the second negative-parity band, but the signature inversion is not observed. It is also found that the structure of the two negative-parity bands is similar to that of its isotone ^{82}Y....

  4. Microbiological Transform Ginsenoside Rb1 into Rg3%微生物转化人参皂苷Rb1为Rg3的研究

    Institute of Scientific and Technical Information of China (English)

    白龙律; 臧蕴霞; 尹成日

    2009-01-01

    利用18种菌株对人参皂苷Rb1进行生物转化研究,发现一种绿毛状GY-06菌使人参皂苷Rb1有效地转化为Rg3.经形态学和内转录间隔区(internal transcribed spacer, ITS)基因序列分析,确定其为一种扩展青霉(Penicillium expansum).

  5. 微生物转化人参皂苷Rb1为C-K的研究%Microbiological Transformation of Ginsenoside Rb1 into C-K

    Institute of Scientific and Technical Information of China (English)

    金艳; 尹成日; 金恩华

    2010-01-01

    利用23种菌株对人参皂苷Rb1进行生物转化研究,发现一种灰绿毛状GH-9菌株使人参皂苷Rb1有效地转化为C-K.经形态学和内转录间隔区(intemal transcribed spacer,ITS)基因序列分析,该菌株属于青霉属(Penicillium),且接近于Penicillium dipodomyicola.

  6. BLIND ADAPTIVE XPIC BASED ON HOS

    Institute of Scientific and Technical Information of China (English)

    Fu Haiyang; Yang Longxiang; Peng Jianglong

    2001-01-01

    This paper presents a new blind XPIC and a new adaptive blind deconvolutional algorithm based on HOS processing, which separates and equalizes the signals in real time. The simulation results demonstrate that the performance of the proposed adaptive blind algorithm,compared with the conventional algorithms, is outstanding with the feature of feasibility, stability and fast convergence rate.

  7. Occupant satisfaction with two blind control strategies

    DEFF Research Database (Denmark)

    Karlsen, Line Røseth; Heiselberg, Per Kvols; Bryn, Ida

    2015-01-01

    Highlights •Occupant satisfaction with two blind control strategies has been studied. •Control based on cut-off position of slats was more popular than closed slats. •Results from the study are helpful in development of control strategies for blinds. •The results give indications of how blinds...

  8. Psychomotor Development for the Deaf-Blind.

    Science.gov (United States)

    Sherrill, Claudine

    The stages of psychomotor development in deaf blind children and youth are reviewed, and educational principles to guide psychomotor development programs for the deaf blind are outlined. Etiological factors which contribute to the psychomotor development of deaf blind persons are discussed including nonambulation and sensory deprivation, heart…

  9. A subset of malignant phyllodes tumors harbors alterations in the Rb/p16 pathway

    OpenAIRE

    Cimino-Mathews, Ashley; Hicks, Jessica L.; Sharma, Rajni; Vang, Russell; Illei, Peter B; De Marzo, Angelo; Emens, Leisha A.; Argani, Pedram

    2013-01-01

    Breast phyllodes tumors are fibroepithelial neoplasms with variable risk of aggressive local recurrence and distant metastasis, and the molecular pathogenesis is unclear. Here, we systematically study p16 and Rb expression in 34 phyllodes tumors in relation to proliferation. Tissue microarrays were constructed from 10 benign, 10 borderline, and 14 malignant phyllodes (5 cores/tumor) and from 10 fibroadenomas (2 cores/tumor). Tissue microarrays were labeled by immunohistochemistry for p16, Rb,...

  10. Transcriptional activation by pRB and its coordination with SWI/SNF recruitment.

    Science.gov (United States)

    Flowers, Stephen; Beck, George R; Moran, Elizabeth

    2010-11-01

    A central question in cancer biology is why most tumor susceptibility genes are linked with only limited types of cancer. Human germ-line mutation of the retinoblastoma susceptibility gene Rb1 is closely linked with just retinoblastoma and osteosarcoma, although the gene is universally expressed. Functional analysis of pRB and its close relatives, p107 and p130, has largely focused on their roles in repression of proliferation across all tissue types, but genetic evidence indicates an active requirement for pRB in osteoblast differentiation that correlates more directly with osteosarcoma susceptibility. Still, potential promoter targets of pRB and its role in normally differentiating osteoblasts remain insufficiently characterized. Here, an early marker of osteoblast differentiation, alkaline phosphatase, is identified as a direct promoter activation target of pRB. One role of pRB on this promoter is to displace the histone lysine demethylase KDM5A, thereby favoring trimethylation of H3K4, a promoter activation mark. A major new aspect of pRB-mediated transcriptional activation revealed in this promoter analysis is its role in recruitment of an activating SWI/SNF chromatin-remodeling complex. SWI/SNF is a critical coordinator of tissue-specific gene expression. In osteoblasts, SWI/SNF complexes containing the BRM ATPase repress osteoblast-specific genes to maintain the precursor state, whereas the alternative ATPase BRG1 distinguishes an activating SWI/SNF complex necessary for RNA polymerase-II recruitment. A switch from BRM to BRG1 on the alkaline phosphatase promoter marks the onset of differentiation and is accomplished in a precise two-step mechanism. Dissociation of BRM-containing SWI/SNF depends on p300, and association of BRG1-containing SWI/SNF depends on pRB.

  11. HPV infection and the alterations of the pRB pathway in oral carcinogenesis.

    Science.gov (United States)

    Lim, Kue Peng; Hamid, Sharifah; Lau, Shin-Hin; Teo, Soo-Hwang; Cheong, Sok Ching

    2007-06-01

    Inactivation of the retinoblastoma (pRB) pathway is a common event in oral squamous cell carcinoma particularly through the aberrant expression of the components within this pathway. This study examines the alterations of molecules within the pRB pathway by looking at the presence of homozygous deletions in p16(INK4A) and the expression patterns of pRB, cyclin D1 and CDK4, as well as the presence of human papillomavirus (HPV) in our samples. In our study, 5/20 samples demonstrated deletions of p16(INK4A) exon 1alpha. pRB overexpression was found in 20/20 samples, the expression was mainly observed in all layers of the epithelia, particularly in the basal layer where cells are actively dividing and aberrant pRB expression was found in 12/20 samples. Cyclin D1 and CDK4 overexpression was detected in 6/20 and 2/20 samples respectively in comparison to hyperplasias where both proteins were either not expressed or expressed at minimal levels (pRB pathway, however, we did not find any significant relationship between the presence of HPV, homozygous deletion of p16(INK4A) and overexpression of pRB, cyclin D1 and CDK4. Collectively, this data demonstrates that alterations in the pRB pathway are a common event and involve the aberration of more than one molecule within the pathway. Furthermore, the involvement of HPV in all our samples suggests that HPV infection may play an important role in oral carcinogenesis.

  12. Mutational analysis of the RB1 gene and the inheritance patterns of retinoblastoma in Jordan.

    Science.gov (United States)

    Yousef, Yacoub A; Tbakhi, Abdelghani; Al-Hussaini, Maysa; AlNawaiseh, Ibrahim; Saab, Ala; Afifi, Amal; Naji, Maysa; Mohammad, Mona; Deebajah, Rasha; Jaradat, Imad; Sultan, Iyad; Mehyar, Mustafa

    2017-08-12

    Retinoblastoma (RB) is a childhood cancer developing in the retina due to RB1 pathologic variant. Herein we are evaluating the oncogenic mutations in the RB1 gene and the inheritance patterns of RB in the Jordanian patients. In this prospective study, the peripheral blood of 50 retinoblastoma patients was collected, genomic DNA was extracted, mutations were identified using Quantitative multiplex PCR (QM-PCR), Allele-specific PCR, Next Generation Sequencing analysis, and Sanger sequencing. In this cohort of 50 patients, 20(40%) patients had unilateral RB and 30(60%) were males. Overall, 36(72%) patients had germline disease, 17(47%) of whom had the same RB1 pathologic variant detected in one of the parents (inherited disease). In the bilateral group, all (100%) patients had germline disease; 13(43%) of them had inherited mutation. In the unilateral group, 6(30%) had germline disease, 4(20%) of them had inherited mutation. Nonsense mutation generating a stop codon and producing a truncated non-functional protein was the most frequent detected type of mutations (n = 15/36, 42%). Only one (2%) of the patients had mosaic mutation, and of the 17 inherited cases, 16(94%) had an unaffected carrier parent. In conclusion, in addition to all bilateral RB patients in our cohort, 30% of unilateral cases showed germline mutation. Almost half (47%) of germline cases had inherited disease from affected (6%) parent or unaffected carrier (94%). Therefore molecular screening is critical for the genetic counseling regarding the risk for inherited RB in both unilateral and bilateral cases including those with no family history.

  13. Rb and p53 Liver Functions Are Essential for Xenobiotic Metabolism and Tumor Suppression.

    Directory of Open Access Journals (Sweden)

    Sathidpak Nantasanti

    Full Text Available The tumor suppressors Retinoblastoma (Rb and p53 are frequently inactivated in liver diseases, such as hepatocellular carcinomas (HCC or infections with Hepatitis B or C viruses. Here, we discovered a novel role for Rb and p53 in xenobiotic metabolism, which represent a key function of the liver for metabolizing therapeutic drugs or toxins. We demonstrate that Rb and p53 cooperate to metabolize the xenobiotic 3,5-diethoxycarbonyl-1,4-dihydrocollidine (DDC. DDC is metabolized mainly by cytochrome P450 (Cyp3a enzymes resulting in inhibition of heme synthesis and accumulation of protoporphyrin, an intermediate of heme pathway. Protoporphyrin accumulation causes bile injury and ductular reaction. We show that loss of Rb and p53 resulted in reduced Cyp3a expression decreased accumulation of protoporphyrin and consequently less ductular reaction in livers of mice fed with DDC for 3 weeks. These findings provide strong evidence that synergistic functions of Rb and p53 are essential for metabolism of DDC. Because Rb and p53 functions are frequently disabled in liver diseases, our results suggest that liver patients might have altered ability to remove toxins or properly metabolize therapeutic drugs. Strikingly the reduced biliary injury towards the oxidative stress inducer DCC was accompanied by enhanced hepatocellular injury and formation of HCCs in Rb and p53 deficient livers. The increase in hepatocellular injury might be related to reduce protoporphyrin accumulation, because protoporphrin is well known for its anti-oxidative activity. Furthermore our results indicate that Rb and p53 not only function as tumor suppressors in response to carcinogenic injury, but also in response to non-carcinogenic injury such as DDC.

  14. From" Televised Blind Date” to" Televised Half-blind Wedding”

    Institute of Scientific and Technical Information of China (English)

    倪俊

    2001-01-01

    @@ A couple of weeks ago I happened to see on TV how American young men and women go out on "blind dates” , arranged by a television station. It is interesting to see how a young man and a young woman enjoy playing, dining or chatting with each other happily and naturally before a TV camera, even though they have never known or met with each other before. Yesterday evening one of the biggest national TV stations, FOX by name, made another bold try by broadcasting live a "half-blind wedding” to the whole country. It is such an original and also absurd idea that 1 think only American television-men can have figured it out and carried it out.

  15. From "Televised Blind Date" to "Televised Half-blind Wedding"

    Institute of Scientific and Technical Information of China (English)

    倪俊

    2001-01-01

    A couple of weeks ago I happened to see on TV how American young men and women go out on "blind dates", arranged by a television station, It is interesting to see bow a young man and a young woman enjoy playing, dining or chatting with each other happily and naturally before a TV camera, even though they have never known or met with each other before. Yesterday evening one of the biggest national TV stations, FOX by name, made another bold try by broadcasting live a "half-blind wedding" to the whole country. It is such an original and also absurd idea that I think only American television-men can have figured it out and carried it out. In the beginning, the directors of FOX put ads in newspapers, openly asking the public: "Who wants to marry a multi-millionaire?" It did not cost much time or

  16. Rb and p53 gene deletions in lung adenocarcinomas from irradiated and control mice

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.; Woloschak, G.E. [Argonne National Lab., IL (United States). Center for Mechanistic Biology and Biotechnology

    1997-08-01

    This study was conducted on mouse lung adenocarcinoma tissues that were formalin-treated and paraffin-embedded 25 years ago to investigate the large gene deletions of mRb and p53 in B6CF{sub 1} male mice. A total of 80 lung tissue samples from irradiated mice and 40 lung samples from nonirradiated controls were randomly selected and examined in the mRb portion of this study. The results showed a significant (P < 0.05) higher percentage of mRb deletions in lung adenocarcinomas from mice exposed to 60 once-weekly {gamma}-ray doses than those from mice receiving 24 once-weekly {gamma}-ray doses at low doses and low dose rates; however, the percentage was not significantly different (P > 0.05) from that for spontaneous lung adenocarcinomas or lung adenocarcinomas from mice exposed to single-dose {gamma} irradiation at a similar total dose. mRb fragments 3 (71%) and 5 (67%), the parts of the gene that encoded the pocket binding region of Rb protein to adenovirus E1A and SV40 T-antigen, were the most frequently deleted fragments. p53 gene deletion analysis was carried out on normal lungs and lung adenocarcinomas that were initially found to bear mRb deletions. Exons 1,4,5,6, and 9 were chosen to be analyzed.

  17. Loss of pRB causes centromere dysfunction and chromosomal instability.

    Science.gov (United States)

    Manning, Amity L; Longworth, Michelle S; Dyson, Nicholas J

    2010-07-01

    Chromosome instability (CIN) is a common feature of tumor cells. By monitoring chromosome segregation, we show that depletion of the retinoblastoma protein (pRB) causes rates of missegregation comparable with those seen in CIN tumor cells. The retinoblastoma tumor suppressor is frequently inactivated in human cancers and is best known for its regulation of the G1/S-phase transition. Recent studies have shown that pRB inactivation also slows mitotic progression and promotes aneuploidy, but reasons for these phenotypes are not well understood. Here we describe the underlying mitotic defects of pRB-deficient cells that cause chromosome missegregation. Analysis of mitotic cells reveals that pRB depletion compromises centromeric localization of CAP-D3/condensin II and chromosome cohesion, leading to an increase in intercentromeric distance and deformation of centromeric structure. These defects promote merotelic attachment, resulting in failure of chromosome congression and an increased propensity for lagging chromosomes following mitotic delay. While complete loss of centromere function or chromosome cohesion would have catastrophic consequences, these more moderate defects allow pRB-deficient cells to proliferate but undermine the fidelity of mitosis, leading to whole-chromosome gains and losses. These observations explain an important consequence of RB1 inactivation, and suggest that subtle defects in centromere function are a frequent source of merotely and CIN in cancer.

  18. Inhibition of proliferation and induction of apoptosis in RB116 retinoblastoma cells by afatinib treatment.

    Science.gov (United States)

    Zhan, Wei-Jiao; Zhu, Jian-Feng; Wang, Long-Mei

    2016-07-01

    The present study investigates the effect of afatinib on the growth, induction of apoptosis in RB116 cells, and reduction of carcinoma growth in the mice transplanted with RB116 cells. The results from MTT assay revealed that afatinib inhibited the growth of RB116 cells in a dose-dependent manner. Proliferation of RB116 cells was reduced to 64 % on treatment with 200 μM concentration of afatinib after 48 h. Afatinib treatment of RB116 cells at 200 μM concentration induced apoptosis and necrosis in 49.7 and 9.4 %, respectively, after 48 h. In the RB116-transplanted mice, treatment with afatinib at 10-mg/kg doses for 45 days caused a significant (p afatinib treatment group after 45 days. However, the expression of caspase-3 was increased and of Bcl-2 remained unaltered on treatment with afatinib. Measurement of the body weight of afatinib-treated animals showed no reduction during the study. Thus, afatinib can be of therapeutic value for the treatment of retinoblastoma.

  19. Rb suppresses collective invasion, circulation and metastasis of breast cancer cells in CD44-dependent manner.

    Directory of Open Access Journals (Sweden)

    Kui-Jin Kim

    Full Text Available Basal-like breast carcinomas (BLCs present with extratumoral lymphovascular invasion, are highly metastatic, presumably through a hematogenous route, have augmented expression of CD44 oncoprotein and relatively low levels of retinoblastoma (Rb tumor suppressor. However, the causal relation among these features is not clear. Here, we show that Rb acts as a key suppressor of multiple stages of metastatic progression. Firstly, Rb suppresses collective cell migration (CCM and CD44-dependent formation of F-actin positive protrusions in vitro and cell-cluster based lymphovascular invasion in vivo. Secondly, Rb inhibits the release of single cancer cells and cell clusters into the hematogenous circulation and subsequent metastatic growth in lungs. Finally, CD44 expression is required for collective motility and all subsequent stages of metastatic progression initiated by loss of Rb function. Altogether, our results suggest that Rb/CD44 pathway is a crucial regulator of CCM and metastatic progression of BLCs and a promising target for anti-BLCs therapy.

  20. The tumor suppressor Rb and its related Rbl2 genes are regulated by Utx histone demethylase

    Energy Technology Data Exchange (ETDEWEB)

    Terashima, Minoru; Ishimura, Akihiko; Yoshida, Masakazu [Division of Functional Genomics, Cancer Research Institute, Kanazawa University, Kakuma-machi, Kanazawa 920-1192, Ishikawa (Japan); Suzuki, Yutaka; Sugano, Sumio [Graduate School of Frontier Sciences, The University of Tokyo, Kashiwa 277-8561, Chiba (Japan); Suzuki, Takeshi, E-mail: suzuki-t@staff.kanazawa-u.ac.jp [Division of Functional Genomics, Cancer Research Institute, Kanazawa University, Kakuma-machi, Kanazawa 920-1192, Ishikawa (Japan)

    2010-08-20

    Research highlights: {yields} Utx increases expression of Rb and Rbl2 genes through its demethylase activity. {yields} Utx changes histone H3 methylation on the Rb and Rbl2 promoters. {yields} Utx induces decreased cell proliferation of mammalian primary cells. -- Abstract: Utx is a candidate tumor suppressor gene that encodes histone H3 lysine 27 (H3K27) demethylase. In this study, we found that ectopic expression of Utx enhanced the expression of retinoblastoma tumor suppressor gene Rb and its related gene Rbl2. This activation was dependent on the demethylase activity of Utx, and was suggested to contribute to the decreased cell proliferation induced by Utx. A chromatin immunoprecipitation assay showed that over-expressed Utx was associated with the promoter regions of Rb and Rbl2 resulting in the removal of repressive H3K27 tri-methylation and the increase in active H3K4 tri-methylation. Furthermore, siRNA-mediated knockdown of Utx revealed the recruitment of endogenous Utx protein on the promoters of Rb and Rbl2 genes. These results indicate that Rb and Rbl2 are downstream target genes of Utx and may play important roles in Utx-mediated cell growth control.

  1. Ginsenoside Rb1 Protects Rat Neural Progenitor Cells against Oxidative Injury

    Directory of Open Access Journals (Sweden)

    Na Ni

    2014-03-01

    Full Text Available Ginseng, the root of Panax ginseng C.A. Meyer, has been used as a tonic to enhance bodily functions against various ailments for hundreds of years in Far Eastern countries without apparent adverse effects. Ginsenoside Rb1, one of the most active ingredients of ginseng, has been shown to possess various pharmacological activities. Here we report that Rb1 exhibits potent neuroprotective effects against oxidative injury induced by tert-butylhydroperoxide (t-BHP. Lactate dehydrogenase (LDH assay demonstrated that incubation with 300 µm t-BHP for 2.5 h led to a significant cell loss of cultured rat embryonic cortex-derived neural progenitor cells (NPCs and the cell viability was pronouncedly increased by 24 h pretreatment of 10 µm Rb1. TUNEL staining further confirmed that pretreatment of Rb1 significantly reduced the cell apoptosis in t-BHP-induced oxidative injury. Real time PCR revealed that pretreatment with Rb1 activated Nrf2 pathway in cultured NPCs and led to an elevated expression of HO-1. The results of the present study demonstrate that Rb1 shows a potent anti-oxidative effect on cultured NPCs by activating Nrf2 pathway.

  2. The environmental impact of recombinant bovine somatotropin (rbST) use in dairy production.

    Science.gov (United States)

    Capper, Judith L; Castañeda-Gutiérrez, Euridice; Cady, Roger A; Bauman, Dale E

    2008-07-15

    The environmental impact of using recombinant bovine somatotropin (rbST) in dairy production was examined on an individual cow, industry-scale adoption, and overall production system basis. An average 2006 U.S. milk yield of 28.9 kg per day was used, with a daily response to rbST supplementation of 4.5 kg per cow. Rations were formulated and both resource inputs (feedstuffs, fertilizers, and fuels) and waste outputs (nutrient excretion and greenhouse gas emissions) calculated. The wider environmental impact of production systems was assessed via acidification (AP), eutrophication (EP), and global warming (GWP) potentials. From a producer perspective, rbST supplementation improved individual cow production, with reductions in nutrient input and waste output per unit of milk produced. From an industry perspective, supplementing one million cows with rbST reduced feedstuff and water use, cropland area, N and P excretion, greenhouse gas emissions, and fossil fuel use compared with an equivalent milk production from unsupplemented cows. Meeting future U.S. milk requirements from cows supplemented with rbST conferred the lowest AP, EP, and GWP, with intermediate values for conventional management and the highest environmental impact resulting from organic production. Overall, rbST appears to represent a valuable management tool for use in dairy production to improve productive efficiency and to have less negative effects on the environment than conventional dairying.

  3. Resistance to Phytophthora infestans EC-1 clonal lineage in Solanum tuberosum by introducing the RB gene

    Directory of Open Access Journals (Sweden)

    María Lupe Román

    2015-04-01

    Full Text Available One of the most efficient options for the control of late blight disease in potato (Solanum tuberosum is the development of resistant varieties to Phytophthora infestans mediated by the direct transfer of resistance (R genes through genetic engineering. In the present work, we used Solanum bulbocastanum RB gene to confers broad spectrum resistance to P. infestans races. To that end, Agrobacterium - mediated genetic transformation was used to transform a susceptible potato variety, Desiree, with the binary vector pCIP68 harboring the RB gene. As a result, 19 transformed plants containing the RB gene were obtained. kanamycin resistance test and polymerase chain reaction (PCR assays confirmed the integration of the T-DNA in the potato genome. The 19 transformed plants, also called transgenic events were subjected to infection under biosafety greenhouse conditions. Phytophthora infestans isolate POX067 of the EC-1 clonal lineage, commonly find in Peru, was used for the infection. Three of the 19 plants ([RB]54, [RB]56 and [RB]70 show high resistance levels to isolate POX067 of P. infestans.

  4. Brucella abortus Strain RB51 Vaccine: Immune Response after Calfhood Vaccination and Field Investigation in Italian Cattle Population

    Directory of Open Access Journals (Sweden)

    Manuela Tittarelli

    2008-01-01

    Full Text Available Immune response to Brucella abortus strain RB51 vaccine was measured in cattle vaccinated at calfhood. After an increase at day 6 post-vaccination (pv, the antibody level recorded in the 10 vaccinated animals remained constant for two months, and then progressively decreased. All vaccinated animals remained negative from day 162 pv to the end of the study (day 300 pv. Only at days 13 and 14 pv the RB51-CFT showed 100% sensitivity (credibility interval (CI 76.2%–100%. The results indicate that the possibility to use RB51-CFT for the identification of cattle vaccinated at calfhood with RB51 is limited in time. A field investigation was carried out on 26,975 sera collected on regional basis from the Italian cattle population. The study outcomes indicate that in case of RB51-CFT positive results observed in officially Brucellosis-free (OBF areas and, in any case, when an illegal use of RB51 vaccine is suspected, the use of the RB51-CFT alone is not sufficient to identify all the vaccinated animals. The design of a more sophisticated diagnostic protocol including an epidemiological investigation, the use of RB51-CFT, and the use of the skin test with RB51 as antigen is deemed more appropriate for the identification of RB51 vaccinated animals.

  5. Place field repetition and spatial learning in a multicompartment environment.

    Science.gov (United States)

    Grieves, Roddy M; Jenkins, Bryan W; Harland, Bruce C; Wood, Emma R; Dudchenko, Paul A

    2016-01-01

    Recent studies have shown that place cells in the hippocampus possess firing fields that repeat in physically similar, parallel environments. These results imply that it should be difficult for animals to distinguish parallel environments at a behavioral level. To test this, we trained rats on a novel odor-location task in an environment with four parallel compartments which had previously been shown to yield place field repetition. A second group of animals was trained on the same task, but with the compartments arranged in different directions, an arrangement we hypothesised would yield less place field repetition. Learning of the odor-location task in the parallel compartments was significantly impaired relative to learning in the radially arranged compartments. Fewer animals acquired the full discrimination in the parallel compartments compared to those trained in the radial compartments, and the former also required many more sessions to reach criterion compared to the latter. To confirm that the arrangement of compartments yielded differences in place cell repetition, in a separate group of animals we recorded from CA1 place cells in both environments. We found that CA1 place cells exhibited repeated fields across four parallel local compartments, but did not do so when the same compartments were arranged radially. To confirm that the differences in place field repetition across the parallel and radial compartments depended on their angular arrangement, and not incidental differences in access to an extra-maze visual landmark, we repeated the recordings in a second set of rats in the absence of the orientation landmark. We found, once again, that place fields showed repetition in parallel compartments, and did not do so in radially arranged compartments. Thus place field repetition, or lack thereof, in these compartments was not dependent on extra-maze cues. Together, these results imply that place field repetition constrains spatial learning.

  6. Blind Channel Estimation for SIMO-OFDM Systems without Cyclic Prefix

    Science.gov (United States)

    Fang, Shih-Hao; Chen, Ju-Ya; Shieh, Ming-Der; Lin, Jing-Shiun

    A blind channel estimation algorithm based on the subspace method for single-input multiple-output (SIMO) orthogonal frequency division multiplexing (OFDM) systems is proposed in this letter. With the aid of a repetition index, the conventional algorithm is a special case of our algorithm. Compared with related studies, the proposed algorithm reduces the computational complexity of the SVD operation and is suitable for cyclic-prefix-free systems. In particular, the necessary condition of the proposed signal matrix to be full rank can be satisfied with fewer OFDM blocks. Simulation results demonstrate that the proposed algorithm outperforms conventional methods in normalized mean-square error.

  7. An accurate Rb density measurement method for a plasma wakefield accelerator experiment using a novel Rb reservoir

    CERN Document Server

    Öz, E; Muggli, P

    2016-01-01

    A method to accurately measure the density of Rb vapor is described. We plan on using this method for the Advanced Wakefield (AWAKE)~\\cite{bib:awake} project at CERN , which will be the world's first proton driven plasma wakefield experiment. The method is similar to the hook~\\cite{bib:Hook} method and has been described in great detail in the work by W. Tendell Hill et. al.~\\cite{bib:densitymeter}. In this method a cosine fit is applied to the interferogram to obtain a relative accuracy on the order of $1\\%$ for the vapor density-length product. A single-mode, fiber-based, Mach-Zenhder interferometer will be built and used near the ends of the 10 meter-long AWAKE plasma source to be able to make accurate relative density measurement between these two locations. This can then be used to infer the vapor density gradient along the AWAKE plasma source and also change it to the value desired for the plasma wakefield experiment. Here we describe the plan in detail and show preliminary results obtained using a prot...

  8. Color blindness and Rorschach color responsivity.

    Science.gov (United States)

    Corsino, B V

    1985-10-01

    Color vision deficits occur in 10% of the American white male population. Thus, color blindness may invalidate diagnostic hypotheses generated from Rorschach data. The Rorschach protocols of 43 white, college male color-blind subjects were compared to the protocols of normally sighted controls. The color-blind group manifested fewer pure "C" responses. No significant between group differences emerged for any of the other primary Rorschach color variables. Pure "C" responses rarely figure prominently in Rorschach evaluations, and the apparent lowered frequency of these responses by the color-blind is insufficient to warrant modification of current Rorschach practice. The data suggest that color blindness is unlikely to confound Rorschach assessment.

  9. BLIND SERBIAN RULERS AND FAMOUS PERSONS

    Directory of Open Access Journals (Sweden)

    Janicijevic Katarina

    2016-12-01

    Full Text Available History and medicine were an integral part of life-being of blind serbian acters. One of the main actors was half-blind serbian ruler, Stefan of Decani and whose name was associated with first ophthalmologic hospital and precursor of the eye`s injuries care. After, national reputation as Stefan Blind Righteous, ruler of the Serbian despot between 1458. and 1459. (member of Brankovic`s dinasty, and he was blinded by eye injuries burns. The famous national was also Filip Visnjic, as blind minstrel and authentic creator of serbian folk traditions, with sequels as a child, by bilateral infective panuveitis.

  10. Demonstration of blind quantum computing.

    Science.gov (United States)

    Barz, Stefanie; Kashefi, Elham; Broadbent, Anne; Fitzsimons, Joseph F; Zeilinger, Anton; Walther, Philip

    2012-01-20

    Quantum computers, besides offering substantial computational speedups, are also expected to preserve the privacy of a computation. We present an experimental demonstration of blind quantum computing in which the input, computation, and output all remain unknown to the computer. We exploit the conceptual framework of measurement-based quantum computation that enables a client to delegate a computation to a quantum server. Various blind delegated computations, including one- and two-qubit gates and the Deutsch and Grover quantum algorithms, are demonstrated. The client only needs to be able to prepare and transmit individual photonic qubits. Our demonstration is crucial for unconditionally secure quantum cloud computing and might become a key ingredient for real-life applications, especially when considering the challenges of making powerful quantum computers widely available.

  11. [Cortical plasticity in blind individual].

    Science.gov (United States)

    Wang, Shu-zhen; Zhu, Si-quan

    2008-10-01

    The cognitive mechanisms and functional brain imaging research on blind individuals provide special information for exploring the plasticity of the developing human brain. This paper focuses on five aspects of recent progress in this field: (1) the behavior compensation of the blind; (2) the influence of early visual deprivation and later visual deprivation on cross-modal reorganization; (3) the relationship between the complexity of task requirement and cross-modal reorganization; (4) the relationship between the sensitive periods of the visual system and the time course of cross-modal reorganization; (5) the neural mechanisms of cross-modal reorganization. These findings contribute greatly to the theoretical basis of the rehabilitation of individuals with perceptual deficits.

  12. Multiple protein biomarker assessment for recombinant bovine somatotropin (rbST abuse in cattle.

    Directory of Open Access Journals (Sweden)

    Susann K J Ludwig

    Full Text Available Biomarker profiling, as a rapid screening approach for detection of hormone abuse, requires well selected candidate biomarkers and a thorough in vivo biomarker evaluation as previously done for detection of growth hormone doping in athletes. The bovine equivalent of growth hormone, called recombinant bovine somatotropin (rbST is (illegally administered to enhance milk production in dairy cows. In this study, first a generic sample pre-treatment and 4-plex flow cytometric immunoassay (FCIA were developed for simultaneous measurement of four candidate biomarkers selected from literature: insulin-like growth factor 1 (IGF-1, its binding protein 2 (IGFBP2, osteocalcin and endogenously produced antibodies against rbST. Next, bovine serum samples from two extensive controlled rbST animal treatment studies were used for in vivo validation and biomarker evaluation. Finally, advanced statistic tools were tested for the assessment of biomarker combination quality aiming to correctly identify rbST-treated animals. The statistical prediction tool k-nearest neighbours using a combination of the biomarkers osteocalcin and endogenously produced antibodies against rbST proved to be very reliable and correctly predicted 95% of the treated samples starting from the second rbST injection until the end of the treatment period and even thereafter. With the same biomarker combination, only 12% of untreated animals appeared false-positive. This reliability meets the requirements of Commission Decision 2002/657/EC for screening methods in veterinary control. From the results of this multidisciplinary study, it is concluded that the osteocalcin - anti-rbST-antibodies combination represent fit-for-purpose biomarkers for screening of rbST abuse in dairy cattle and can be reliably measured in both the developed 4-plex FCIA as well as in a cost-effective 2-plex microsphere-based binding assay. This screening method can be incorporated in routine veterinary monitoring

  13. Periventricular white matter abnormalities and restricted repetitive behavior in autism spectrum disorder

    Directory of Open Access Journals (Sweden)

    Karen Blackmon

    2016-01-01

    Full Text Available Malformations of cortical development are found at higher rates in autism spectrum disorder (ASD than in healthy controls on postmortem neuropathological evaluation but are more variably observed on visual review of in-vivo MRI brain scans. This may be due to the visually elusive nature of many malformations on MRI. Here, we utilize a quantitative approach to determine whether a volumetric measure of heterotopic gray matter in the white matter is elevated in people with ASD, relative to typically developing controls (TDC. Data from a primary sample of 48 children/young adults with ASD and 48 age-, and gender-matched TDCs, selected from the Autism Brain Imaging Data Exchange (ABIDE open-access database, were analyzed to compare groups on (1 blinded review of high-resolution T1-weighted research sequences; and (2 quantitative measurement of white matter hypointensity (WMH volume calculated from the same T1-weighted scans. Groupwise WMH volume comparisons were repeated in an independent, multi-site sample (80 ASD/80 TDC, also selected from ABIDE. Visual review resulted in equivalent proportions of imaging abnormalities in the ASD and TDC group. However, quantitative analysis revealed elevated periventricular and deep subcortical WMH volumes in ASD. This finding was replicated in the independent, multi-site sample. Periventricular WMH volume was not associated with age but was associated with greater restricted repetitive behaviors on both parent-reported and clinician-rated assessment inventories. Thus, findings demonstrate that periventricular WMH volume is elevated in ASD and associated with a higher degree of repetitive behaviors and restricted interests. Although the etiology of focal WMH clusters is unknown, the absence of age effects suggests that they may reflect a static anomaly.

  14. Periventricular white matter abnormalities and restricted repetitive behavior in autism spectrum disorder

    Science.gov (United States)

    Blackmon, Karen; Ben-Avi, Emma; Wang, Xiuyuan; Pardoe, Heath R.; Di Martino, Adriana; Halgren, Eric; Devinsky, Orrin; Thesen, Thomas; Kuzniecky, Ruben

    2015-01-01

    Malformations of cortical development are found at higher rates in autism spectrum disorder (ASD) than in healthy controls on postmortem neuropathological evaluation but are more variably observed on visual review of in-vivo MRI brain scans. This may be due to the visually elusive nature of many malformations on MRI. Here, we utilize a quantitative approach to determine whether a volumetric measure of heterotopic gray matter in the white matter is elevated in people with ASD, relative to typically developing controls (TDC). Data from a primary sample of 48 children/young adults with ASD and 48 age-, and gender-matched TDCs, selected from the Autism Brain Imaging Data Exchange (ABIDE) open-access database, were analyzed to compare groups on (1) blinded review of high-resolution T1-weighted research sequences; and (2) quantitative measurement of white matter hypointensity (WMH) volume calculated from the same T1-weighted scans. Groupwise WMH volume comparisons were repeated in an independent, multi-site sample (80 ASD/80 TDC), also selected from ABIDE. Visual review resulted in equivalent proportions of imaging abnormalities in the ASD and TDC group. However, quantitative analysis revealed elevated periventricular and deep subcortical WMH volumes in ASD. This finding was replicated in the independent, multi-site sample. Periventricular WMH volume was not associated with age but was associated with greater restricted repetitive behaviors on both parent-reported and clinician-rated assessment inventories. Thus, findings demonstrate that periventricular WMH volume is elevated in ASD and associated with a higher degree of repetitive behaviors and restricted interests. Although the etiology of focal WMH clusters is unknown, the absence of age effects suggests that they may reflect a static anomaly. PMID:26693400

  15. Periventricular white matter abnormalities and restricted repetitive behavior in autism spectrum disorder.

    Science.gov (United States)

    Blackmon, Karen; Ben-Avi, Emma; Wang, Xiuyuan; Pardoe, Heath R; Di Martino, Adriana; Halgren, Eric; Devinsky, Orrin; Thesen, Thomas; Kuzniecky, Ruben

    2016-01-01

    Malformations of cortical development are found at higher rates in autism spectrum disorder (ASD) than in healthy controls on postmortem neuropathological evaluation but are more variably observed on visual review of in-vivo MRI brain scans. This may be due to the visually elusive nature of many malformations on MRI. Here, we utilize a quantitative approach to determine whether a volumetric measure of heterotopic gray matter in the white matter is elevated in people with ASD, relative to typically developing controls (TDC). Data from a primary sample of 48 children/young adults with ASD and 48 age-, and gender-matched TDCs, selected from the Autism Brain Imaging Data Exchange (ABIDE) open-access database, were analyzed to compare groups on (1) blinded review of high-resolution T1-weighted research sequences; and (2) quantitative measurement of white matter hypointensity (WMH) volume calculated from the same T1-weighted scans. Groupwise WMH volume comparisons were repeated in an independent, multi-site sample (80 ASD/80 TDC), also selected from ABIDE. Visual review resulted in equivalent proportions of imaging abnormalities in the ASD and TDC group. However, quantitative analysis revealed elevated periventricular and deep subcortical WMH volumes in ASD. This finding was replicated in the independent, multi-site sample. Periventricular WMH volume was not associated with age but was associated with greater restricted repetitive behaviors on both parent-reported and clinician-rated assessment inventories. Thus, findings demonstrate that periventricular WMH volume is elevated in ASD and associated with a higher degree of repetitive behaviors and restricted interests. Although the etiology of focal WMH clusters is unknown, the absence of age effects suggests that they may reflect a static anomaly.

  16. [Double-blind peer review].

    Science.gov (United States)

    Fenyvesi, Tamás

    2002-02-03

    The peer review process in medical sciences is much debated. The method is not yet evidence based. Who are the reviewers and how do they perform? They are "independent" experts. As such they are bound to be involved in research similar to that outlined in the manuscript. Very often they are contestant in the same race. That is why the author consider the double blind method, where the author is blinded and the reviewer masked from each other's identity, the best choice. Nevertheless in very many scientific journals of high quality and envied impact factors do not blind the identity of the authors. Science is a race for fame, self accomplishment and also a means to get grants for pursuing the scientific research. Only success is able to provide resources for expensive scientific research. There is no fail-safe method against bias in grant giving and editorial process. In the tidal wave of electronic information it is mandatory to help in differentiating between signal and noise in science. Peer review is the best method to protect readers from the trash of uncontrolled publications in medical science.

  17. Interaction of antiprotons with Rb atoms and a comparison of antiproton stopping powers of the atoms H, Li, Na, K, and Rb

    DEFF Research Database (Denmark)

    Lühr, Armin Christian; Fischer, Nicolas; Saenz, Alejandro

    2009-01-01

    Ionization and excitation cross sections as well as electron-energy spectra and stopping powers of the alkali metal atoms Li, Na, K, and Rb colliding with antiprotons were calculated using a time-dependent channel-coupling approach. An impact-energy range from 0.25 to 4000 keV was considered. The...

  18. RPERT: Repetitive-Projects Evaluation and Review Technique

    Directory of Open Access Journals (Sweden)

    Remon Fayek Aziz

    2014-03-01

    Full Text Available Estimating expected completion probability of any repetitive construction project with a specified/certain duration including repetitive identical activities by using program evaluation and review technique is the most essential part in construction areas since the activities were had optimistic, most likely and pessimistic durations. This paper focuses on the calculation of expected completion probability of any repetitive construction project within a specified/certain duration (contract duration by using Line Of Balance technique (LOB in case of single or multiple number of crews integrated with Program Evaluation and Review Technique (PERT. Repetitive-Projects Evaluation and Review Technique (RPERT, which is a simplified software, will generate the expected project completion probability of a specified/certain duration (contract duration. RPERT software is designed by java programming code system to provide a number of new and unique capabilities, including: (1 Viewing the expected project completion probability according to a set of specified durations per each identical activity (optimistic time, most likely time, and pessimistic time in the analyzed project; (2 Providing seamless integration with available project time calculations. In order to provide the aforementioned capabilities of RPERT, the system is implemented and developed in four main modules: (1 A user interface module; (2 A database module; (3 A running module; and (4 A processing module. At the end, an illustrative example will be presented to demonstrate and verify the applications of proposed software (RPERT, by using probabilistic calculations for repetitive construction projects.

  19. Autism and exergaming: effects on repetitive behaviors and cognition

    Directory of Open Access Journals (Sweden)

    Anderson-Hanley C

    2011-09-01

    Full Text Available Cay Anderson-Hanley, Kimberly Tureck, Robyn L Schneiderman Department of Psychology, Union College, Schenectady, NY, USA Abstract: Autism is a neurodevelopmental disorder that leads to impairment in social skills and delay in language development, and results in repetitive behaviors and restricted interests that impede academic and social involvement. Physical exercise has been shown to decrease repetitive behaviors in autistic children and improve cognitive function across the life-span. Exergaming combines physical and mental exercise simultaneously by linking physical activity movements to video game control and may yield better compliance with exercise. In this investigation, two pilot studies explored the potential behavioral and cognitive benefits of exergaming. In Pilot I, twelve children with autism spectrum disorders completed a control task and an acute bout of Dance Dance Revolution (DDR; in Pilot II, ten additional youths completed an acute bout of cyber cycling. Repetitive behaviors and executive function were measured before and after each activity. Repetitive behaviors significantly decreased, while performance on Digits Backwards improved following the exergaming conditions compared with the control condition. Additional research is needed to replicate these findings, and to explore the application of exergaming for the management of behavioral disturbance and to increase cognitive control in children on the autism spectrum. Keywords: autism, repetitive behaviors, exergaming, exercise, executive function

  20. Quantifying repetitive speech in autism spectrum disorders and language impairment.

    Science.gov (United States)

    van Santen, Jan P H; Sproat, Richard W; Hill, Alison Presmanes

    2013-10-01

    We report on an automatic technique for quantifying two types of repetitive speech: repetitions of what the child says him/herself (self-repeats) and of what is uttered by an interlocutor (echolalia). We apply this technique to a sample of 111 children between the ages of four and eight: 42 typically developing children (TD), 19 children with specific language impairment (SLI), 25 children with autism spectrum disorders (ASD) plus language impairment (ALI), and 25 children with ASD with normal, non-impaired language (ALN). The results indicate robust differences in echolalia between the TD and ASD groups as a whole (ALN + ALI), and between TD and ALN children. There were no significant differences between ALI and SLI children for echolalia or self-repetitions. The results confirm previous findings that children with ASD repeat the language of others more than other populations of children. On the other hand, self-repetition does not appear to be significantly more frequent in ASD, nor does it matter whether the child's echolalia occurred within one (immediate) or two turns (near-immediate) of the adult's original utterance. Furthermore, non-significant differences between ALN and SLI, between TD and SLI, and between ALI and TD are suggestive that echolalia may not be specific to ALN or to ASD in general. One important innovation of this work is an objective fully automatic technique for assessing the amount of repetition in a transcript of a child's utterances.

  1. A dark-line two-dimensional magneto-optical trap of 85Rb atoms with high optical depth.

    Science.gov (United States)

    Zhang, Shanchao; Chen, J F; Liu, Chang; Zhou, Shuyu; Loy, M M T; Wong, G K L; Du, Shengwang

    2012-07-01

    We describe the apparatus of a dark-line two-dimensional (2D) magneto-optical trap (MOT) of (85)Rb cold atoms with high optical depth (OD). Different from the conventional configuration, two (of three) pairs of trapping laser beams in our 2D MOT setup do not follow the symmetry axes of the quadrupole magnetic field: they are aligned with 45° angles to the longitudinal axis. Two orthogonal repumping laser beams have a dark-line volume in the longitudinal axis at their cross over. With a total trapping laser power of 40 mW and repumping laser power of 18 mW, we obtain an atomic OD up to 160 in an electromagnetically induced transparency (EIT) scheme, which corresponds to an atomic-density-length product NL = 2.05 × 10(15) m(-2). In a closed two-state system, the OD can become as large as more than 600. Our 2D MOT configuration allows full optical access of the atoms in its longitudinal direction without interfering with the trapping and repumping laser beams spatially. Moreover, the zero magnetic field along the longitudinal axis allows the cold atoms maintain a long ground-state coherence time without switching off the MOT magnetic field, which makes it possible to operate the MOT at a high repetition rate and a high duty cycle. Our 2D MOT is ideal for atomic-ensemble-based quantum optics applications, such as EIT, entangled photon pair generation, optical quantum memory, and quantum information processing.

  2. Ginseng Rb fraction protects glia, neurons and cognitive function in a rat model of neurodegeneration.

    Directory of Open Access Journals (Sweden)

    Kangning Xu

    Full Text Available The loss and injury of neurons play an important role in the onset of various neurodegenerative diseases, while both microgliosis and astrocyte loss or dysfunction are significant causes of neuronal degeneration. Previous studies have suggested that an extract enriched panaxadiol saponins from ginseng has more neuroprotective potential than the total saponins of ginseng. The present study investigated whether a fraction of highly purified panaxadiol saponins (termed as Rb fraction was protective for both glia and neurons, especially GABAergic interneurons, against kainic acid (KA-induced excitotoxicity in rats. Rats received Rb fraction at 30 mg/kg (i.p., 40 mg/kg (i.p. or saline followed 40 min later by an intracerebroventricular injection of KA. Acute hippocampal injury was determined at 48 h after KA, and impairment of hippocampus-dependent learning and memory as well as delayed neuronal injury was determined 16 to 21 days later. KA injection produced significant acute hippocampal injuries, including GAD67-positive GABAergic interneuron loss in CA1, paralbumin (PV-positive GABAergic interneuron loss, pyramidal neuron degeneration and astrocyte damage accompanied with reactive microglia in both CA1 and CA3 regions of the hippocampus. There was also a delayed loss of GAD67-positive interneurons in CA1, CA3, hilus and dentate gyrus. Microgliosis also became more severe 21 days later. Accordingly, KA injection resulted in hippocampus-dependent spatial memory impairment. Interestingly, the pretreatment with Rb fraction at 30 or 40 mg/kg significantly protected the pyramidal neurons and GABAergic interneurons against KA-induced acute excitotoxicity and delayed injury. Rb fraction also prevented memory impairments and protected astrocytes from KA-induced acute excitotoxicity. Additionally, microglial activation, especially the delayed microgliosis, was inhibited by Rb fraction. Overall, this study demonstrated that Rb fraction protected both

  3. Oral absorption of ginsenoside Rb1 using in vitro and in vivo models.

    Science.gov (United States)

    Han, Min; Sha, Xianyi; Wu, Yunjuan; Fang, Xiaoling

    2006-04-01

    This research attempts to clarify the cause for poor oral absorption of ginsenoside Rb1 (Rb1), one main ingredient of the well known Panax notoginseng saponins (PNS) for curing hemorrhage. Caco-2 cell monolayers were used as an in vitro model to reveal the transport mechanism of Rb1 across the intestinal mucosa. Moreover, the serum concentration-time profiles of Rb1 after tail venous (IV), portal venous (PV), intraduodenal (ID) and peroral (PO) administration to rats were compared to evaluate the first-pass effects of stomach, intestine and liver. In vitro experiments showed that uptake by Caco-2 cell monolayers was temperature dependent, but was not influenced by cyclosporine A and ketoconazole. The change in the apical pH showed no obvious effects on the uptake of Rb1. The uptake and transport were non-saturable, and flux from the apical compartment to the basolateral compartment (A-B) increased linearly with increasing concentration, which indicated a passive transport. Meanwhile, an apparent permeability coefficient of (5.90 +/- 1.02) x 10(-8) cm/s (C0 = 1 mg/mL) predicted an incomplete absorption. The investigation on the pharmacokinetic behavior of Rb1 after different routes of administration to rats showed a significant difference between PO (F(PO) was 0.64%), ID (F(ID) was 2.46%) and PV (F(PV) was 59.49%) administration, and the first-pass effect of the intestine is more significant than that of the stomach and liver in the absorption process. In summary, elimination in the stomach, large intestine and liver contributed to the poor absorption of Rb1, but the low membrane permeability might be a more important factor dominating the extent of absorption.

  4. Role of Rb during Neurogenesis and Axonal Guidance in the Developing Olfactory System

    Science.gov (United States)

    Jaafar, Carine; Omais, Saad; Al Lafi, Sawsan; El Jamal, Nadim; Noubani, Mohammad; Skaf, Larissa; Ghanem, Noël

    2016-01-01

    The Retinoblastoma protein, Rb, was shown to regulate distinct aspects of neurogenesis in the embryonic and adult brain besides its primary role in cell cycle control. It is still unknown, however, whether Rb is required for tissue morphogenesis and the establishment of synaptic connections between adjacent tissues during development. We have investigated here the role of Rb during development of the olfactory system (OS), which heavily relies on reciprocal interactions between the olfactory epithelium (OE) and the olfactory bulb (OB). We show that mice carrying a telencephalic-specific deletion of Rb display several neurogenic defects in the OS during late development. In the OE, loss of Rb leads to ectopic proliferation of late-born progenitors (Tuj-1+), abnormal radial migration and terminal maturation of olfactory sensory neurons (OSNs). In the OB, deletion of Rb causes severe lamination defects with loss of clear boundaries between distinct layers. Importantly, starting around E15.5 when OB glomerulogenesis is initiated, many OSNs axons that project along the olfactory nerve layer (ONL) fail to properly innervate the nascent bulb, thus resulting in partial loss of connectivity between OE-OB and gradual neuronal degeneration in both tissues peaking at birth. This deficiency correlates with deregulated expressions of two key chemo-repellant molecules, Robo2/Slit1 and Nrp2/Sema3F that control the formation of dorsal-ventral topographic map of OSNs connections with OB glomeruli. This study highlights a critical requirement for Rb during neurogenesis and the establishment of proper synaptic connections inside the OS during development. PMID:27667971

  5. Ginseng Rb fraction protects glia, neurons and cognitive function in a rat model of neurodegeneration.

    Science.gov (United States)

    Xu, Kangning; Zhang, Yufen; Wang, Yan; Ling, Peng; Xie, Xin; Jiang, Chenyao; Zhang, Zhizhen; Lian, Xiao-Yuan

    2014-01-01

    The loss and injury of neurons play an important role in the onset of various neurodegenerative diseases, while both microgliosis and astrocyte loss or dysfunction are significant causes of neuronal degeneration. Previous studies have suggested that an extract enriched panaxadiol saponins from ginseng has more neuroprotective potential than the total saponins of ginseng. The present study investigated whether a fraction of highly purified panaxadiol saponins (termed as Rb fraction) was protective for both glia and neurons, especially GABAergic interneurons, against kainic acid (KA)-induced excitotoxicity in rats. Rats received Rb fraction at 30 mg/kg (i.p.), 40 mg/kg (i.p. or saline followed 40 min later by an intracerebroventricular injection of KA. Acute hippocampal injury was determined at 48 h after KA, and impairment of hippocampus-dependent learning and memory as well as delayed neuronal injury was determined 16 to 21 days later. KA injection produced significant acute hippocampal injuries, including GAD67-positive GABAergic interneuron loss in CA1, paralbumin (PV)-positive GABAergic interneuron loss, pyramidal neuron degeneration and astrocyte damage accompanied with reactive microglia in both CA1 and CA3 regions of the hippocampus. There was also a delayed loss of GAD67-positive interneurons in CA1, CA3, hilus and dentate gyrus. Microgliosis also became more severe 21 days later. Accordingly, KA injection resulted in hippocampus-dependent spatial memory impairment. Interestingly, the pretreatment with Rb fraction at 30 or 40 mg/kg significantly protected the pyramidal neurons and GABAergic interneurons against KA-induced acute excitotoxicity and delayed injury. Rb fraction also prevented memory impairments and protected astrocytes from KA-induced acute excitotoxicity. Additionally, microglial activation, especially the delayed microgliosis, was inhibited by Rb fraction. Overall, this study demonstrated that Rb fraction protected both astrocytes and neurons

  6. Quantification of myocardial blood flow with {sup 82}Rb dynamic PET imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lortie, Mireille; Beanlands, Rob S.B.; Yoshinaga, Keiichiro; Klein, Ran; DaSilva, Jean N.; DeKemp, Robert A. [University of Ottawa Heart Institute, Cardiac PET Centre, Ottawa, ON (Canada)

    2007-11-15

    The PET tracer {sup 82}Rb is commonly used to evaluate regional perfusion defects for the diagnosis of coronary artery disease. There is limited information on the quantification of myocardial blood flow and flow reserve with this tracer. The goal of this study was to investigate the use of a one-compartment model of {sup 82}Rb kinetics for the quantification of myocardial blood flow. Fourteen healthy volunteers underwent rest and dipyridamole stress imaging with both {sup 13}N-ammonia and {sup 82}Rb within a 2-week interval. Myocardial blood flow was estimated from the time-activity curves measured with {sup 13}N-ammonia using a standard two-compartment model. The uptake parameter of the one-compartment model was estimated from the time-activity curves measured with {sup 82}Rb. To describe the relationship between myocardial blood flow and the uptake parameter, a nonlinear extraction function was fitted to the data. This function was then used to convert estimates of the uptake parameter to flow estimates. The extraction function was validated with an independent data set obtained from 13 subjects with documented evidence of coronary artery disease (CAD). The one-compartment model described {sup 82}Rb kinetics very well (median R-square = 0.98). The flow estimates obtained with {sup 82}Rb were well correlated with those obtained with {sup 13}N-ammonia (r = 0.85), and the best-fit line did not differ significantly from the identity line. Data obtained from the subjects with CAD confirmed the validity of the estimated extraction function. It is possible to obtain accurate estimates of myocardial blood flow and flow reserve with a one-compartment model of {sup 82}Rb kinetics and a nonlinear extraction function. (orig.)

  7. 5-Aza-2'-deoxycytidine reactivates gene expression via degradation of pRb pocket proteins.

    Science.gov (United States)

    Zheng, Zhixing; Li, Lian; Liu, Xiangyu; Wang, Donglai; Tu, Bo; Wang, Lina; Wang, Haiying; Zhu, Wei-Guo

    2012-01-01

    Not only does 5-aza-2'-deoxycytidine (5-aza-CdR) induce the reexpression of silenced genes through the demethylation of CpG islands, but it increases the expression of unmethylated genes. However, the mechanism by which 5-aza-CdR activates the expression of genes is not completely understood. Here, we report that the pRb pocket proteins pRb, p107, and p130 were degraded in various cancer cell lines in response to 5-aza-CdR treatment, and this effect was dependent on the proteasome pathway. Mouse double minute 2 (MDM2) played a critical role in this 5-aza-CdR-induced degradation of pRb. Furthermore, PP2A phosphatase-induced MDM2 dephosphorylation at S260 was found to be essential for MDM2 binding to pRb in the presence of 5-aza-CdR. pRb degradation resulted in the significant reexpression of several genes, including methylated CDKN2A, RASFF1A, and unmethylated CDKN2D. Finally, knockdown of pRb pocket proteins by either RNAi or 5-aza-CdR treatment induced a significant decrease in the recruitment of SUV39H1 and an increase in the enrichment of KDM3B and KDM4A to histones around the promoter of RASFF1A and thus reduced H3K9 di- and trimethylation, by which RASFF1A expression is activated. Our data reveal a novel mechanism by which 5-aza-CdR induces the expression of both methylated and unmethylated genes by degrading pRb pocket proteins.

  8. ROBUST REPETITIVE CONTROL FOR IMPROVING RATE SMOOTHNESS OF TEST TURNTABLE

    Institute of Scientific and Technical Information of China (English)

    LIUYu; ZENGMing; SUBao-ku

    2005-01-01

    A robust repetitive control scheme is used to improve the rate smoothness of a brushless DC motor (BLDCM) driven test turntable. The method synthesizes variable structure control (VSC) laws and repetitive control (RC) laws in a complementary manner. The VSC strategy can stabilize the system and suppress uncertainties, such as the aperiodic disturbance and noises, while RC strategy can eliminate the periodic rate fluctuation in a steady state. The convergence of the repetitive learning process is also guaranteed by VSC. A general nonlinear system model is discussed. The model can be considered as an extension of BLDCMs. The stability and asymptotic position tracking performance are validated by using Lyapunov functions. Simulation results show the effectiveness of the proposed approach for improving the rate smoothness.

  9. Body-focused repetitive behavior disorders in ICD-11

    Directory of Open Access Journals (Sweden)

    Jon E. Grant

    2014-01-01

    Full Text Available This article addresses the question of how body-focused repetitive behavior disorders (e.g., trichotillomania and skin-picking disorder should be characterized in ICD-11. The article reviews the historical nosology of the two disorders and the current approaches in DSM-5 and ICD-10. Although data are limited and mixed regarding the optimal relationship between body-focused repetitive behavior disorders and nosological categories, these conditions should be included within the obsessive-compulsive and related disorders category, as this is how most clinicians see these behaviors, and as this may optimize clinical utility. The descriptions of these disorders should largely mirror those in DSM-5, given the evidence from recent field surveys. The recommendations regarding ICD-11 and body-focused repetitive behavior disorders should promote the global identification and treatment of these conditions in primary care settings.

  10. Repeated text in unrelated passages: Repetition versus meaning selection effects.

    Science.gov (United States)

    Klin, Celia M; Drumm, April M; Ralano, Angela S

    2009-07-01

    Despite previous findings, Klin, Ralano, and Weingartner (2007) found transfer benefits across unrelated passages. After processing an ambiguous phrase in Story A that was biased toward its sarcastic meaning, readers were more likely to interpret the identical phrase in Story B as sarcastic, even though it contained no disambiguating information. In the present experiments, we found both repetition effects (a benefit for the lexical items) and meaning selection effects (a benefit for the selected meaning of the phrase) with short delays between Stories A and B; with longer delays, only repetition effects were found. Whereas decreasing the elaboration of the phrase eliminated both effects, moving the disambiguating context from before to after the phrase eliminated meaning selection effects only. We conclude that meaning selection effects, which are based on conceptual overlap, are more sensitive to context changes and less robust than repetition effects, which are based on both perceptual and conceptual overlap.

  11. Effects of repetition and temperature on Contingent Electrical Stimulation

    DEFF Research Database (Denmark)

    Castrillon, Eduardo E.; Zhou, Xinwen; Svensson, Peter

    Effects of repetition and temperature on Contingent Electrical Stimulation. E.E. Castrillon W1, 2, Xinwen Zhou 3, P. Svensson1, 2, 4 1 Department of Dentistry and Oral Health, Section of Orofacial Pain and Jaw Function, Aarhus University, Denmark2 Scandinavian Center for Orofacial Neuroscience...... (SCON)3 Department of Dentistry, Beijing Shijitan Hospital, Capital Medical University, Beijing, China. 4 Department of Dental Medicine, Karolinska Institutet, Huddinge, Sweden  Background: Contingent electrical stimulation (CES) of the facial skin has been shown to reduce electromyographic (EMG......) activity associated with bruxism. Repetition of the electrical stimulus and skin surface temperature (ST) may affect the perception of CES and possibly also the inhibitory EMG effects.Objectives: To determine the effects of stimulus repetition and skin ST on the perception of CES.  Methods: Healthy...

  12. Restricted Repetitive Sampling in Designing of Control Charts

    Directory of Open Access Journals (Sweden)

    Muhammad Anwar Mughal

    2017-06-01

    Full Text Available In this article a criteria have been defined to classify the existing repetitive sampling into soft, moderate and strict conditions. Behind this division a ratio has been suggested i.e. c2 (constant used in repetitive limits to c1(constant used in control limit in slabs. A restricted criterion has been devised on the existing repetitive sampling. By embedding the proposed schematic in the control chart it becomes highly efficient in detecting the shifts quite earlier as well as it detects even smaller shifts at smaller ARLs. To facilitate the user for best choice the restricted criterion has further categorized to softly restricted, moderately restricted and strictly restricted. The restricted conditions are dependent on value of restriction parameter ’m’ varies 2 to 6. The application of proposed scheme on selected cases is given in tables which are self explanatory.

  13. Cancer resistance in the blind mole rat is mediated by concerted necrotic cell death mechanism.

    Science.gov (United States)

    Gorbunova, Vera; Hine, Christopher; Tian, Xiao; Ablaeva, Julia; Gudkov, Andrei V; Nevo, Eviatar; Seluanov, Andrei

    2012-11-20

    Blind mole rats Spalax (BMR) are small subterranean rodents common in the Middle East. BMR is distinguished by its adaptations to life underground, remarkable longevity (with a maximum documented lifespan of 21 y), and resistance to cancer. Spontaneous tumors have never been observed in spalacids. To understand the mechanisms responsible for this resistance, we examined the growth of BMR fibroblasts in vitro of the species Spalax judaei and Spalax golani. BMR cells proliferated actively for 7-20 population doublings, after which the cells began secreting IFN-β, and the cultures underwent massive necrotic cell death within 3 d. The necrotic cell death phenomenon was independent of culture conditions or telomere shortening. Interestingly, this cell behavior was distinct from that observed in another long-lived and cancer-resistant African mole rat, Heterocephalus glaber, the naked mole rat in which cells display hypersensitivity to contact inhibition. Sequestration of p53 and Rb proteins using SV40 large T antigen completely rescued necrotic cell death. Our results suggest that cancer resistance of BMR is conferred by massive necrotic response to overproliferation mediated by p53 and Rb pathways, and triggered by the release of IFN-β. Thus, we have identified a unique mechanism that contributes to cancer resistance of this subterranean mammal extremely adapted to life underground.

  14. Oral Language Skills Moderate Nonword Repetition Skills in Children with Dyslexia: A Meta-Analysis of the Role of Nonword Repetition Skills in Dyslexia

    Science.gov (United States)

    Melby-Lervag, Monica; Lervag, Arne

    2012-01-01

    We present a meta-analysis reviewing studies that have focused on the relationship between dyslexia and nonword repetition. The results show that children with dyslexia have poorer nonword repetition skills when compared to both chronological-age and reading-level controls. However, the severity of the nonword repetition problem varies…

  15. Oral Language Skills Moderate Nonword Repetition Skills in Children with Dyslexia: A Meta-Analysis of the Role of Nonword Repetition Skills in Dyslexia

    Science.gov (United States)

    Melby-Lervag, Monica; Lervag, Arne

    2012-01-01

    We present a meta-analysis reviewing studies that have focused on the relationship between dyslexia and nonword repetition. The results show that children with dyslexia have poorer nonword repetition skills when compared to both chronological-age and reading-level controls. However, the severity of the nonword repetition problem varies…

  16. Effects of Bilateral Repetitive Transcranial Magnetic Stimulation on Post-Stroke Dysphagia.

    Science.gov (United States)

    Park, Eunhee; Kim, Min Su; Chang, Won Hyuk; Oh, Su Mi; Kim, Yun Kwan; Lee, Ahee; Kim, Yun-Hee

    Optimal protocol of repetitive transcranial magnetic stimulation (rTMS) on post-stroke dysphagia remains uncertain with regard to its clinical efficacy. The aim of the present study is to investigate the effects of high-frequency rTMS at the bilateral motor cortices over the cortical representation of the mylohyoid muscles in the patients with post-stroke dysphagia. This study was a single-blind, randomized controlled study with a blinded observer. Thirty-five stroke patients were randomly divided into three intervention groups: the bilateral stimulation group, the unilateral stimulation group, and the sham stimulation group. For the bilateral stimulation group, 500 pulses of 10 Hz rTMS over the ipsilesional and 500 pulses of 10 Hz rTMS over the contralesional motor cortices over the cortical areas that project to the mylohyoid muscles were administered daily for 2 consecutive weeks. For the unilateral stimulation group, 500 pulses of 10 Hz rTMS over the ipsilesional motor cortex over the cortical representation of the mylohyoid muscle and the same amount of sham rTMS over the contralesional hemisphere were applied. For the sham stimulation group, sham rTMS was applied at the bilateral motor cortices. Clinical swallowing function and videofluoroscopic swallowing studies were assessed before the intervention (T0), immediately after the intervention (T1) and 3 weeks after the intervention (T2) using Clinical Dysphagia Scale (CDS), Dysphagia Outcome and Severity Scale (DOSS), Penetration Aspiration Scale (PAS), and Videofluoroscopic Dysphagia Scale (VDS). There were significant time and intervention interaction effects in the CDS, DOSS, PAS, and VDS scores (p dysphagia therapies. Copyright © 2016. Published by Elsevier Inc.

  17. RB1 status in triple negative breast cancer cells dictates response to radiation treatment and selective therapeutic drugs.

    Science.gov (United States)

    Robinson, Tyler J W; Liu, Jeff C; Vizeacoumar, Frederick; Sun, Thomas; Maclean, Neil; Egan, Sean E; Schimmer, Aaron D; Datti, Alessandro; Zacksenhaus, Eldad

    2013-01-01

    Triple negative breast cancer (TNBC) includes basal-like and claudin-low subtypes for which only chemotherapy and radiation therapy are currently available. The retinoblastoma (RB1) tumor suppressor is frequently lost in human TNBC. Knockdown of RB1 in luminal BC cells was shown to affect response to endocrine, radiation and several antineoplastic drugs. However, the effect of RB1 status on radiation and chemo-sensitivity in TNBC cells and whether RB1 status affects response to divergent or specific treatment are unknown. Using multiple basal-like and claudin-low cell lines, we hereby demonstrate that RB-negative TNBC cell lines are highly sensitive to gamma-irradiation, and moderately more sensitive to doxorubicin and methotrexate compared to RB-positive TNBC cell lines. In contrast, RB1 status did not affect sensitivity of TNBC cells to multiple other drugs including cisplatin (CDDP), 5-fluorouracil, idarubicin, epirubicin, PRIMA-1(met), fludarabine and PD-0332991, some of which are used to treat TNBC patients. Moreover, a non-biased screen of ∼3400 compounds, including FDA-approved drugs, revealed similar sensitivity of RB-proficient and -deficient TNBC cells. Finally, ESA(+)/CD24(-/low)/CD44(+) cancer stem cells from RB-negative TNBC lines were consistently more sensitive to gamma-irradiation than RB-positive lines, whereas the effect of chemotherapy on the cancer stem cell fraction varied irrespective of RB1 expression. Our results suggest that patients carrying RB-deficient TNBCs would benefit from gamma-irradiation as well as doxorubicin and methotrexate therapy, but not necessarily from many other anti-neoplastic drugs.

  18. RB1 status in triple negative breast cancer cells dictates response to radiation treatment and selective therapeutic drugs.

    Directory of Open Access Journals (Sweden)

    Tyler J W Robinson

    Full Text Available Triple negative breast cancer (TNBC includes basal-like and claudin-low subtypes for which only chemotherapy and radiation therapy are currently available. The retinoblastoma (RB1 tumor suppressor is frequently lost in human TNBC. Knockdown of RB1 in luminal BC cells was shown to affect response to endocrine, radiation and several antineoplastic drugs. However, the effect of RB1 status on radiation and chemo-sensitivity in TNBC cells and whether RB1 status affects response to divergent or specific treatment are unknown. Using multiple basal-like and claudin-low cell lines, we hereby demonstrate that RB-negative TNBC cell lines are highly sensitive to gamma-irradiation, and moderately more sensitive to doxorubicin and methotrexate compared to RB-positive TNBC cell lines. In contrast, RB1 status did not affect sensitivity of TNBC cells to multiple other drugs including cisplatin (CDDP, 5-fluorouracil, idarubicin, epirubicin, PRIMA-1(met, fludarabine and PD-0332991, some of which are used to treat TNBC patients. Moreover, a non-biased screen of ∼3400 compounds, including FDA-approved drugs, revealed similar sensitivity of RB-proficient and -deficient TNBC cells. Finally, ESA(+/CD24(-/low/CD44(+ cancer stem cells from RB-negative TNBC lines were consistently more sensitive to gamma-irradiation than RB-positive lines, whereas the effect of chemotherapy on the cancer stem cell fraction varied irrespective of RB1 expression. Our results suggest that patients carrying RB-deficient TNBCs would benefit from gamma-irradiation as well as doxorubicin and methotrexate therapy, but not necessarily from many other anti-neoplastic drugs.

  19. p16 controls epithelial cell growth and suppresses carcinogenesis through mechanisms that do not require RB1 function

    Science.gov (United States)

    Sen, M; Akeno, N; Reece, A; Miller, A L; Simpson, D S; Wikenheiser-Brokamp, K A

    2017-01-01

    The p16/RB1 tumor suppressor pathway is inactivated in the vast majority, if not all, human cancers. The current paradigm is that p16 and RB1 function in a linear pathway to suppress tumorigenesis; however p16 is preferentially lost in human cancers suggesting that p16 has critical tumor suppressive functions not mediated through RB1. Carcinomas arise from transformed epithelial cells and account for 80% of adult malignancies highlighting the need to understand p16/RB1 pathway function in organ epithelia. Lung cancer is the leading cause of cancer deaths and is associated with p16/RB1 pathway deregulation. We demonstrate that p16 is upregulated in the lung epithelium after Rb1 ablation in genetically engineered mouse models. In contrast to fibroblasts, loss of RB1 family proteins, p107 or p130, did not result in p16 induction, demonstrating that p16 suppression is a unique RB1 pocket protein function in the lung epithelium in vivo. p16 upregulation did not induce cellular senescence but rather promoted survival of RB1-deficient lung epithelial progenitor cells. Mechanistic studies show that p16 protects RB1-deficient cells from DNA damage. Consequently, additional loss of p16 led to genetic instability and increased susceptibility to cellular immortalization and transformation. Mice with combined RB1/p16-deficient lungs developed lung tumors including aggressive metastatic lung cancers. These studies identify p16 loss as a molecular event that causes genetic instability and directly demonstrate that p16 protects against DNA damage in the absence of RB1 function providing an explanation for why p16 is preferentially targeted in human cancers. PMID:28414317

  20. pRB-E2F1 complexes are resistant to adenovirus E1A-mediated disruption.

    Science.gov (United States)

    Seifried, L A; Talluri, S; Cecchini, M; Julian, L M; Mymryk, J S; Dick, F A

    2008-05-01

    Disruption of pRB-E2F interactions by E1A is a key event in the adenoviral life cycle that drives expression of early viral transcription and induces cell cycle progression. This function of E1A is complicated by E2F1, an E2F family member that controls multiple processes besides proliferation, including apoptosis and DNA repair. Recently, a second interaction site in pRB that only contacts E2F1 has been discovered, allowing pRB to control proliferation separately from other E2F1-dependent activities. Based on this new insight into pRB-E2F1 regulation, we investigated how E1A affects control of E2F1 by pRB. Our data reveal that pRB-E2F1 interactions are resistant to E1A-mediated disruption. Using mutant forms of pRB that selectively force E2F1 to bind through only one of the two binding sites on pRB, we determined that E1A is unable to disrupt E2F1's unique interaction with pRB. Furthermore, analysis of pRB-E2F complexes during adenoviral infection reveals the selective maintenance of pRB-E2F1 interactions despite the presence of E1A. Our experiments also demonstrate that E2F1 functions to maintain cell viability in response to E1A expression. This suggests that adenovirus E1A's seemingly complex mechanism of disrupting pRB-E2F interactions provides selectivity in promoting viral transcription and cell cycle advancement, while maintaining cell viability.

  1. pRb phosphorylation regulates the proliferation of supporting cells in gentamicin-damaged neonatal avian utricle.

    Science.gov (United States)

    Wu, Jingfang; Sun, Shan; Li, Wenyan; Chen, Yan; Li, Huawei

    2014-10-01

    The ability of nonmammalian vertebrates to regenerate hair cells (HCs) after damage-induced HC loss has stimulated and inspired research in the field of HC regeneration. The protein pRb encoded by retinoblastoma gene Rb1 forces sensory progenitor cells to exit cell cycle and maintain differentiated HCs and supporting cells (SCs) in a quiescent state. pRb function is regulated by phosphorylation through the MEK/ERK or the pRb/Raf-1 signaling pathway. In our previous study, we have shown that pRb phosphorylation is crucial for progenitor cell proliferation and survival during the early embryonic stage of avian otocyst sensory epithelium development. However, in damaged avian utricle, the role of pRb in regulating the cell cycling of SCs or HCs regeneration still remains unclear. To further elucidate the function of pRb phosphorylation on SCs re-entering the cell cycle triggered by gentamycin-induced HCs damage, we isolated neonatal chicken utricles and treated them with the MEK inhibitor U0126 or the pRb/Raf-1 inhibitor RRD-251, respectively in vitro. We found that after gentamycin-induced HCs damage, pRb phosphorylation is important for the quiescent SCs re-entering the cell cycle in the neonatal chicken utricle. In addition, the proliferation of SCs decreased in a dose-dependent manner in response to both U0126 and RRD-251, which indicates that both the MEK/ERK and the pRb/Raf-1 signaling pathway play important roles in pRb phosphorylation in damaged neonatal chicken utricle. Together, these findings on the function of pRb in damaged neonatal chicken utricle improve our understanding of the regulation of the cell cycle of SCs after HCs loss and may shed light on the mammalian HC regeneration from SCs in damaged organs.

  2. Staurosporine is chemoprotective by inducing G1 arrest in a Chk1- and pRb-dependent manner.

    Science.gov (United States)

    Murray, Mollianne McGahren; Bui, Tuyen; Smith, Michelle; Bagheri-Yarmand, Rozita; Wingate, Hannah; Hunt, Kelly K; Keyomarsi, Khandan

    2013-10-01

    Chemotherapeutic agents have been the mainstay of cancer therapy for years. However, their effectiveness has been limited by toxicities they impart on normal cells. Staurosporine (ST) has been shown to arrest normal, but not breast cancer, cells in G1. Therefore, ST may become a chemoprotective agent, arresting normal cells while allowing tumor cells to enter cell cycle phases where they are sensitive to chemotherapeutic agents. Understanding the mechanism of ST-mediated G1 arrest may allow for a beneficial chemoprotective treatment strategy for patients. We utilized 76NE6 (pRb+/p53-), 76NF2V (pRb+/p53+) and 76NE7 (pRb-/P53+) non-tumorigenic human mammary epithelial cell lines to understand the role of the Rb and p53 pathways in ST-directed G1 arrest. CDK4 was downregulated by ST in Rb+ cells, but its presence could not reverse the arrest, neither did its stable downregulation alter ST-mediated cellular response. ST-mediated G1 arrest required pRb, which in turn initiated a cascade of events leading to inhibition of CDK4. Further assessment of this pathway revealed that Chk1 expression and activity were required for the Rb-dependent arrest. For example, pRb+ cells with small interfering RNA to Chk1 had approximately 60% less cells in G1 phase compared with controls and pRb- cells do not arrest upon ST. Furthermore, Chk1 expression facilitates the release of the Rb+ cells from G1 arrest. Collectively, our data suggest that pRb cooperates with Chk1 to mediate a G1 arrest only in pRb+ cells. The elucidation of this pathway can help identify novel agents to protect cancer patients against the debilitating effects of chemotherapy.

  3. Effect of repetitive mckenzie lumbar spine exercises on cardiovascular system

    Directory of Open Access Journals (Sweden)

    Agrawal Sonal S

    2014-07-01

    Full Text Available Background & Purpose: McKenzie exercises for the lumbar spine, which are done repeatedly, such as flexion in standing (FIS, extension in standing flexion in lying (FIL & extension in lying (EIL have been used in the management of low back pain for over three decades. The cardiovascular effects of exercises that involve postural stabilization, arm exercises and of exercises performed in lying are well known, but there are seldom studies performed to assess the cardiovascular effects of these commonly used McKenzie exercises. Therefore the study focused on evaluating the effects of 4 commonly used McKenzie exercises on the cardiovascular system. Methods: 80 subjects in the age group of 20-59 years were randomly assigned into 4 groups according to their age, such that such that each group comprised of an equal number of subjects & equal number of males & females. Each subject performed all the 4 exercises (FIS, EIS, FIL & EIL for 10, 15 & 20 repetitions respectively. Heart rate, blood pressure & rate pressure product were recorded before & after each set of repetitions & after each type of exercise. Results: Repetitive McKenzie lumbar spine exercises had cardiovascular effects in apparently healthy subjects (both male & female. Exercises performed in lying were hemodynamically more demanding than that performed in standing, also exercises involving flexion of the lumbar spine elicited greater cardiovascular demand as compared to extension exercises i.e. FIL>EIL>FIS>EIS irrespective of the number of repetitions, 10, 15 or 20. The cardiovascular demand for a given subject increased as the number of repetitions increased, for all the 4 exercises. Conclusion: McKenzie exercises when done repetitively have cardiovascular effects in healthy subjects.

  4. The neural correlates of picture naming facilitated by auditory repetition

    Directory of Open Access Journals (Sweden)

    Heath Shiree

    2012-02-01

    Full Text Available Abstract Background Overt repetition of auditorily presented words can facilitate picture naming performance in both unimpaired speakers and individuals with word retrieval difficulties, but the underlying neurocognitive mechanisms and longevity of such effects remain unclear. This study used functional magnetic resonance imaging to examine whether different neurological mechanisms underlie short-term (within minutes and long-term (within days facilitation effects from an auditory repetition task in healthy older adults. Results The behavioral results showed that both short- and long-term facilitated items were named significantly faster than unfacilitated items, with short-term items significantly faster than long-term items. Neuroimaging analyses identified a repetition suppression effect for long-term facilitated items, relative to short-term facilitated and unfacilitated items, in regions known to be associated with both semantic and phonological processing. A repetition suppression effect was also observed for short-term facilitated items when compared to unfacilitated items in a region of the inferior temporal lobe linked to semantic processing and object recognition, and a repetition enhancement effect when compared to long-term facilitated items in a posterior superior temporal region associated with phonological processing. Conclusions These findings suggest that different neurocognitive mechanisms underlie short- and long-term facilitation of picture naming by an auditory repetition task, reflecting both phonological and semantic processing. More specifically, the brain areas engaged were consistent with the view that long-term facilitation may be driven by a strengthening of semantic-phonological connections. Short-term facilitation, however, appears to result in more efficient semantic processing and/or object recognition, possibly in conjunction with active recognition of the phonological form.

  5. Frobenius morphisms and stable module categories of repetitive algebras

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Let k be the algebraic closure of a finite field F_q and A be a finite dimensional k-algebra with a Frobenius morphism F.In the present paper we establish a relation between the stable module category of the repetitive algebra  of A and that of the repetitive algebra of the fixed-point algebra A~F.As an application,it is shown that the derived category of A~F is equivalent to the subcategory of F-stable objects in the derived category of A when A has a finite global dimension.

  6. Risk factors for hand-wrist disorders in repetitive work

    DEFF Research Database (Denmark)

    Thomsen, J. F.; Mikkelsen, S.; Andersen, JH

    2007-01-01

    (wrist pain and palpation tenderness) were determined in 3123 employees in 19 industrial settings. With the use of questionnaires and video recordings of homogenous work tasks number of wrist movements, hand force requirements and wrist position were analysed as risk factors for hand-wrist disorders......OBJECTIVES: To identify the risk of hand-wrist disorders related to repetitive movements, use of hand force and wrist position in repetitive monotonous work. METHODS: Using questionnaires and physical examinations, the prevalence and incidence of hand-wrist pain and possible extensor tendonitis...... were less consistent. Working with the hand in a non-neutral position could not be identified as a risk factor...

  7. Demonstration of a high repetition rate capillary discharge waveguide

    Energy Technology Data Exchange (ETDEWEB)

    Gonsalves, A. J., E-mail: ajgonsalves@lbl.gov; Pieronek, C.; Daniels, J.; Bulanov, S. S.; Waldron, W. L.; Mittelberger, D. E.; Leemans, W. P. [Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Liu, F.; Antipov, S.; Butler, J. E. [Euclid TechLabs, Gaithersburg, Maryland 20879 (United States); Bobrova, N. A.; Sasorov, P. V. [Keldysh Institute of Applied Mathematics, Moscow (Russian Federation)

    2016-01-21

    A hydrogen-filled capillary discharge waveguide operating at kHz repetition rates is presented for parameters relevant to laser plasma acceleration (LPA). The discharge current pulse was optimized for erosion mitigation with laser guiding experiments and MHD simulation. Heat flow simulations and measurements showed modest temperature rise at the capillary wall due to the average heat load at kHz repetition rates with water-cooled capillaries, which is promising for applications of LPAs such as high average power radiation sources.

  8. Medium Repetition Rate TEA Laser For Industrial Applications

    Science.gov (United States)

    Walter, Bruno

    1987-09-01

    The design and performance of an inexpensive compact repetitively pulsed TEA CO2 laser is described. The device uses a modified corona preionization technique and a fast transverse gas flow to achieve high repetition rates. An output energy of 500 mJ per pulse and an out-put power of 6.2W at 40Hz have been obtained. Due to the small energy needed for preionization, the efficiency of the device is high, whereas the gas dissociation is low when compared with commercial laser systems. This results in the relatively small fresh laser gas exchange of 20 ltr h-1 for long term operation.

  9. A mouse model of human repetitive mild traumatic brain injury

    OpenAIRE

    Kane, Michael J; Pérez, Mariana Angoa; Briggs, Denise I.; Viano, David C.; Kreipke, Christian W.; Kuhn, Donald M.

    2011-01-01

    A novel method for the study of repetitive mild traumatic brain injury (rmTBI) that models the most common form of head injury in humans is presented. Existing animal models of TBI impart focal, severe damage unlike that seen in repeated and mild concussive injuries, and few are configured for repetitive application. Our model is a modification of the Marmarou weight drop method and allows repeated head impacts to lightly anesthetized mice. A key facet of this method is the delivery of an imp...

  10. Convention, Repetition and Abjection: The Way of the Gothic

    OpenAIRE

    Łowczanin Agnieszka

    2014-01-01

    This paper employs Deleuze and Kristeva in an examination of certain Gothic conventions. It argues that repetition of these conventions- which endows Gothicism with formulaic coherence and consistence but might also lead to predictability and stylistic deadlock-is leavened by a novelty that Deleuze would categorize as literary “gift.” This particular kind of “gift” reveals itself in the fiction of successive Gothic writers on the level of plot and is applied to the repetition of the genre’s m...

  11. Urine concentrations of repetitive doses of inhaled salbutamol

    DEFF Research Database (Denmark)

    Elers, J; Pedersen, Lars; Henninge, J;

    2011-01-01

    We examined blood and urine concentrations of repetitive doses of inhaled salbutamol in relation to the existing cut-off value used in routine doping control. We compared the concentrations in asthmatics with regular use of beta2-agonists prior to study and healthy controls with no previous use...... of beta2-agonists. We enrolled 10 asthmatics and 10 controls in an open-label study in which subjects inhaled repetitive doses of 400 microgram salbutamol every second hour (total 1600 microgram), which is the permitted daily dose by the World Anti-Doping Agency (WADA). Blood samples were collected...

  12. A Brief Account on the Functions of Rhetorical Repetition

    Institute of Scientific and Technical Information of China (English)

    Li Yuping

    2000-01-01

    It is believed that using rhetoric devices precisely is of great importance for the English Learners, if they want to write good articles. Repetition is one of the rhetoric devices that is frequently used in English writing. This paper gives a brief account on the four functions of repetition by presenting some typical examples, focusing the reader's attention on the significance of this device in the English writing. The following are the four functions: an effective means of emphasis; making anidea clear and easier; generating emotional force; heightening a certain atmosphere.

  13. p53-independent pRB degradation contributes to a drug-induced apoptosis in AGS cells

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The retinoblastoma (RB) tumor suppressor protein, pRB, plays an important role in the regulation of mammalian cell cycle. Furthermore, several lines of evidence suggest that pRB also involves in the regulation of apoptosis. In the present study, the degradation of pRB was observed in apoptotic gastric tumor cells treated with a new potent anti-tumor component, tripchlorolide (TC). The inhibition of pRB degradation by a general cysteine protease inhibitor IDAM resulted in the reduction of the apoptotic cells. Furthermore, the survival of the gastric tumor cells under the TC treatment was enhanced by an over-expression of exogenous pRB. These results suggest that the pRB degradation of the gastric tumor cells under the TC treatment involves in the apoptotic progression. In addition, the same extent of TC-induced pRB-degradation was detected in the gastric tumor cells containing a p53 dominant-negative construct, indicating that this kind of pRB degradation is p53-independent.

  14. A functional connection between pRB and transforming growth factor beta in growth inhibition and mammary gland development.

    Science.gov (United States)

    Francis, Sarah M; Bergsied, Jacqueline; Isaac, Christian E; Coschi, Courtney H; Martens, Alison L; Hojilla, Carlo V; Chakrabarti, Subrata; Dimattia, Gabriel E; Khoka, Rama; Wang, Jean Y J; Dick, Frederick A

    2009-08-01

    Transforming growth factor beta (TGF-beta) is a crucial mediator of breast development, and loss of TGF-beta-induced growth arrest is a hallmark of breast cancer. TGF-beta has been shown to inhibit cyclin-dependent kinase (CDK) activity, which leads to the accumulation of hypophosphorylated pRB. However, unlike other components of TGF-beta cytostatic signaling, pRB is thought to be dispensable for mammary development. Using gene-targeted mice carrying subtle missense changes in pRB (Rb1(DeltaL) and Rb1(NF)), we have discovered that pRB plays a critical role in mammary gland development. In particular, Rb1 mutant female mice have hyperplastic mammary epithelium and defects in nursing due to insensitivity to TGF-beta growth inhibition. In contrast with previous studies that highlighted the inhibition of cyclin/CDK activity by TGF-beta signaling, our experiments revealed that active transcriptional repression of E2F target genes by pRB downstream of CDKs is also a key component of TGF-beta cytostatic signaling. Taken together, our work demonstrates a unique functional connection between pRB and TGF-beta in growth control and mammary gland development.

  15. Cloning and Molecular Characterization of the Schistosoma mansoni Genes RbAp48 and Histone H4

    Directory of Open Access Journals (Sweden)

    Patrícia P Souza

    2002-10-01

    Full Text Available The human nuclear protein RbAp48 is a member of the tryptophan/aspartate (WD repeat family, which binds to the retinoblastoma (Rb protein. It also corresponds to the smallest subunit of the chromatin assembly factor and is able to bind to the helix 1 of histone H4, taking it to the DNA in replication. A cDNA homologous to the human gene RbAp48 was isolated from a Schistosoma mansoni adult worm library and named SmRbAp48. The full length sequence of SmRbAp48 cDNA is 1036 bp long, encoding a protein of 308 amino acids. The transcript of SmRbAp48 was detected in egg, cercariae and schistosomulum stages. The protein shows 84% similarity with the human RbAp48, possessing four WD repeats on its C-terminus. A hypothetical tridimensional structure for the SmRbAp48 C-terminal domain was constructed by computational molecular modeling using the b-subunit of the G protein as a model. To further verify a possible interaction between SmRbAp48 and S. mansoni histone H4, the histone H4 gene was amplified from adult worm genomic DNA using degenerated primers. The gene fragment of SmH4 is 294 bp long, encoding a protein of 98 amino acids which is 100% identical to histone H4 from Drosophila melanogaster.

  16. Blindness

    Science.gov (United States)

    ... good vision would be able to read certain letters from 20 feet (6 meters) away. Eyesight this good is called 20/20 vision, although some people can see even better than that. The numbers change depending on ...

  17. p107 in the public eye: an Rb understudy and more

    Directory of Open Access Journals (Sweden)

    Wirt Stacey E

    2010-04-01

    Full Text Available Abstract p107 and its related family members Rb and p130 are critical regulators of cellular proliferation and tumorigenesis. Due to the extent of functional overlap within the Rb family, it has been difficult to assess which functions are exclusive to individual members and which are shared. Like its family members, p107 can bind a variety of cellular proteins to affect the expression of many target genes during cell cycle progression. Unlike Rb and p130, p107 is most highly expressed during the G1 to S phase transition of the cell cycle in actively dividing cells and accumulating evidence suggests a role for p107 during DNA replication. The specific roles for p107 during differentiation and development are less clear, although emerging studies suggest that it can cooperate with other Rb family members to control differentiation in multiple cell lineages. As a tumor suppressor, p107 is not as potent as Rb, yet studies in knockout mice have revealed some tumor suppressor functions in mice, depending on the context. In this review, we identify the unique and overlapping functions of p107 during the cell cycle, differentiation, and tumorigenesis.

  18. Collimated Blue and Infrared Beams Generated by Two-Photon Excitation in Rb Vapor

    CERN Document Server

    Sell, J F; DePaola, B D; Knize, R J

    2013-01-01

    Utilizing two-photon excitation in hot Rb vapor we demonstrate the generation of collimated optical fields at 420 nm and 1324 nm. Input laser beams at 780 nm and 776 nm enter a heated Rb vapor cell collinear and circularly polarized, driving Rb atoms to the $5D_{5/2}$ state. Under phase-matching conditions coherence among the $5S_{1/2}\\rightarrow 5P_{3/2}\\rightarrow 5D_{5/2} \\rightarrow 6P_{3/2}$ transitions produces a blue (420 nm) beam by four-wave mixing. We also observe a forward and backward propagating IR (1324 nm) beam, due to cascading decays through the $6S_{1/2}\\rightarrow 5P_{1/2}$ states. Power saturation of the generated beams is investigated by scaling the input powers to greater than 200 mW, resulting in a coherent blue beam of 9.1 mW power, almost an order of magnitude larger than previously achieved. We measure the dependences of both beams in relation to the Rb density, the frequency detuning between Rb ground state hyperfine levels, and the input laser intensities.

  19. Bioconversion of ginsenoside Rb1 into compound K by Leuconostoc citreum LH1 isolated from kimchi

    Directory of Open Access Journals (Sweden)

    Lin-Hu Quan

    2011-09-01

    Full Text Available About 40 different types of ginsenoside (ginseng saponin, a major pharmacological component of ginseng, have been identified along with their physiological activities. Among these, compound K has been reported to prevent the development of and the metastasis of cancer by blocking the formation of tumors and suppressing the invasion of cancerous cells. In this study, ginsenoside Rb1 was converted into compound K via interaction with the enzyme secreted by β-glucosidase active bacteria, Leuconostoc citreum LH1, extracted from kimchi. The optimum time for the conversion of Rb1 to compound K was about 72 hrs at a constant pH of 6.0 and an optimum temperature of about 30ºC. Under optimal conditions, ginsenoside Rb1 was decomposed and converted into compound K by 72 hrs post-reaction (99%. Both TLC and HPLC were used to analyze the enzymatic reaction. Ginsenoside Rb1 was consecutively converted to ginsenoside Rd, F2, and compound K via the hydrolyses of 20-C β-(1 → 6-glucoside, 3-C β-(1 → 2glucoside, and 3-C β-glucose of ginsenoside Rb1.

  20. Solar photocatalytic degradation of RB5 by ferrite bismuth nanoparticles synthesized via ultrasound.

    Science.gov (United States)

    Soltani, T; Entezari, M H

    2013-09-01

    In this paper, the photocatalytic degradation of Reactive Black 5 (RB5) was investigated with ferrite bismuth synthesized via ultrasound under direct sunlight irradiation. The intensity of absorption peaks of RB5 gradually decreased by increasing the irradiation time and finally vanished in 50 min in acidic medium. The formation of new intermediate was observed in basic medium. The relative concentration of RB5 in solution and on the surface of ferrite bismuth (BiFeO3) nanoparticles was considered during the experiment in acidic and basic media. The effects of various parameters such as amount of catalyst, concentration of dye, and pH of the solution have been studied on the dye degradation. The adsorption isotherm and the kinetic of photocatalytic degradation of RB5 were investigated. The adsorption constants in the dark and in the presence of sunlight irradiation were compared. The photocatalytic degradation mechanism of RB5 has been evaluated through the addition of some scavengers to the solution. In addition, the stability and reusability of the catalyst were examined in this work.