DISCOVERY OF A NEW SOFT GAMMA REPEATER: SGR J0418 + 5729
International Nuclear Information System (INIS)
Van der Horst, A. J.; Connaughton, V.; Briggs, M. S.; Kouveliotou, C.; Goegues, E.; Kaneko, Y.; Wachter, S.; Granot, J.; Ramirez-Ruiz, E.; Woods, P. M.; Aptekar, R. L.; Frederiks, D. D.; Golenetskii, S.; Barthelmy, S. D.; Cummings, J. R.; Gehrels, N.; Finger, M. H.; Gelino, C. R.; Gelino, D. M.; Hurley, K.
2010-01-01
On 2009 June 5, the Gamma-ray Burst Monitor (GBM) onboard the Fermi Gamma-ray Space Telescope triggered on two short and relatively dim bursts with spectral properties similar to soft gamma repeater (SGR) bursts. Independent localizations of the bursts by triangulation with the Konus-RF and with the Swift satellite confirmed their origin from the same, previously unknown, source. The subsequent discovery of X-ray pulsations with the Rossi X-ray Timing Explorer confirmed the magnetar nature of the new source, SGR J0418 + 5729. We describe here the Fermi/GBM observations, the discovery and the localization of this new SGR, and our infrared and Chandra X-ray observations. We also present a detailed temporal and spectral study of the two GBM bursts. SGR J0418 + 5729 is the second source discovered in the same region of the sky in the last year, the other one being SGR J0501 + 4516. Both sources lie in the direction of the galactic anti-center and presumably at the nearby distance of ∼2 kpc (assuming they reside in the Perseus arm of our Galaxy). The near-threshold GBM detection of bursts from SGR J0418 + 5729 suggests that there may be more such 'dim' SGRs throughout our Galaxy, possibly exceeding the population of 'bright' SGRs. Finally, using sample statistics, we conclude that the number of observable active magnetars in our Galaxy at any given time is ∼<10, in agreement with our earlier estimates.
Magnetar Observations in the Swift-Fermi/GBM Era
Kouveliotou, Chryssa
2010-01-01
NASA's Fermi Observatory was launched June 11, 2008; the Fermi Gamma Ray Burst Monitor (GBM) began normal operations on July 14, about a month after launch, when the trigger algorithms were enabled. Since then, and against all odds, GBM recorded over 600 bursts from 4 SGRs. Of these four sources, only one was an old magnetar: SGR J1806+20. SGR J0501+4516, was discovered with Swift and extensively monitored with GBM. A source originally classified as AXP 1E1547.0-5408 exhibited SGR-like bursting behavior and we reclassified it as SGR J1550-5418. Finally, GBM discovered SGR J0418+5729 on 2009 June. Finally, on March 2010, a third new magnetar was discovered with Swift, SGR J1833-0832. I report below on the current status of the field and on several results combining multi-satellite and ground-based data
CHANDRA OBSERVATION OF THE TeV SOURCE HESS J1834-087
International Nuclear Information System (INIS)
Misanovic, Zdenka; Kargaltsev, Oleg; Pavlov, George G.
2011-01-01
Chandra ACIS observed the field of the extended TeV source HESS J1834-087 for 47 ks. A previous XMM-Newton EPIC observation of the same field revealed a point-like source (XMMU J183435.3-084443) and an offset region of faint extended emission. In the low-resolution, binned EPIC images the two appear to be connected. However, the high-resolution Chandra ACIS images do not support the alleged connection. In these images, XMMU J183435.3-084443 is resolved into a point source, CXOU J183434.9-084443 (L 0.5-8keV ≅ 2.3 x 10 33 erg s -1 , for a distance of 4 kpc; photon index Γ ≅ 1.1), and a compact (∼ 0.5-8keV ≅ 4.1 x 10 33 erg s -1 , Γ ≅ 2.7). The nature of the nebula is uncertain. We discuss a dust scattering halo and a pulsar-wind nebula as possible interpretations. Based on our analysis of the X-ray data, we re-evaluate the previously suggested interpretations of HESS J1834-087 and discuss a possible connection to the Fermi Large Area Telescope source 1FGL J1834.3-0842c. We also obtained an upper limit of 3 x 10 -14 erg cm -2 s -1 on the unabsorbed flux of the SGR J1833-0832 (in quiescence), which happened to be in the ACIS field of view.
Hard burst emission from the soft gamma repeater SGR 1900+14
Woods, P.M.; Kouveliotou, C.; van Paradijs, J.; Briggs, M.S.; Hurley, K.; Göğüş, E.; Preece, R.D.; Giblin, T.W.; Thompson, C.; Duncan, R.C.
1999-01-01
We present evidence for burst emission from SGR 1900+14 with a power-law high-energy spectrum extending beyond 500 keV. Unlike previous detections of high-energy photons during bursts from soft gamma repeaters (SGRs), these emissions are not associated with extraordinarily bright flares. Not only is
Quiet but still bright: XMM-Newton observations of the soft gamma-ray repeater SGR 0526-66
Tiengo, A.; Esposito, P.; Mereghetti, S.; Israel, G.L.; Stella, L.; Turolla, R.; Zane, S.; Rea, N.; Götz, D.; Feroci, M.
2009-01-01
SGR 0526-66 was the first soft gamma-ray repeater (SGR) from which a giant flare was detected in March 1979, suggesting the existence of magnetars, i.e. neutron stars powered by the decay of their extremely strong magnetic field. Since then, very little information has been obtained on this object,
Fermi/GAMMA-RAY BURST MONITOR OBSERVATIONS OF SGR J0501+4516 BURSTS
International Nuclear Information System (INIS)
Lin Lin; Zhang Shuangnan; Kouveliotou, Chryssa; Baring, Matthew G.; Van der Horst, Alexander J.; Finger, Mark H.; Guiriec, Sylvain; Preece, Robert; Chaplin, Vandiver; Bhat, Narayan; Woods, Peter M.; Goegues, Ersin; Kaneko, Yuki; Scargle, Jeffrey; Granot, Jonathan; Von Kienlin, Andreas; Watts, Anna L.; Wijers, Ralph A. M. J.; Gehrels, Neil; Harding, Alice
2011-01-01
We present our temporal and spectral analyses of 29 bursts from SGR J0501+4516, detected with the gamma-ray burst monitor on board the Fermi Gamma-ray Space Telescope during 13 days of the source's activation in 2008 (August 22- September 3). We find that the T 90 durations of the bursts can be fit with a log-normal distribution with a mean value of ∼123 ms. We also estimate for the first time event durations of soft gamma repeater (SGR) bursts in photon space (i.e., using their deconvolved spectra) and find that these are very similar to the T 90 values estimated in count space (following a log-normal distribution with a mean value of ∼124 ms). We fit the time-integrated spectra for each burst and the time-resolved spectra of the five brightest bursts with several models. We find that a single power law with an exponential cutoff model fits all 29 bursts well, while 18 of the events can also be fit with two blackbody functions. We expand on the physical interpretation of these two models and we compare their parameters and discuss their evolution. We show that the time-integrated and time-resolved spectra reveal that E peak decreases with energy flux (and fluence) to a minimum of ∼30 keV at F = 8.7 x 10 -6 erg cm -2 s -1 , increasing steadily afterward. Two more sources exhibit a similar trend: SGRs J1550-5418 and 1806-20. The isotropic luminosity, L iso , corresponding to these flux values is roughly similar for all sources (0.4-1.5 x 10 40 erg s -1 ).
vanderHorst, A. J.; Kouveliotou, C.; Gorgone, N. M.; Kaneko, Y.; Baring, M. G.; Guiriec, S.; Gogus, E,; Granot, J.; Watts, A. L.; Lin, L.;
2012-01-01
We have performed detailed temporal and time-integrated spectral analysis of 286 bursts from SGR J1550-5418 detected with the Fermi Gamma-ray Burst Monitor (GBM) in 2009 January, resulting in the largest uniform sample of temporal and spectral properties of SGR J1550-5418 bursts. We have used the combination of broadband and high time-resolution data provided with GBM to perform statistical studies for the source properties.We determine the durations, emission times, duty cycles, and rise times for all bursts, and find that they are typical of SGR bursts. We explore various models in our spectral analysis, and conclude that the spectra of SGR J15505418 bursts in the 8-200 keV band are equally well described by optically thin thermal bremsstrahlung (OTTB), a power law (PL) with an exponential cutoff (Comptonized model), and two blackbody (BB) functions (BB+BB). In the spectral fits with the Comptonized model, we find a mean PL index of -0.92, close to the OTTB index of -1. We show that there is an anti-correlation between the Comptonized E(sub peak) and the burst fluence and average flux. For the BB+BBfits, we find that the fluences and emission areas of the two BB functions are correlated. The low-temperature BB has an emission area comparable to the neutron star surface area, independent of the temperature, while the high temperature BB has a much smaller area and shows an anti-correlation between emission area and temperature.We compare the properties of these bursts with bursts observed from other SGR sources during extreme activations, and discuss the implications of our results in the context of magnetar burst models.
Energy Technology Data Exchange (ETDEWEB)
Van der Horst, A. J.; Finger, M. H. [Universities Space Research Association, NSSTC, Huntsville, AL 35805 (United States); Kouveliotou, C. [Space Science Office, VP62, NASA/Marshall Space Flight Center, Huntsville, AL 35812 (United States); Gorgone, N. M. [Connecticut College, New London, CT 06320 (United States); Kaneko, Y.; Goegues, E.; Lin, L. [Sabanc Latin-Small-Letter-Dotless-I University, Orhanl Latin-Small-Letter-Dotless-I -Tuzla, Istanbul 34956 (Turkey); Baring, M. G. [Department of Physics and Astronomy, Rice University, MS-108, P.O. Box 1892, Houston, TX 77251 (United States); Guiriec, S.; Bhat, P. N.; Chaplin, V. L.; Goldstein, A. [University of Alabama, Huntsville, CSPAR, Huntsville, AL 35805 (United States); Granot, J. [Racah Institute of Physics, Hebrew University, Jerusalem 91904 (Israel); Watts, A. L. [Astronomical Institute ' Anton Pannekoek' , University of Amsterdam, Postbus 94249, 1090 GE Amsterdam (Netherlands); Bissaldi, E.; Gruber, D. [Max Planck Institute for Extraterrestrial Physics, Giessenbachstrasse, Postfach 1312, 85748 Garching (Germany); Gehrels, N.; Harding, A. K. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Gibby, M. H.; Giles, M. M., E-mail: A.J.VanDerHorst@uva.nl [Jacobs Technology, Inc., Huntsville, AL (United States); and others
2012-04-20
We have performed detailed temporal and time-integrated spectral analysis of 286 bursts from SGR J1550-5418 detected with the Fermi Gamma-ray Burst Monitor (GBM) in 2009 January, resulting in the largest uniform sample of temporal and spectral properties of SGR J1550-5418 bursts. We have used the combination of broadband and high time-resolution data provided with GBM to perform statistical studies for the source properties. We determine the durations, emission times, duty cycles, and rise times for all bursts, and find that they are typical of SGR bursts. We explore various models in our spectral analysis, and conclude that the spectra of SGR J1550-5418 bursts in the 8-200 keV band are equally well described by optically thin thermal bremsstrahlung (OTTB), a power law (PL) with an exponential cutoff (Comptonized model), and two blackbody (BB) functions (BB+BB). In the spectral fits with the Comptonized model, we find a mean PL index of -0.92, close to the OTTB index of -1. We show that there is an anti-correlation between the Comptonized E{sub peak} and the burst fluence and average flux. For the BB+BB fits, we find that the fluences and emission areas of the two BB functions are correlated. The low-temperature BB has an emission area comparable to the neutron star surface area, independent of the temperature, while the high-temperature BB has a much smaller area and shows an anti-correlation between emission area and temperature. We compare the properties of these bursts with bursts observed from other SGR sources during extreme activations, and discuss the implications of our results in the context of magnetar burst models.
BURST TAILS FROM SGR J1550–5418 OBSERVED WITH THE ROSSI X-RAY TIMING EXPLORER
Energy Technology Data Exchange (ETDEWEB)
Muş, Sinem Şaşmaz; Gögüş, Ersin; Kaneko, Yuki; Chakraborty, Manoneeta; Aydın, Berk, E-mail: sinemsmus@sabanciuniv.edu [Sabancı University, Faculty of Engineering and Natural Sciences, Orhanlı Tuzla 34956 Istanbul (Turkey)
2015-07-01
We present the results of our extensive search using the Bayesian block method for long tails following short bursts from a magnetar, SGR J1550–5418, over all RXTE observations of the source. We identified four bursts with extended tails, most of which occurred during its 2009 burst active episode. The durations of tails range between ∼13 s and over 3 ks, which are much longer than the typical duration of bursts. We performed detailed spectral and temporal analyses of the burst tails. We find that the spectra of three tails show a thermal nature with a trend of cooling throughout the tail. We compare the results of our investigations with the properties of four other extended tails detected from SGR 1900+14 and SGR 1806–20 and suggest a scenario for the origin of the tail in the framework of the magnetar model.
A note on the puzzling spindown behavior of the Galactic center magnetar SGR J1745–2900
International Nuclear Information System (INIS)
Tong, Hao
2015-01-01
SGR J1745–2900 is a magnetar near the Galactic center. X-ray observations of this source found a decreasing X-ray luminosity accompanied by an enhanced spindown rate. This negative correlation between X-ray luminosity and spindown rate is hard to understand. The wind braking model of magnetars is employed to explain this puzzling spindown behavior. During the release of magnetic energy of magnetars, a system of particles may be generated. Some of these particles remain trapped in the magnetosphere and may contribute to the X-ray luminosity. The rest of the particles can flow out and take away the rotational energy of the central neutron star. A smaller polar cap angle will cause the decrease of X-ray luminosity and enhanced spindown rate of SGR J1745–2900. This magnetar is shortly expected to have a maximum spindown rate. (paper)
Quiet but still bright: XMM-Newton observations of the soft gamma-ray repeater SGR 0526-66
International Nuclear Information System (INIS)
Tiengo, A.; Esposito, P.; Mereghetti, S.; Esposito, P.; Israel, G.L.; Stella, L.; Turolla, R.; Turolla, R.; Zane, S.; Rea, N.; Gotz, D.; Feroci, M.
2009-01-01
SGR 0526-66 was the first soft gamma-ray repeater from which a giant flare was detected in 1979 March, suggesting the existence of magnetars, i.e. neutron stars powered by the decay of their extremely strong magnetic field. Since then, very little information has been obtained on this object, mainly because it has been burst inactive since 1983 and the study of its persistent X-ray emission has been hampered by its large distance and its location in a X-ray bright supernova remnant in the Large Magellanic Cloud. Here, we report on a comprehensive analysis of all the available XMM-Newton observations of SGR 0526-66. In particular, thanks to a deep observation taken in 2007, we measured its pulsation period (P = 8.0544 ± 0.0002 s) 6 years after its latest detection by Chandra. This allowed us to detect for the first time a significant reduction of its spin-down rate. From a comparison with two shorter XMM-Newton observations performed in 2000 and 2001, we found no significant changes in the spectrum, which is well modelled by an absorbed power law with nH = 4.6E+21 cm -2 and photon index = 3.27. The high luminosity about 4E+35 erg/s, in the 1-10 keV energy band) still observed about 25 years after the latest detection of bursting activity places SGR 0526-66 in the group of bright and persistent magnetar candidates. (authors)
RXTE All-Sky Monitor Localization of SGR 1627-41
Smith, Donald A.; Bradt, Hale V.; Levine, Alan M.
1999-01-01
The fourth unambiguously identified Soft Gamma Repeater (SGR), SGR1627-41, was discovered with the BATSE instrument on 1998 June 15 (Kouveliotou et al. 1998). Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6 deg segment of a narrow (19") annulus (Hurley et al. 1999; Woods et al. 1998). We present two bursts from this source observed by the All-Sky Monitor (ASM) on RXTE. We use the ASM data to further constrain the source location to a 5'...
The SSS classical nova V5116 Sgr
Sala, G.; Ness, J.; Greiner, J.; Hernanz, M.
2017-10-01
XMM-Newton observed the nova V5116 Sgr during its supersoft phase (SSS). V5116 Sgr showed a decrease of the flux by a factor around 8 during 2/3 of the orbital period. The broad band EPIC spectra remain unchanged during the different flux phases, suggesting an occultation of the central source in a high inclination system. While the global SED does not change significantly, the RGS spectrum is changing between the high and the low flux phases. The non-occultation phase shows a typical white dwarf atmosphere spectrum, dominated by absorption lines. During the low flux periods an extra component of emission lines is superimposed to the soft X-ray continuum. This supports the picture of V5116 Sgr as the clearest example of a system switching between the SSa class of SSS novae, with spectra dominated by absorption lines, and the SSe class, showing an emission lines component. In addition, the simultaneous OM images allow us to find a phase solution for the X-ray light-curve. A thick rim of the accretion disk as the one developed for the SSSs CAL 87, RX J0019.8, and RX J0513.9 could provide a plausible model both for the optical and the X-ray light curve of V5116 Sgr.
NCBI nr-aa BLAST: CBRC-ACAR-01-0832 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0832 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-142 60% ...
RXTE All-Sky Monitor Localization of SGR 1627-41
Smith, D. A.; Bradt, H. V.; Levine, A. M.
1999-09-01
The fourth unambiguously identified Soft Gamma Repeater (SGR), SGR 1627--41, was discovered with the BATSE instrument on 1998 June 15 (Kouveliotou et al. 1998). Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6(deg) segment of a narrow (19('') ) annulus (Hurley et al. 1999; Woods et al. 1998). We report on two bursts from this source observed by the All-Sky Monitor (ASM) on RXTE. We use the ASM data to further constrain the source location to a 5(') long segment of the BATSE/IPN error box. The ASM/IPN error box lies within 0.3(') of the supernova remnant (SNR) G337.0--0.1. The probability that a SNR would fall so close to the error box purely by chance is ~ 5%.
Pumpe, Daniel; Gabler, Michael; Steininger, Theo; Enßlin, Torsten A.
2018-02-01
Quasi-periodic oscillations (QPOs) discovered in the decaying tails of giant flares of magnetars are believed to be torsional oscillations of neutron stars. These QPOs have a high potential to constrain properties of high-density matter. In search for quasi-periodic signals, we study the light curves of the giant flares of SGR 1806-20 and SGR 1900+14, with a non-parametric Bayesian signal inference method called D3PO. The D3PO algorithm models the raw photon counts as a continuous flux and takes the Poissonian shot noise as well as all instrument effects into account. It reconstructs the logarithmic flux and its power spectrum from the data. Using this fully noise-aware method, we do not confirm previously reported frequency lines at ν ≳ 17 Hz because they fall into the noise-dominated regime. However, we find two new potential candidates for oscillations at 9.2 Hz (SGR 1806-20) and 7.7 Hz (SGR 1900+14). If these are real and the fundamental magneto-elastic oscillations of the magnetars, current theoretical models would favour relatively weak magnetic fields B̅ 6× 1013-3 × 1014 G (SGR 1806-20) and a relatively low shear velocity inside the crust compared to previous findings. Data are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/610/A61
An X-ray Pulsar with a Superstrong Magnetic Field in the Soft Gamma-Ray Repeater SGR1806-20
Kouveliotou, C.; Dieters, S.; Strohmayer, T.; vanParadijs, J.; Fishman, G. J.; Meegan, C. A.; Hurley, K.; Kommers, J.; Smith, I.; Frail, D.;
1998-01-01
Soft gamma-ray repeaters (SGRs) emit multiple, brief (approximately O.1 s) intense outbursts of low-energy gamma-rays. They are extremely rare; three are known in our galaxy and one in the Large Magellanic Cloud. Two SGRs are associated with young supernova remnants (SNRs), and therefore most probably with neutron stars, but it remains a puzzle why SGRs are so different from 'normal' radio pulsars. Here we report the discovery of pulsations in the persistent X-ray flux of SGR1806-20, with a period of 7.47 s and a spindown rate of 2.6 x 10(exp -3) s/yr. We argue that the spindown is due to magnetic dipole emission and find that the pulsar age and (dipolar) magnetic field strength are approximately 1500 years and 8 x 10(exp 14) gauss, respectively. Our observations demonstrate the existence of 'magnetars', neutron stars with magnetic fields about 100 times stronger than those of radio pulsars, and support earlier suggestions that SGR bursts are caused by neutron-star 'crust-quakes' produced by magnetic stresses. The 'magnetar' birth rate is about one per millenium, a substantial fraction of that of radio pulsars. Thus our results may explain why some SNRs have no radio pulsars.
2010-10-01
... supplies exceeding $5,000 in total aggregate fair market value upon termination or completion of the award... 49 Transportation 1 2010-10-01 2010-10-01 false Supplies. 18.33 Section 18.33 Transportation... Supplies. (a) Title. Title to supplies acquired under a grant or subgrant will vest, upon acquisition, in...
Rossi X-Ray Timing Explorer All-Sky Monitor Localization of SGR 1627-41
Smith, Donald A.; Bradt, Hale V.; Levine, Alan M.
1999-07-01
The fourth unambiguously identified soft gamma repeater (SGR), SGR 1627-41, was discovered with the BATSE instrument on 1998 June 15. Interplanetary Network (IPN) measurements and BATSE data constrained the location of this new SGR to a 6° segment of a narrow (19") annulus. We present two bursts from this source observed by the All-Sky Monitor (ASM) on the Rossi X-Ray Timing Explorer. We use the ASM data to further constrain the source location to a 5' long segment of the BATSE/IPN error box. The ASM/IPN error box lies within 0.3 arcmin of the supernova remnant G337.0-0.1. The probability that a supernova remnant would fall so close to the error box purely by chance is ~5%.
The Parallax of the Red Hypergiant VX Sgr with Accurate Tropospheric Delay Calibration
Xu, Shuangjing; Zhang, Bo; Reid, Mark J.; Menten, Karl M.; Zheng, Xingwu; Wang, Guangli
2018-05-01
We report astrometric results of VLBI phase-referencing observations of 22 GHz H2O masers emission toward the red hypergiant VX Sgr, one of most massive and luminous red hypergiant stars in our Galaxy, using the Very Long Baseline Array. A background source, J1820‑2528, projected 4.°4 from the target VX Sgr, was used as the phase reference. For the low decl. of these sources, such a large separation normally would seriously degrade the relative astrometry. We use a two-step method of tropospheric delay calibration, which combines the VLBI geodetic-block (or Global Positioning System) calibration with an image-optimization calibration, to obtain a trigonometric parallax of 0.64 ± 0.04 mas, corresponding to a distance of {1.56}-0.10+0.11 kpc. The measured proper motion of VX Sgr is 0.36 ± 0.76 and ‑2.92 ± 0.78 mas yr‑1 in the eastward and northward directions. The parallax and proper motion confirms that VX Sgr belong to the Sgr OB1 association. Rescaling bolometric luminosities in the literature to our parallax distance, we find that the luminosity of VX Sgr is (1.95 ± 0.62) × 105 L ⊙, where the uncertainty is dominated by differing photometry measurements.
International Nuclear Information System (INIS)
Karplus, H.B.
1984-01-01
J. D. Aindow and R. C. Chivers [J. Acoust. Soc. Am. 73, 1833 (1983)] compared the precision of the direct ''time-of-flight'' technique with the ''sing-around'' method for sound velocity measurement. Their conclusion is changed by the newer, faster, commercial clocks (2 ns HP5345<0.1 ns HP5370), giving the advantage to the time of flight method. The analysis is herewith augmented by calculating the time jitter in terms of signal to noise ratio, which was correctly shown to be negligible with 100-ns clocks, but becomes increasingly more significant with faster clocks
Energy Technology Data Exchange (ETDEWEB)
Younes, George; Kouveliotou, Chryssa; Van der Horst, Alexander J. [Department of Physics, The George Washington University, Washington, DC 20052 (United States); Jaodand, Amruta; Hessels, Jason W. T. [ASTRON, the Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA Dwingeloo (Netherlands); Baring, Matthew G. [Department of Physics and Astronomy, Rice University, MS-108, P.O. Box 1892, Houston, TX 77251 (United States); Harding, Alice K.; Gehrels, Neil [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Gill, Ramandeep; Granot, Jonathan [Department of Natural Sciences, The Open University of Israel, 1 University Road, P.O. Box 808, Raánana 43537 (Israel); Huppenkothen, Daniela [Center for Data Science, New York University, 726 Broadway, 7th Floor, New York, NY 10003 (United States); Göğüş, Ersin [Sabancı University, Orhanlı-Tuzla, İstanbul 34956 (Turkey); Lin, Lin, E-mail: gyounes@gwu.edu [Department of Astronomy, Beijing Normal University, Beijing 100875 (China)
2017-10-01
We analyzed broadband X-ray and radio data of the magnetar SGR J1935+2154 taken in the aftermath of its 2014, 2015, and 2016 outbursts. The source soft X-ray spectrum <10 keV is well described with a blackbody+power-law (BB+PL) or 2BB model during all three outbursts. Nuclear Spectroscopic Telescope Array observations revealed a hard X-ray tail, with a PL photon index Γ = 0.9, extending up to 50 keV, with flux comparable to the one detected <10 keV. Imaging analysis of Chandra data did not reveal small-scale extended emission around the source. Following the outbursts, the total 0.5–10 keV flux from SGR J1935+2154 increased in concordance to its bursting activity, with the flux at activation onset increasing by a factor of ∼7 following its strongest 2016 June outburst. A Swift /X-Ray Telescope observation taken 1.5 days prior to the onset of this outburst showed a flux level consistent with quiescence. We show that the flux increase is due to the PL or hot BB component, which increased by a factor of 25 compared to quiescence, while the cold BB component kT = 0.47 keV remained more or less constant. The 2014 and 2015 outbursts decayed quasi-exponentially with timescales of ∼40 days, while the stronger 2016 May and June outbursts showed a quick short-term decay with timescales of about four days. Our Arecibo radio observations set the deepest limits on the radio emission from a magnetar, with a maximum flux density limit of 14 μ Jy for the 4.6 GHz observations and 7 μ Jy for the 1.4 GHz observations. We discuss these results in the framework of the current magnetar theoretical models.
Energy Technology Data Exchange (ETDEWEB)
Lynch, Ryan S.; Archibald, Robert F.; Kaspi, Victoria M.; Scholz, Paul, E-mail: rlynch@physics.mcgill.ca [Department of Physics, McGill University, 3600 University Street, Montreal, Quebec, H3A 2T8 (Canada)
2015-06-20
We present results from eight months of Green Bank Telescope 8.7 GHz observations and nearly 18 months of Swift X-ray telescope observations of the radio magnetar SGR J1745–2900. We tracked the radio and X-ray flux density, polarization properties, profile evolution, rotation, and single-pulse behavior. We identified two main periods of activity. The first is characterized by approximately 5.5 months of relatively stable evolution in radio flux density, rotation, and profile shape, while in the second these properties varied substantially. Specifically, a third profile component emerged and the radio flux also became more variable. The single pulse properties also changed, most notably with a larger fraction of pulses with pulse widths ∼5–20 ms in the erratic state. Bright single pulses are well described by a log-normal energy distribution at low energies, but with an excess at high energies. The 2–10 keV flux decayed steadily since the initial X-ray outburst, while the radio flux remained stable to within ∼20% during the stable state. A joint pulsar timing analysis of the radio and X-ray data shows a level of timing noise unprecedented in a radio magnetar, though during the time covered by the radio data alone the timing noise was at a level similar to that observed in other radio magnetars. While SGR J1745–2900 is similar to other radio magnetars in many regards, it differs by having experienced a period of relative stability in the radio that now appears to have ended, while the X-ray properties evolved independently.
Directory of Open Access Journals (Sweden)
Roberto Nesci
2014-12-01
Full Text Available The nature of V2282 Sgr is examined on the basis of several multiband observations: a 20 years long I-band light curve of V2282 Sgr obtained from archive photographic plates of the Asiago and Catania Observatories; a CCD R-band light curve obtained at Cornero Observatory; JHK photometry from 2MASS and UKDISS; Spitzer IRAC and MIPS images; optical spectra from Loiano Observatory; X-ray flux from CHANDRA. The star has a K-type spectrum with strong emission lines and is irregularly variable at all wavebands. The overall evidences suggest that V2282 Sgr is a Pre Main Sequence star with an accretion disk.
Large Torque Variations in Two Soft Gamma Repeaters
Woods, P.M.; Kouveliotou, C.; Göğüş, E.; Finger, M.H.; Swank, J.; Markwardt, C.B.; Hurley, K.; van der Klis, M.
2002-01-01
We have monitored the pulse frequencies of the two soft gamma repeaters SGR 1806-20 and SGR 1900+14 through the beginning of year 2001 using primarily Rossi X-Ray Timing Explorer Proportional Counter Array observations. In both sources, we observe large changes in the spin-down torque up to a factor
The X-ray outburst of the Galactic Centre magnetar SGR J1745-2900 during the first 1.5 year
Coti Zelati, F.; Rea, N.; Papitto, A.; Viganò, D.; Pons, J.A.; Turolla, R.; Esposito, P.; Haggard, D.; Baganoff, F.K.; Ponti, G.; Israel, G.L.; Campana, S.; Torres, D.F.; Tiengo, A.; Mereghetti, S.; Perna, R.; Zane, S.; Mignani, R.P.; Possenti, A.; Stella, L.
2015-01-01
In 2013 April a new magnetar, SGR 1745−2900, was discovered as it entered an outburst, at only 2.4 arcsec angular distance from the supermassive black hole at the centre of the Milky Way, Sagittarius A*. SGR 1745−2900 has a surface dipolar magnetic field of ∼2 × 1014 G, and it is the neutron star
Search for soft gamma repeaters in the SMM/HXRBS data
Kouveliotou, C.; Norris, J. P.; Wood, K. S.; Cline, T. L.; Dennis, B. R.; Desal, U. D.; Orwig, L. E.
1992-01-01
The triggered fast memory of the hard X-ray burst spectrometer (HXRBS) on board the SMM is used to describe the results of a search for short transients resembling soft gamma repeater (SGR) bursts. Memory data for a total of about 4000 burst triggers, out of which only a very few could be considered as valid SGR candidate events, are analyzed. The search methodology is outlined, the HXRBS exposure and sensitivity to SGR bursts are calculated, and the criteria which constrain the number of candidate events are described. An upper limit is given for the SGR source number density. This limit, combined with results from other relevant observations and the assumption of a neutron star origin, are applied to obtain a constraint on SGR-active lifetimes.
PG 0832 + 676 - An apparently normal B1 V star 18 kiloparsecs above the galactic plane
International Nuclear Information System (INIS)
Brown, P.J.F.; Dufton, P.L.; Keenan, F.P.; Boksenberg, A.; King, D.L.
1989-01-01
Stellar equivalent widths and line profiles, measured from optical spectra obtained with the 5 m Hale telescope and the 2.5 m Isaac Newton telescope, are used in conjunction with model atmosphere calculations to determine the atmospheric parameters and chemical composition of the faint, blue, high-galactic latitude star PG 0832 + 676. The effective temperature (Teff = 25,000 K), surface gravity (log g = 3.9), and abundances of He, C, N, O, Mg, Al, and Si are similar to those of Population I OB-type stars, from which it is concluded that PG 0832 + 676 is a normal star at a distance from the galactic plane of about 18 kpc. The star's kinematics and evolutionary age suggest that it formed in the halo, possibly from galactic fountain material. 51 refs
DEFF Research Database (Denmark)
Zhang, Shuo; Hailey, Charles J.; Mori, Kaya
2015-01-01
In 2013, NuSTAR observed the Sgr B2 region and for the first time resolved its hard X-ray emission on subarcminute scales. Two prominent features are detected above 10 keV:. a newly emerging cloud, G0.66-0.13, and the central 90 '' radius region containing two compact cores, Sgr B2(M) and Sgr B2(N......), surrounded by diffuse emission. It is inconclusive whether the remaining level of Sgr. B2 emission is still decreasing or has reached a constant background level. A decreasing X-ray emission can be best explained by the X-ray reflection nebula scenario, where the cloud reprocesses a past giant outburst from...... Sgr A*. In the X-ray reflection nebula (XRN) scenario, the 3-79 keV Sgr. B2 spectrum allows us to self-consistently test the XRN model using both the Fe K alpha line and the continuum emission. The peak luminosity of the past Sgr A* outburst is constrained to L3-79keV∼5 x 1038 ergs s-1. A newly...
Quasi-periodic oscillations in short recurring bursts of the soft gamma repeater J1550–5418
Energy Technology Data Exchange (ETDEWEB)
Huppenkothen, D.; D' Angelo, C.; Watts, A. L.; Heil, L.; Van der Klis, M.; Van der Horst, A. J. [Astronomical Institute " Anton Pannekoek," University of Amsterdam, Postbus 94249, 1090 GE Amsterdam (Netherlands); Kouveliotou, C. [Astrophysics Office, ZP 12, NASA-Marshall Space Flight Center, Huntsville, AL 35812 (United States); Baring, M. G. [Department of Physics and Astronomy, Rice University, MS-108, P.O. Box 1892, Houston, TX 77251 (United States); Göğüş, E.; Kaneko, Y. [SabancıUniversity, Orhanlı-Tuzla, İstanbul 34956 (Turkey); Granot, J. [Department of Natural Sciences, The Open University of Israel, 1 University Road, P.O. Box 808, Ra' anana 43537 (Israel); Lin, L. [François Arago Centre, APC, 10 rue Alice Domon et Léonie Duquet, F-75205 Paris (France); Von Kienlin, A. [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Younes, G., E-mail: D.Huppenkothen@uva.nl [NSSTC, 320 Sparkman Drive, Huntsville, AL 35805 (United States)
2014-06-01
The discovery of quasi-periodic oscillations (QPOs) in magnetar giant flares has opened up prospects for neutron star asteroseismology. The scarcity of giant flares makes a search for QPOs in the shorter, far more numerous bursts from soft gamma repeaters (SGRs) desirable. In Huppenkothen et al., we developed a Bayesian method for searching for QPOs in short magnetar bursts, taking into account the effects of the complicated burst structure, and have shown its feasibility on a small sample of bursts. Here we apply the same method to a much larger sample from a burst storm of 286 bursts from SGR J1550–5418. We report a candidate signal at 260 Hz in a search of the individual bursts, which is fairly broad. We also find two QPOs at ∼93 Hz, and one at 127 Hz, when averaging periodograms from a number of bursts in individual triggers, at frequencies close to QPOs previously observed in magnetar giant flares. Finally, for the first time, we explore the overall burst variability in the sample and report a weak anti-correlation between the power-law index of the broadband model characterizing aperiodic burst variability and the burst duration: shorter bursts have steeper power-law indices than longer bursts. This indicates that longer bursts vary over a broader range of timescales and are not simply longer versions of the short bursts.
Corrales, Lia; Mon, Brayden; Haggard, Daryl; Baganoff, Frederick K.; Garmire, Gordon; Degenaar, Nathalie; Reynolds, Mark
2017-08-01
The supermassive black hole at the center of our galaxy, Sgr A*, is surprisingly under-luminous. This problem has motivated a host of theoretical models to explain low-level radiatively inefficient accretion flows onto compact objects. We discuss how the Galactic Center sight line, which is optically thick to the scattering of soft X-rays (tau ~ 5), affects high resolution studies of the accretion flow around Sgr A*. X-ray light from compact objects in the dense GC environment is scattered by foreground dust, producing scattering echoes that are time delayed relative to the X-ray source's light curve. We discuss the scattering halo of SWIFT J174540.7-290015, which underwent the brightest X-ray outburst within 30’' of Sgr A*. Preliminary fits to the scattering halo suggest that a small amount of foreground dust, within 250 pc of the GC, affects the X-ray surface brightness profile within 10’' of any GC point source. The associated time delay is on the order of several hours, which is important for understanding the quiescent accretion flow of Sgr A*. We take advantage of the Chandra Galactic Center XVP dataset to explore the effect of the interstellar medium on the inferred characteristics of Sgr A*.
International Nuclear Information System (INIS)
Trippe, S; Gillessen, S; Ott, T; Eisenhauer, F; Paumard, T; Martins, F; Genzel, R; Schoedel, R; Eckart, A; Alexander, T
2006-01-01
In this article we present and discuss the latest results from the observations of stars (''S-stars'') orbiting Sgr A* . With improving data quality the number of observed S-stars has increased substantially in the last years. The combination of radial velocity and proper motion information allows an ever more precise determination of orbital parameters and of the mass of and the distance to the supermassive black hole in the centre of the Milky Way. Additionally, the orbital solutions allow us to verify an agreement between the NIR source Sgr A* and the dynamical centre of the stellar orbits to within 2 mas
Studying MHD and radiative processes in Sgr A*
Dibi, S.
2014-01-01
This thesis details four different studies of accretion and emission processes around the Galactic Center Sgr A*. We are studying Sgr A* in particular because it is the closest supermassive black hole and therefore we have incomparable observational data to test our theories and predictions.
DEFF Research Database (Denmark)
Gotz, D.; Mereghetti, S.; Molkov, S.
2006-01-01
SGR 1806-20 has been observed for more than 2 years with the INTEGRAL satellite. In this period the source went from a quiescent state into a very active one culminating in a giant flare on December 27, 2004. Here we report on the properties of all the short bursts detected with INTEGRAL before t...
SGR-like behaviour of the repeating FRB 121102
Energy Technology Data Exchange (ETDEWEB)
Wang, F.Y.; Yu, H., E-mail: fayinwang@nju.edu.cn, E-mail: yuhai@smail.nju.edu.cn [School of Astronomy and Space Science, Nanjing University, 163 Xianlin Avenue, Nanjing, 210093 China (China)
2017-03-01
Fast radio bursts (FRBs) are millisecond-duration radio signals occurring at cosmological distances. However the physical model of FRBs is mystery, many models have been proposed. Here we study the frequency distributions of peak flux, fluence, duration and waiting time for the repeating FRB 121102. The cumulative distributions of peak flux, fluence and duration show power-law forms. The waiting time distribution also shows power-law distribution, and is consistent with a non-stationary Poisson process. These distributions are similar as those of soft gamma repeaters (SGRs). We also use the statistical results to test the proposed models for FRBs. These distributions are consistent with the predictions from avalanche models of slowly driven nonlinear dissipative systems.
Depression of molecular emission in the line of sight of Sgr A West
International Nuclear Information System (INIS)
Fukui, Y.; Ogawa, H.; Deguchi, S.; Suzuki, H.
1982-01-01
The galatic center region has been mapped in the 4-mm emission lines of HCCCN (J = 8-7) and H 2 CO (JK-K+ = 1 01 -0 00 ) with a 1.5 arc min beam. The molecular lines are found to show depression in intensity in the line of sight of Sgr A West. Comparison with other molecular data indicates that NH 3 also shows a significant depression while HCN and HCO + show little sign of similar depression. Based on some density estimates we suggest that the depression means abnormally reduced abundance in HCCCN, NH 3 , and H 2 CO in the line of sight of Sgr A West. The difference in the degree of depression could be interpreted in terms of a time-dependent ion-molecule reaction scheme because HCO + and HCN are formed much more rapidly than the other molecules in the scheme
Nynka, Melania; Hailey, Charles J.; Mori, Kaya; Baganoff, Frederick K.; Bauer, Franz E.; Boggs, Steven E.; Craig, William W.; Christensen, Finn E.; Gotthelf, Eric V.; Harrison, Fiona A.;
2013-01-01
We report the unambiguous detection of non-thermal X-ray emission up to 30 keV from the Cannonball, a few arcsecond long diffuse X-ray feature near the Galactic Center, using the NuSTAR X-ray observatory. The Cannonball is a high-velocity (v(proj) approximately 500 km s(exp -1)) pulsar candidate with a cometary pulsar wind nebula (PWN) located approximately 2' north-east from Sgr A*, just outside the radio shell of the supernova remnant Sagittarius A (Sgr A) East. Its non-thermal X-ray spectrum, measured up to 30 keV, is well characterized by a Gamma is approximately 1.6 power law, typical of a PWN, and has an X-ray luminosity of L(3-30 keV) = 1.3 × 10(exp 34) erg s(exp -1). The spectral and spatial results derived from X-ray and radio data strongly suggest a runaway neutron star born in the Sgr A East supernova event. We do not find any pulsed signal from the Cannonball. The NuSTAR observations allow us to deduce the PWN magnetic field and show that it is consistent with the lower limit obtained from radio observations.
Vunk, Aldur, 1959-
2013-01-01
Pühalepa vennastekogust ja usuvabadusest. Pühalepa personaalraamatust 1817-1833. Pühalepa vennatekogu liikmetest 1817-1833. Ametlikest palvemajadest. Lugemiskohtadest ja erapalvemajadest. Pühalepa keskusest ja kihelkonna lõunaosast. Pühalepa kihelkonna keskosast. Pühalepa keskuse põhjaosast. Palukülast ja Kärdlast.
Bipartisan proposal calls for SGR repeal
Directory of Open Access Journals (Sweden)
Robbins RA
2013-11-01
Full Text Available No abstract available. Article truncated at 150 words. The Washington Post (11/1, Carey reports a bipartisan group of legislators has agreed on a framework replacing the “problematic” Medicare payment formula in an attempt to end the annual Sustainable Growth Rate (SGR or “doc fix” debate. The current system is set to reduce Medicare physician payments by approximately 25% on Jan. 1 without Congressional intervention. Senate Finance Committee Chairman Max Baucus (D-MT and House Ways and Means Committee Chairman Dave Camp (R-MI introduced a draft proposal that would “encourage care management services for individuals with complex chronic care needs through the development of new payment codes for such services, as well as leverage physician-developed standard of care guidelines to avoid the unnecessary provision of services”. The Committees value your feedback on this proposal. Please submit written comments to the Finance SGR comments mailbox at sgrcomments@finance.senate.gov and the Ways & Means SGR comments mailbox at sgrwhitepaper@mail.house.gov by Tuesday, November 12, …
The Submillimeter Polarization of Sgr A*
Marrone, Daniel P.; Moran, James M.; Zhao, Jun-Hui; Rao, Ramprasad
2006-12-01
We report on the submillimeter properties of Sgr A* derived from observations with the Submillimeter Array and its polarimeter. We ftid that the spectrum of Sgr A* between 230 and 690 GHz is slightly decreasing when measured simultaneously, indicating a transition to optically thin emission around 300 400 GHz. We also present very sensitive and well calibrated measurements of the polarization of Sgr A* at 230 and 345 GHz. With these data we are able to show for the frst time that the polarization of Sgr A* varies on hour timescales, as has been observed for the total intensity. On one night we fhd variability that may arise from a polarized "blob" orbiting the black hole. Finally, we use the ensemble of observations to determine the rotation measure. This represents the frst statistically significant rotation measure determination and the only one made without resorting to comparing position angles measured at separate epochs. We frid a rotation measure of (-5.6 ± 0.7) × 105 rad m2, with no evidence for variability on inter-day timescales at the level of the measurement error. The stability constrains interday flictuations in the accretion rate to 8%. The mean intrinsic polarization position angle is 167°±7° and we detect variations of 31+18-9 degrees. This separation of intrinsic polarization changes and possible rotation measure flictuations is now possible because of the frequency coverage and sensitivity of our data. The observable rotation measure restricts the accretion rate to the range 2 × 10-7 Mdot o yr-1 to 2 × 10-9 Mdot o yr-1, if the magnetic ffeld is near equipartition and ordered.
On the enhanced X-ray emission from SGR 1900+14 after the August 27th giant flare
International Nuclear Information System (INIS)
Ertan, Ue.; Alpar, M.A.
2004-01-01
We show that the giant flares of soft gamma ray repeaters (E∼10 44 erg) can push the inner regions of a fall-back disk out to larger radii by radiation pressure, while matter remains bound to the system for plausible parameters. The subsequent relaxation of this pushed-back matter can account for the observed enhanced X-ray emission after the August 27 th giant flare of SGR 1900+14
The Submillimeter Polarization of Sgr A*
Energy Technology Data Exchange (ETDEWEB)
Marrone, Daniel P [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Moran, James M [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Zhao, Jun-Hui [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Rao, Ramprasad [Inst. of Ast. and Astrophys., Academia Sinica, PO Box 23-141, Taipei 10617, Taiwan (China)
2006-12-15
We report on the submillimeter properties of Sgr A* derived from observations with the Submillimeter Array and its polarimeter. We ftid that the spectrum of Sgr A* between 230 and 690 GHz is slightly decreasing when measured simultaneously, indicating a transition to optically thin emission around 300-400 GHz. We also present very sensitive and well calibrated measurements of the polarization of Sgr A* at 230 and 345 GHz. With these data we are able to show for the frst time that the polarization of Sgr A* varies on hour timescales, as has been observed for the total intensity. On one night we fhd variability that may arise from a polarized 'blob' orbiting the black hole. Finally, we use the ensemble of observations to determine the rotation measure. This represents the frst statistically significant rotation measure determination and the only one made without resorting to comparing position angles measured at separate epochs. We frid a rotation measure of (-5.6 {+-} 0.7) x 10{sup 5} rad m{sup 2}, with no evidence for variability on inter-day timescales at the level of the measurement error. The stability constrains interday flictuations in the accretion rate to 8%. The mean intrinsic polarization position angle is 167{sup 0}{+-}7{sup 0} and we detect variations of 31{sup +18}{sub -9} degrees. This separation of intrinsic polarization changes and possible rotation measure flictuations is now possible because of the frequency coverage and sensitivity of our data. The observable rotation measure restricts the accretion rate to the range 2 x 10{sup -7} M o-dot yr{sup -1} to 2 x 10{sup -9} M o-dot yr{sup -1}, if the magnetic field is near equipartition and ordered.
The Submillimeter Polarization of Sgr A*
International Nuclear Information System (INIS)
Marrone, Daniel P; Moran, James M; Zhao, Jun-Hui; Rao, Ramprasad
2006-01-01
We report on the submillimeter properties of Sgr A* derived from observations with the Submillimeter Array and its polarimeter. We ftid that the spectrum of Sgr A* between 230 and 690 GHz is slightly decreasing when measured simultaneously, indicating a transition to optically thin emission around 300-400 GHz. We also present very sensitive and well calibrated measurements of the polarization of Sgr A* at 230 and 345 GHz. With these data we are able to show for the frst time that the polarization of Sgr A* varies on hour timescales, as has been observed for the total intensity. On one night we fhd variability that may arise from a polarized 'blob' orbiting the black hole. Finally, we use the ensemble of observations to determine the rotation measure. This represents the frst statistically significant rotation measure determination and the only one made without resorting to comparing position angles measured at separate epochs. We frid a rotation measure of (-5.6 ± 0.7) x 10 5 rad m 2 , with no evidence for variability on inter-day timescales at the level of the measurement error. The stability constrains interday flictuations in the accretion rate to 8%. The mean intrinsic polarization position angle is 167 0 ±7 0 and we detect variations of 31 +18 -9 degrees. This separation of intrinsic polarization changes and possible rotation measure flictuations is now possible because of the frequency coverage and sensitivity of our data. The observable rotation measure restricts the accretion rate to the range 2 x 10 -7 M o-dot yr -1 to 2 x 10 -9 M o-dot yr -1 , if the magnetic field is near equipartition and ordered
First Spectroscopic Studies and Detection in SgrB2 of 13C-DOUBLY Substitued Ethyl Cyanide
Margulès, L.; Motiyenko, R. A.; Guillemin, J.-C.; Müller, Holger S. P.; Belloche, Arnaud
2015-06-01
Ethyl cyanide (CH_3CH_2CN) is one of the most abundant complex organic molecules in the interstellar medium firstly detected in OMC-1 and Sgr B2 in 1977. The vibrationally excited states are enough populated under ISM conditions and could be detected. Apart from the deuterated ones, all mono-substituted isotopologues of ethyl cyanide (13C and 15N have been detected in the ISM. The detection of isotopologues in the ISM is important: it can give information about the formation process of complex organic molecules, and it is essential to clean the ISM spectra from the lines of known molecules in order to detect new ones. The 12C/13C ratio found in SgrB2: 20-30 suggests that the doubly 13C could be present in the spectral line survey recently obtained with ALMA (EMoCA), but no spectroscopic studies exist up to now. We measured and analyzed the spectra of the 13C-doubly-substitued species up to 1 THz with the Lille solid-state based spectrometer. The spectroscopic results and and the detection of the doubly 13C species in SgrB2 will be presented. This work was supported by the CNES and the Action sur Projets de l'INSU, PCMI. This work was also done under ANR-13-BS05-0008-02 IMOLABS. Support by the Deutsche Forschungsgemeinschaft via SFB 956, project B3 is acknowledged D.~R.~Johnson, et al., Astrophys.~J. 1977, 218, L370 A.~Belloche, et al., A&A 2013, 559, A47 A.M.~Daly, et al., Astrophys.~J. 2013, 768, 81 K.~Demyk, et al. A&A 2007 466, 255 Margulès, et al. A&A 2009, 493, 565 Belloche et al. 2014, Science, 345, 1584
Long-term monitoring of Sgr A* at 7 mm with VERA and KaVA
Akiyama, K.; Kino, M.; Sohn, B.; Lee, S.; Trippe, S.; Honma, M.
2014-05-01
We present the results of radio monitoring observations of Sgr A* at 7 mm (i.e. 43 GHz) with the VLBI Exploration of Radio Astrometry (VERA), which is a VLBI array in Japan. VERA provides angular resolution on millisecond scales, resolving structures within 100 Schwarzschild radii of Sgr A* , similar to the Very Large Baseline Array (VLBA). We performed multi-epoch observations of Sgr A* in 2005 - 2008, and started monitoring it again with VERA from 2013 January to trace the current G2 encounter event. Our preliminary results in 2013 show that Sgr A* on mas scales has been in an ordinary state as of August 2013, although some fraction of the G2 cloud already passed the pericenter of Sgr A* in April 2013. We will continue monitoring Sgr A* with VERA and the newly developed KaVA (KVN and VERA Array).
Testing the No-Hair Theorem with Sgr A*
Directory of Open Access Journals (Sweden)
Tim Johannsen
2012-01-01
Full Text Available The no-hair theorem characterizes the fundamental nature of black holes in general relativity. This theorem can be tested observationally by measuring the mass and spin of a black hole as well as its quadrupole moment, which may deviate from the expected Kerr value. Sgr A*, the supermassive black hole at the center of the Milky Way, is a prime candidate for such tests thanks to its large angular size, high brightness, and rich population of nearby stars. In this paper, I discuss a new theoretical framework for a test of the no-hair theorem that is ideal for imaging observations of Sgr A* with very long baseline interferometry (VLBI. The approach is formulated in terms of a Kerr-like spacetime that depends on a free parameter and is regular everywhere outside of the event horizon. Together with the results from astrometric and timing observations, VLBI imaging of Sgr A* may lead to a secure test of the no-hair theorem.
Variable accretion of stellar winds onto Sgr A*
Cuadra, Jorge; Nayakshin, Sergei
2006-12-01
We report a 3-dimensional numerical study of the accretion of stellar winds onto Sgr A*, the super-massive black hole at the centre of our Galaxy. Compared with previous investigations, we allow the stars to be on realistic orbits, include the recently discovered slow wind sources, and allow for optically thin radiative cooling. We frst show the strong inflience of the stellar dynamics on the accretion onto the central black hole. We then present more realistic simulations of Sgr A* accretion and frid that the slow winds shock and rapidly cool, forming cold gas clumps and flaments that coexist with the hot X-ray emitting gas. The accretion rate in this case is highly variable on time-scales of tens to hundreds of years. Such variability can in principle lead to a strongly non-linear response through accretion fbw physics not resolved here, making Sgr A* an important energy source for the Galactic centre.
Variable accretion of stellar winds onto Sgr A*
Energy Technology Data Exchange (ETDEWEB)
Cuadra, Jorge [Max-Planck-Institut fuer Astrophysik, D-85741 Garching (Germany); Nayakshin, Sergei [Department of Physics and Astronomy, University of Leicester, LEI 7RH (United Kingdom)
2006-12-15
We report a 3-dimensional numerical study of the accretion of stellar winds onto Sgr A*, the super-massive black hole at the centre of our Galaxy. Compared with previous investigations, we allow the stars to be on realistic orbits, include the recently discovered slow wind sources, and allow for optically thin radiative cooling. We frst show the strong inflience of the stellar dynamics on the accretion onto the central black hole. We then present more realistic simulations of Sgr A* accretion and frid that the slow winds shock and rapidly cool, forming cold gas clumps and flaments that coexist with the hot X-ray emitting gas. The accretion rate in this case is highly variable on time-scales of tens to hundreds of years. Such variability can in principle lead to a strongly non-linear response through accretion fbw physics not resolved here, making Sgr A* an important energy source for the Galactic centre.
Variable accretion of stellar winds onto Sgr A*
International Nuclear Information System (INIS)
Cuadra, Jorge; Nayakshin, Sergei
2006-01-01
We report a 3-dimensional numerical study of the accretion of stellar winds onto Sgr A*, the super-massive black hole at the centre of our Galaxy. Compared with previous investigations, we allow the stars to be on realistic orbits, include the recently discovered slow wind sources, and allow for optically thin radiative cooling. We frst show the strong inflience of the stellar dynamics on the accretion onto the central black hole. We then present more realistic simulations of Sgr A* accretion and frid that the slow winds shock and rapidly cool, forming cold gas clumps and flaments that coexist with the hot X-ray emitting gas. The accretion rate in this case is highly variable on time-scales of tens to hundreds of years. Such variability can in principle lead to a strongly non-linear response through accretion fbw physics not resolved here, making Sgr A* an important energy source for the Galactic centre
An expanding radio nebula produced by a giant flare from the magnetar SGR 1806-20.
Gaensler, B M; Kouveliotou, C; Gelfand, J D; Taylor, G B; Eichler, D; Wijers, R A M J; Granot, J; Ramirez-Ruiz, E; Lyubarsky, Y E; Hunstead, R W; Campbell-Wilson, D; van der Horst, A J; McLaughlin, M A; Fender, R P; Garrett, M A; Newton-McGee, K J; Palmer, D M; Gehrels, N; Woods, P M
2005-04-28
Soft gamma-ray repeaters (SGRs) are 'magnetars', a small class of slowly spinning neutron stars with extreme surface magnetic fields, B approximately 10(15) gauss (refs 1 , 2 -3). On 27 December 2004, a giant flare was detected from the magnetar SGR 1806-20 (ref. 2), only the third such event recorded. This burst of energy was detected by a variety of instruments and even caused an ionospheric disturbance in the Earth's upper atmosphere that was recorded around the globe. Here we report the detection of a fading radio afterglow produced by this outburst, with a luminosity 500 times larger than the only other detection of a similar source. From day 6 to day 19 after the flare from SGR 1806-20, a resolved, linearly polarized, radio nebula was seen, expanding at approximately a quarter of the speed of light. To create this nebula, at least 4 x 10(43) ergs of energy must have been emitted by the giant flare in the form of magnetic fields and relativistic particles.
1998-08-01
bags" containing the accumulated history of this bursting activity. The study of these plerionic supernova remnants (detailed below) gives us a new and different perspective on the magnetar phenomena. SGR 0526-66: The Famous March 5 1979 Burst SGR 0526-66 lays claim to having produced the brightest gamma-ray burst ever observed: the famous March 5 1979 burst. Owing to the large number of satellites which saw this burst (10 in total) an accurate position could be determined. This put SGR 0526-66 on the edge of the supernova remnant N49 in the Large Magellanic Cloud 180,000 light years from our Sun. This should have been sufficient to convince everyone that the burst and the supernova remnant were associated. However, in 1979 astronomers were working under the misconception that all gamma-ray bursts came from a local (500 light years) population of neutron stars. This new piece of the puzzle didn't fit. Real progress in this area had to wait until the mid-1980's when soft gamma-ray repeaters were recognized as a distinct class of high energy transient and then in the early 1990's when SGR 1806-20 was tied to its supernova remnant (see below). The significance of two other important clues also went unnoticed in the early 1980's. The first was the large offset in the location of SGR 0526-66 from the center of the supernova remnant (i.e. its birthplace) and the second was a compact X-ray source at this same location. These observations, combined with the known age of the supernova remnant (5000 years), require that the magnetar be moving at a high speed and depositing energy into its surroundings as it goes. SGR 1806-20: A Magnetar Powers a Nebula While SGR 1806-20 was the most prolific burster in the 1980's, its true location wasn't known until it was detected by the Japanese X-ray ASCA satellite in 1993, verifying an earlier claim that it was associated with the supernova remnant G10.0-0.3. SGR 1806-20 lies at the center of this egg-shaped supernova remnant whose radio
POSSIBLE ORIGIN OF THE G2 CLOUD FROM THE TIDAL DISRUPTION OF A KNOWN GIANT STAR BY SGR A*
International Nuclear Information System (INIS)
Guillochon, James; Loeb, Abraham; MacLeod, Morgan; Ramirez-Ruiz, Enrico
2014-01-01
The discovery of the gas cloud G2 on a near-radial orbit about Sgr A* has prompted much speculation on its origin. In this Letter, we propose that G2 formed out of the debris stream produced by the removal of mass from the outer envelope of a nearby giant star. We perform hydrodynamical simulations of the returning tidal debris stream with cooling and find that the stream condenses into clumps that fall periodically onto Sgr A*. We propose that one of these clumps is the observed G2 cloud, with the rest of the stream being detectable at lower Brγ emissivity along a trajectory that would trace from G2 to the star that was partially disrupted. By simultaneously fitting the orbits of S2, G2, and ∼2000 candidate stars, and by fixing the orbital plane of each candidate star to G2 (as is expected for a tidal disruption), we find that several stars have orbits that are compatible with the notion that one of them was tidally disrupted to produce G2. If one of these stars were indeed disrupted, it last encountered Sgr A* hundreds of years ago and has likely encountered Sgr A* repeatedly. However, while these stars are compatible with the giant disruption scenario given their measured positions and proper motions, their radial velocities are currently unknown. If one of these stars' radial velocity is measured to be compatible with a disruptive orbit, it would strongly suggest that its disruption produced G2
Imaging the Molecular Disk Orbiting the Twin Suns of V4046 Sgr
Rodriguez, David R.; Kastner, J. H.; Wilner, D. J.; Zuckerman, B.
2009-05-01
V4046 Sgr is a 12 Myr-old spectroscopic binary with a period of 2.4 days. At a distance of 73 pc (Torres et al. 2008), it is the second closest classical T Tauri star to the Earth after TW Hydra. Previously, rotational transitions of CO, HCO+, CN, and HCN were detected with the 30m IRAM telescope (Kastner et al. 2008). The double peaked CO profiles can be fit by a model invoking a Keplerian disk with outer radius of 250 AU that is viewed at an inclination of 35 degrees. The CO line profile was asymmetric, with the redshifted emission peak in both C-12 and C-13 brighter than the blueshifted peak. We have used the SMA to spatially resolve the J=2-1 CO emission line and the 230 GHz continuum. The CO channel maps show a disk consistent with Keplerian rotation. At the velocity of the redshifted emission peak, these observations reveal enhanced CO emission a few arcseconds to the southwest of the binary. A question arises as to whether this enhanced CO emission is associated with a third star in the system. According to the analysis of Tokovinin et al. (2006), the probability that a binary with a 2.4 day period has an associated tertiary star is essentially 100%. We searched archival Chandra and HST (ACS and NICMOS) images in the vicinity of V4046 Sgr to look for a star at the position of the enhanced CO emission. While there is a star in the HST ACS images approximately coincident with the enhanced CO emission, our preliminary analysis suggests that this star is not physically associated with V4046 Sgr. We will present a detailed discussion of the SMA results. This work has been partially supported by a NASA ADA grant to RIT and UCLA.
Sgr A* Emission Parametrizations from GRMHD Simulations
Anantua, Richard; Ressler, Sean; Quataert, Eliot
2018-06-01
Galactic Center emission near the vicinity of the central black hole, Sagittarius (Sgr) A*, is modeled using parametrizations involving the electron temperature, which is found from general relativistic magnetohydrodynamic (GRMHD) simulations to be highest in the disk-outflow corona. Jet-motivated prescriptions generalizing equipartition of particle and magnetic energies, e.g., by scaling relativistic electron energy density to powers of the magnetic field strength, are also introduced. GRMHD jet (or outflow)/accretion disk/black hole (JAB) simulation postprocessing codes IBOTHROS and GRMONTY are employed in the calculation of images and spectra. Various parametric models reproduce spectral and morphological features, such as the sub-mm spectral bump in electron temperature models and asymmetric photon rings in equipartition-based models. The Event Horizon Telescope (EHT) will provide unprecedentedly high-resolution 230+ GHz observations of the "shadow" around Sgr A*'s supermassive black hole, which the synthetic models presented here will reverse-engineer. Both electron temperature and equipartition-based models can be constructed to be compatible with EHT size constraints for the emitting region of Sgr A*. This program sets the groundwork for devising a unified emission parametrization flexible enough to model disk, corona and outflow/jet regions with a small set of parameters including electron heating fraction and plasma beta.
An Expanding Radio Nebula Produced by a Giant Flare from the Magnetar SGR 1806-20
Energy Technology Data Exchange (ETDEWEB)
Gaensler, B.
2005-03-04
Soft gamma repeaters (SGRs) are ''magnetars'', a small class of slowly spinning neutron stars with extreme surface magnetic fields, B {approx} 10{sup 15} gauss. On 2004 December 27, a giant flare was detected from the magnetar SGR 1806-20, the third such event ever recorded. This burst of energy was detected by a variety of instruments and even caused an ionospheric disturbance in the Earth's upper atmosphere recorded around the globe. Here we report the detection of a fading radio afterglow produced by this outburst, with a luminosity 500 times larger than the only other detection of a similar source. From day 6 to day 19 after the flare from SGR 1806-20, a resolved, linearly polarized, radio nebula was seen, expanding at approximately a quarter the speed of light. To create this nebula, at least 4 x 10{sup 43} ergs of energy must have been emitted by the giant flare in the form of magnetic fields and relativistic particles. The combination of spatially resolved structure and rapid time evolution allows a study in unprecedented detail of a nearby analog to supernovae and gamma-ray bursts.
Optical Spectroscopy of the Classical Novae V339 Del (2013) and V5668 Sgr (2015 No. 2)
Wagner, R. Mark; Woodward, Charles E.; Starrfield, Sumner; Ilyin, Ilya; Strassmeier, Klaus G.; Page, Kim; Osborne, Julian P.; Beardmore, Andrew P.
2016-01-01
We report the results of optical spectroscopy of the gamma-ray classical novae V339 Del (2013) and V5668 Sgr (PNV J18365700-2855420/Nova Sgr 2015 No. 2) supplemented by UV and X-ray observations obtained with Swift. Our spectra were obtained with the Steward Observatory Bok 2.3 m telescope (+B&C), the MDM 2.4 m Hiltner telescope (+OSMOS), the 6.5 m MMT (+BlueChannel), and the 2 x 8.4 m Large Binocular Telescope (+MODS1 and PEPSI) between 2013 August and 2015 September. The PEPSI spectra cover all or part of the 384-907 nm spectral region at a resolution of up to 270,000 (1 km/s). This is the highest resolution available on any 8-10 m class telescope. V339 Del was discovered on 2015 August 14.58 by Itagaki at V about 6.8. This nova reached a peak magnitude of about 4.3 making it one of the brightest novae of this century. Because of its exceptional brightness it has been observed at a variety of wavelengths and by a host of observatories both on the ground and in space. V5668 Sgr was discovered on 2015 March 15.634 by Seach at a magnitude of 6.0. It subsequently reached a maximum brightness of about 4.0 in late March. High resolution PEPSI spectra obtained in early April show dramatic variations in the multi-component P Cygni-type line profiles. V5668 Sgr was observed to form dust in June thereafter fading to about 13th magnitude. Our recent observations show that it has now evolved into the nebular phase. SS acknowledges partial support from NSF and NASA grants to ASU. CEW acknowledges support from NASA.
Action at the Horizon: Chandra/EHT Observations of Sgr A*
Neilsen, Joseph
2017-09-01
In April 2017, the Event Horizon Telescope will observe Sgr A* with imaging quality sufficient to resolve the shadow of the black hole, while providing a close-up view of accretion at the horizon. As Sgr A* is a well-known source of X-ray flares, coordinated Chandra/EHT observations offer an incredible opportunity: a chance to observe structures (e.g., hotspots) near the event horizon while tracking their high-energy variability. In anticipation of a follow-up campaign in 2018, we are requesting 4x33 ks Chandra observations of Sgr A* to be coordinated with EHT. This campaign will double our chances of simultaneous flares. We will search for flares and hotspots, provide priors for EHT image reconstruction, and track any activity associated with the closest approach of the massive star S0-2.
DEFF Research Database (Denmark)
Nynka, Melania; Hailey, Charles J.; Mori, Kaya
2013-01-01
V) = 1.3 × 1034 erg s-1 . The spectral and spatial results derived from X-ray and radio data strongly suggest a runaway neutron star born in the Sgr A East supernova event. We do not find any pulsed signal from the Cannonball. The NuSTAR observations allow us to deduce the PWN magnetic field and show...
[The cholera epidemic of 1833 and mortality in Mexico City].
Velasco, M D
1992-01-01
The author examines the impact of the 1833 cholera epidemic in Mexico City, Mexico, on social, economic, and political aspects of life in that city. She finds that some five percent of the population died during the epidemic, and enumerates them by age and sex.
Lloyd, Chelsea R; Park, Seongjin; Fei, Jingyi; Vanderpool, Carin K
2017-06-01
The bacterial small RNA (sRNA) SgrS has been a fruitful model for discovery of novel RNA-based regulatory mechanisms and new facets of bacterial physiology and metabolism. SgrS is one of only a few characterized dual-function sRNAs. SgrS can control gene expression posttranscriptionally via sRNA-mRNA base-pairing interactions. Its second function is coding for the small protein SgrT. Previous work demonstrated that both functions contribute to relief of growth inhibition caused by glucose-phosphate stress, a condition characterized by disrupted glycolytic flux and accumulation of sugar phosphates. The base-pairing activity of SgrS has been the subject of numerous studies, but the activity of SgrT is less well characterized. Here, we provide evidence that SgrT acts to specifically inhibit the transport activity of the major glucose permease PtsG. Superresolution microscopy demonstrated that SgrT localizes to the cell membrane in a PtsG-dependent manner. Mutational analysis determined that residues in the N-terminal domain of PtsG are important for conferring sensitivity to SgrT-mediated inhibition of transport activity. Growth assays support a model in which SgrT-mediated inhibition of PtsG transport activity reduces accumulation of nonmetabolizable sugar phosphates and promotes utilization of alternative carbon sources by modulating carbon catabolite repression. The results of this study expand our understanding of a basic and well-studied biological problem, namely, how cells coordinate carbohydrate transport and metabolism. Further, this work highlights the complex activities that can be carried out by sRNAs and small proteins in bacteria. IMPORTANCE Sequencing, annotation and investigation of hundreds of bacterial genomes have identified vast numbers of small RNAs and small proteins, the majority of which have no known function. In this study, we explore the function of a small protein that acts in tandem with a well-characterized small RNA during metabolic
Pre- and post-flight radiation performance evaluation of the space GPS receiver (SGR)
International Nuclear Information System (INIS)
Oldfield, M.K.; Underwood, C.I.; Unwin, M.J.; Asenek, V.; Harboe-Sorensen, R.
1999-01-01
SSTL (Survey Satellite Technology Ltd), in collaboration with ESA/ESTEC, recently developed a state-of-the-art low cost GPS (Global Positioning System) receiver payload for use on small satellites. The space GPS Receiver (SGR), will be flown on the TiungSAT-1 micro-satellite, UoSAT-12 mini-satellite and ESA's PROBA satellite. The SGR payload is currently flying on the TMSAT micro-satellite in low Earth orbit (LEO) and has carried out autonomous on-board positioning whilst also providing an experimental test-bed for evaluating spacecraft attitude determination algorithms. In order to reduce development time and costs, the SGR consists solely of industry standard COTS (commercial off-the-shelf) devices. This paper describes the ground-based radiation testing of several payload-critical COTS devices used in the SGR payload and describes its on-orbit performance. (authors)
Tidal Distortion of the Envelope of an AGB Star IRS 3 near Sgr A{sup *}
Energy Technology Data Exchange (ETDEWEB)
Yusef-Zadeh, F.; Royster, M. J.; Roberts, D. A. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Wardle, M. [Department of Physics and Astronomy and Research Center for Astronomy, Astrophysics and Astrophotonics, Macquarie University, Sydney NSW 2109 (Australia); Cotton, W.; Kunneriath, D. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Schödel, R. [Instituto de Astfisica de Andalucia (CSIC), Glorieta de la Astronomia S/N, E-18008 Granada (Spain)
2017-03-01
We present radio and millimeter continuum observations of the Galactic center taken with the Very Large Array (VLA) and ALMA at 44 and 226 GHz, respectively. We detect radio and millimeter emission from IRS 3, lying ∼4.″5 NW of Sgr A*, with a spectrum that is consistent with the photospheric emission from an AGB star at the Galactic center. Millimeter images reveal that the envelope of IRS 3, the brightest and most extended 3.8 μ m Galactic center stellar source, consists of two semicircular dust shells facing the direction of Sgr A*. The outer circumstellar shell, at a distance of 1.6 × 10{sup 4} au, appears to break up into “fingers” of dust directed toward Sgr A*. These features coincide with molecular CS (5–4) emission and a near-IR extinction cloud distributed between IRS 3 and Sgr A*. The NE–SW asymmetric shapes of the IRS 3 shells seen at 3.8 μ m and radio are interpreted as structures that are tidally distorted by Sgr A*. Using the kinematics of CS emission and the proper motion of IRS 3, the tidally distorted outflowing material from the envelope after 5000 yr constrains the distance of IRS 3 to ∼0.7 pc in front of or ∼0.5 pc behind Sgr A*. This suggests that the mass loss by stars near Sgr A* can supply a reservoir of molecular material near Sgr A*. We also present dark features in radio continuum images coincident with the envelope of IRS 3. These dusty stars provide examples in which high-resolution radio continuum images can identify dust-enshrouded stellar sources embedded in an ionized medium.
Line Evolution of the Nova V5587 Sgr from Early to Nebula Phase
Directory of Open Access Journals (Sweden)
T. Kajikawa
2015-02-01
Full Text Available The spectral evolution of the nova V5587 Sgr has been monitored at Koyama Astronomical Observatory and Higashi-Hiroshima Observatory, Japan, from the early to nebula phase. The nova rebrightened several times. The spectra during the early phase showed emission lines of H α, H β, O I, He I, He II, N II, Fe II. Nova V5587 Sgr is classified into the Fe II type. The helium abundance of the nova is estimated as N(He/N(H = 0.134 ± 0.09. The light curve, the spectral evolution, and the helium abundance in V5587 Sgr are similar to those of the nova PW Vul.
SMM hard X-ray observations of the soft gamma-ray repeater 1806-20
Kouveliotou, C.; Norris, J. P.; Cline, T. L.; Dennis, B. R.; Desai, U. D.; Orwig, L. E.
1987-01-01
Six bursts from the soft gamma-ray repeater (SGR) 1806-20 have been recorded with the SMM Hard X-ray Burst Spectrometer during a highly active phase in 1983. Rise and decay times of less than 5 ns have been detected. Time profiles of these events indicate low-level emission prior to and after the main peaks. The results suggest that SGRs are distinguished from classical gamma-ray bursts by repetition, softer nonvarying spectra, short durations, simple temporal profiles, and a tendency for source locations to correlate with Population I objects. SGR characteristics differ from those of type I X-ray bursts, but they appear to have similarities with the type II bursts from the Rapid Burster.
SMM hard X-ray observations of the soft gamma-ray repeater 1806-20
International Nuclear Information System (INIS)
Kouveliotou, C.; Norris, J.P.; Cline, T.L.; Dennis, B.R.; Desai, U.D.; Orwig, L.E.
1987-01-01
Six bursts from the soft gamma-ray repeater (SGR) 1806-20 have been recorded with the SMM Hard X-ray Burst Spectrometer during a highly active phase in 1983. Rise and decay times of less than 5 ns have been detected. Time profiles of these events indicate low-level emission prior to and after the main peaks. The results suggest that SGRs are distinguished from classical gamma-ray bursts by repetition, softer nonvarying spectra, short durations, simple temporal profiles, and a tendency for source locations to correlate with Population I objects. SGR characteristics differ from those of type I X-ray bursts, but they appear to have similarities with the type II bursts from the Rapid Burster. 19 references
Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.
Depression variability at 5200 in the β Lyr and ν Sgr spectra
International Nuclear Information System (INIS)
Burnashev, V.I.; Skul'skij, M.Yu.
1986-01-01
Using the absolute spectrophotometrical data on binary stars β Lyr and ν Sgr the variability of depression at lambda 5200 dependent on the phase of orbital cycle has been studied. The variations of the equivalent width of the depression in the spectrum of β Lyr correlate with the magnetic field variations. The magnetic field strength of ν Sgr is predicted to be > or approximately 4 kGs
The Orphans of Cholera Morbus in Yucatan, 1833
Elsa Malvido; Paola Peniche Moreno
2013-01-01
This essay discusses the phenomenon of orphanhood which affected a large number of children after the cholera epidemic that struck Yucatan in July 1833. Moreover, it inquires into the fate of children whose parents died of cholera, the role played by kinship networks to provide them with shelter, and the influence of the Church and the State on the situation. Based on first hand sources, the author suggests that the orphanhood produced by cholera served as a pretext for economically and socia...
PROSPECTS FOR PROBING THE SPACETIME OF Sgr A* WITH PULSARS
Energy Technology Data Exchange (ETDEWEB)
Liu, K.; Wex, N.; Kramer, M. [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany); Cordes, J. M. [Astronomy Department, Cornell University, Ithaca, NY 14853 (United States); Lazio, T. J. W. [Jet Propulsion Laboratory, California Institute of Technology, M/S 138-308, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)
2012-03-01
The discovery of radio pulsars in compact orbits around Sgr A* would allow an unprecedented and detailed investigation of the spacetime of this supermassive black hole. This paper shows that pulsar timing, including that of a single pulsar, has the potential to provide novel tests of general relativity, in particular its cosmic censorship conjecture and no-hair theorem for rotating black holes. These experiments can be performed by timing observations with 100 {mu}s precision, achievable with the Square Kilometre Array for a normal pulsar at frequency above 15 GHz. Based on the standard pulsar timing technique, we develop a method that allows the determination of the mass, spin, and quadrupole moment of Sgr A*, and provides a consistent covariance analysis of the measurement errors. Furthermore, we test this method in detailed mock data simulations. It seems likely that only for orbital periods below {approx}0.3 yr is there the possibility of having negligible external perturbations. For such orbits, we expect a {approx}10{sup -3} test of the frame dragging and a {approx}10{sup -2} test of the no-hair theorem within five years, if Sgr A* is spinning rapidly. Our method is also capable of identifying perturbations caused by distributed mass around Sgr A*, thus providing high confidence in these gravity tests. Our analysis is not affected by uncertainties in our knowledge of the distance to the Galactic center, R{sub 0}. A combination of pulsar timing with the astrometric results of stellar orbits would greatly improve the measurement precision of R{sub 0}.
STACKED SEARCH FOR GRAVITATIONAL WAVES FROM THE 2006 SGR 1900+14 STORM
International Nuclear Information System (INIS)
Abbott, B. P.; Abbott, R.; Adhikari, R.; Anderson, S. B.; Araya, M.; Armandula, H.; Aso, Y.; Ballmer, S.; Ajith, P.; Allen, B.; Aulbert, C.; Allen, G.; Amin, R. S.; Anderson, W. G.; Armor, P.; Arain, M. A.; Aston, S.; Aufmuth, P.; Babak, S.; Baker, P.
2009-01-01
We present the results of a LIGO search for short-duration gravitational waves (GWs) associated with the 2006 March 29 SGR 1900+14 storm. A new search method is used, 'stacking' the GW data around the times of individual soft-gamma bursts in the storm to enhance sensitivity for models in which multiple bursts are accompanied by GW emission. We assume that variation in the time difference between burst electromagnetic emission and potential burst GW emission is small relative to the GW signal duration, and we time-align GW excess power time-frequency tilings containing individual burst triggers to their corresponding electromagnetic emissions. We use two GW emission models in our search: a fluence-weighted model and a flat (unweighted) model for the most electromagnetically energetic bursts. We find no evidence of GWs associated with either model. Model-dependent GW strain, isotropic GW emission energy E GW , and γ ≡ E GW /E EM upper limits are estimated using a variety of assumed waveforms. The stacking method allows us to set the most stringent model-dependent limits on transient GW strain published to date. We find E GW upper limit estimates (at a nominal distance of 10 kpc) of between 2 x 10 45 erg and 6 x 10 50 erg depending on the waveform type. These limits are an order of magnitude lower than upper limits published previously for this storm and overlap with the range of electromagnetic energies emitted in soft gamma repeater (SGR) giant flares.
Shock interactions between Sgr A East and its environments
International Nuclear Information System (INIS)
Lee, Sungho; Pak, Soojong; Geballe, T R; Lee, Sang-Gak; Davis, Christopher J; Choi, Minho; Minh, Y C; Herrnstein, Robeson M; Ho, Paul T P
2006-01-01
We have surveyed the interaction regions between Sgr A East and the surrounding molecular clouds in the H 2 1-0 S(l) (2.1218 μm) line emission. The resulting data cube shows the distribution of the H 2 emission both in space (with a resolution of about 2 arcsec) and in velocity (with a resolution of about 18 km s -1 ). Our data are compared with NH 3 (3,3) data from radio observations to investigate the gas kinematics. Based on the H 2 1-0 S(l) line's intensity, its ratio to H 2 2 - 1 S(1), and its gas kinematics, we conclude that the emitting H 2 is excited by strong molecular shocks. We estimate shock velocities (≅ 100 km s -1 ) by comparing the H 2 line profles with those of NH 3 , and derive an initial explosion energy of 0.2 - 4 x 10 53 ergs. Such a high energy excludes a single normal supernova for the origin of Sgr A East. We examine other hypotheses, including the tidal disruption of a star by the supermassive black hole (Sgr A*), multiple supernovae, and a hypernova. We suggest that a hypernova, which is believed to originate from a collapsar or microquasar, is the most probable origin
Discovery of a Transient Magnetar: XTE J1810-197
Ibrahim, Alaa I.; Markwardt, Craig B.; Swank, Jean H.; Ransom, Scott; Roberts, Mallory; Kaspi, Victoria; Woods, Peter M.; Safi-Harb, Samar; Balman, Solen; Parke, William C.
2004-01-01
We report the discovery of a new X-ray pulsar, XTE J1810-197, that was serendipitously discovered on 2003 July 15 by the Rossi X-Ray Timing Explorer (RXTE) while observing the soft gamma repeater SGR 1806-20. The pulsar has a 5.54 s spin period, a soft X-ray spectrum (with a photon index of approx. = 4). and is detectable in earlier RXTE observations back to 2003 January but not before. These show that a transient outburst began between 2002 November 17 and 2003 January 23 and that the source's persistent X-ray flux has been declining since then. The pulsar exhibits a high spin-down rate P approx.= l0(exp -11) s/s with no evidence of Doppler shifts due to a binary companion. The rapid spin-down rate and slow spin period imply a supercritical characteristic magnetic field B approx. = 3 x l0(exp 14) G and a young age tau less than or = 7600 yr. Follow-up Chandra observations provided an accurate position of the source. Within its error radius, the 1.5 m Russian-Turkish Optical Telescope found a limiting magnitude R(sub c) = 21.5. All such properties are strikingly similar to those of anomalous X-ray pulsars ad soft gamma repeaters, providing strong evidence that the source is a new magnetar. However, archival ASCA and ROSAT observations found the source nearly 2 orders of magnitude fainter. This transient behavior and the observed long-term flux variability of the source in absence of an observed SGR-like burst activity make it the first confirmed transient magnetar and suggest that other neutron stars that share the properties of XTE 51810- 197 during its inactive phase may be unidentified transient magnetars awaiting detection via a similar activity. This implies a larger population of magnetars than previously surmised and a possible evolutionary connection between magnetars and other neutron star families. Subject headings: pulsars: general -pulsars: individual (XTE 51810- 197) - stars: magnetic fields -
Source-intrinsic near-infrared properties of Sgr A*: Total intensity measurements
Witzel, G.; Eckart, A.; Bremer, M.; Zamaninasab, M.; Shahzamanian, B.; Valencia-S., M.; Schödel, R.; Karas, V.; Lenzen, R.; Marchili, N.; Sabha, N.; Garcia-Marin, M.; Buchholz, R. M.; Kunneriath, D.; Straubmeier, C.
2012-01-01
We present a comprehensive data description for Ks-band measurements of Sgr A*. We characterize the statistical properties of the variability of Sgr A* in the near-infrared, which we find to be consistent with a single-state process forming a power-law distribution of the flux density. We discover a linear rms-flux relation for the flux-density range up to 12 mJy on a timescale of 24 minutes. This and the power-law flux density distribution implies a phenomenological, formally non-linear stat...
Multiwavelength Coverage of a Bright Flare from Sgr A
International Nuclear Information System (INIS)
Trap, G.; Goldwurm, A.; Terrier, R.
2009-01-01
The dynamical center of our galaxy hosts a supermassive black hole, Sgr A*, which has been the target of an extensive multiwavelength campaign for a week in April 2007. We report here the detection of a bright flare from the vicinity of the horizon, observed simultaneously in X-rays (XMM-Newton) and NIR (VLT/NACO) on April 4 th . For the first time, such an event also benefitted from a soft γ-rays (INTEGRAL/ISGRI) and MIR (VLT/VISIR) coverage, which enabled us to derive upper limits at both ends of Sgr A* spectral energy distribution (SED). We discuss the physical implications of the contemporaneous light curves as well as the SED, in terms of synchrotron, synchrotron self-Compton and external Compton emission processes.
The Orphans of Cholera Morbus in Yucatan, 1833
Directory of Open Access Journals (Sweden)
Elsa Malvido
2013-07-01
Full Text Available This essay discusses the phenomenon of orphanhood which affected a large number of children after the cholera epidemic that struck Yucatan in July 1833. Moreover, it inquires into the fate of children whose parents died of cholera, the role played by kinship networks to provide them with shelter, and the influence of the Church and the State on the situation. Based on first hand sources, the author suggests that the orphanhood produced by cholera served as a pretext for economically and socially privileged groups to get hold of free labor force both for domestic service and hacienda work.
Approaching the event horizon: 1.3mmλ VLBI of SgrA*
International Nuclear Information System (INIS)
Doeleman, Sheperd
2008-01-01
Advances in VLBI instrumentation now allow wideband recording that significantly increases the sensitivity of short wavelength VLBI observations. Observations of the super-massive black hole candidate at the center of the Milky Way, SgrA*, with short wavelength VLBI reduces the scattering effects of the intervening interstellar medium, allowing observations with angular resolution comparable to the apparent size of the event horizon of the putative black hole. Observations in April 2007 at a wavelength of 1.3mm on a three station VLBI array have now confirmed structure in SgrA* on scales of just a few Schwarzschild radii. When modeled as a circular Gaussian, the fitted diameter of SgrA* is 37 μas (+16,-10; 3σ), which is smaller than the expected apparent size of the event horizon of the Galactic Center black hole. These observations demonstrate that mm/sub-mm VLBI is poised to open a new window onto the study of black hole physics via high angular resolution observations of the Galactic Center.
The Growth, Polarization, and Motion of the Radio Afterglow from the Giant Flare from SGR 1806-20
Energy Technology Data Exchange (ETDEWEB)
Taylor, G
2005-04-20
The extraordinary giant flare (GF) of 2004 December 27 from the soft gamma repeater (SGR) 1806-20 was followed by a bright radio afterglow. We present an analysis of VLA observations of this radio afterglow from SGR1806-20, consisting of previously reported 8.5 GHz data covering days 7 to 20 after the GF, plus new observations at 8.5 and 22 GHz from day 24 to 81. For a symmetric outflow, we find a deceleration in the expansion, from {approx}4.5 mas/day to <2.5 mas/day. The time of deceleration is roughly coincident with the rebrightening in the radio light curve, as expected to result when the ejecta from the GF sweeps up enough of the external medium, and transitions from a coasting phase to the Sedov-Taylor regime. The radio afterglow is elongated and maintains a 2:1 axis ratio with an average position angle of -40{sup o} (north through east), oriented perpendicular to the average intrinsic linear polarization angle. We also report on the discovery of motion in the flux centroid of the afterglow, at an average velocity of 0.26 {+-} 0.03 c (assuming a distance of 15 kpc) at a position angle of -45{sup o}. This motion, in combination with the growth and polarization measurements, suggests an initially asymmetric outflow, mainly from one side of the magnetar.
HOW SOFT GAMMA REPEATERS MIGHT MAKE FAST RADIO BURSTS
Energy Technology Data Exchange (ETDEWEB)
Katz, J. I., E-mail: katz@wuphys.wustl.edu [Department of Physics and McDonnell Center for the Space Sciences, Washington University, St. Louis, Mo. 63130 (United States)
2016-08-01
There are several phenomenological similarities between soft gamma repeaters (SGRs) and fast radio bursts (FRBs), including duty factors, timescales, and repetition. The sudden release of magnetic energy in a neutron star magnetosphere, as in popular models of SGRs, can meet the energy requirements of FRBs, but requires both the presence of magnetospheric plasma, in order for dissipation to occur in a transparent region, and a mechanism for releasing much of that energy quickly. FRB sources and SGRs are distinguished by long-lived (up to thousands of years) current-carrying coronal arches remaining from the formation of the young neutron star, and their decay ends the phase of SGR/AXP/FRB activity even though “magnetar” fields may persist. Runaway increases in resistance when the current density exceeds a threshold, releases magnetostatic energy in a sudden burst, and produces high brightness GHz emission of FRB by a coherent process. SGRs are produced when released energy thermalizes as an equlibrium pair plasma. The failures of some alternative FRB models and the non-detection of SGR 1806-20 at radio frequencies are discussed in the appendices.
HOW SOFT GAMMA REPEATERS MIGHT MAKE FAST RADIO BURSTS
International Nuclear Information System (INIS)
Katz, J. I.
2016-01-01
There are several phenomenological similarities between soft gamma repeaters (SGRs) and fast radio bursts (FRBs), including duty factors, timescales, and repetition. The sudden release of magnetic energy in a neutron star magnetosphere, as in popular models of SGRs, can meet the energy requirements of FRBs, but requires both the presence of magnetospheric plasma, in order for dissipation to occur in a transparent region, and a mechanism for releasing much of that energy quickly. FRB sources and SGRs are distinguished by long-lived (up to thousands of years) current-carrying coronal arches remaining from the formation of the young neutron star, and their decay ends the phase of SGR/AXP/FRB activity even though “magnetar” fields may persist. Runaway increases in resistance when the current density exceeds a threshold, releases magnetostatic energy in a sudden burst, and produces high brightness GHz emission of FRB by a coherent process. SGRs are produced when released energy thermalizes as an equlibrium pair plasma. The failures of some alternative FRB models and the non-detection of SGR 1806-20 at radio frequencies are discussed in the appendices.
Study of diffuse H II regions potentially forming part of the gas streams around Sgr A*
Armijos-Abendaño, J.; López, E.; Martín-Pintado, J.; Báez-Rubio, A.; Aravena, M.; Requena-Torres, M. A.; Martín, S.; Llerena, M.; Aldás, F.; Logan, C.; Rodríguez-Franco, A.
2018-05-01
We present a study of diffuse extended ionized gas towards three clouds located in the Galactic Centre (GC). One line of sight (LOS) is towards the 20 km s-1 cloud (LOS-0.11) in the Sgr A region, another LOS is towards the 50 km s-1 cloud (LOS-0.02), also in Sgr A, while the third is towards the Sgr B2 cloud (LOS+0.693). The emission from the ionized gas is detected from Hnα and Hmβ radio recombination lines (RRLs). Henα and Hemβ RRL emission is detected with the same n and m as those from the hydrogen RRLs only towards LOS+0.693. RRLs probe gas with positive and negative velocities towards the two Sgr A sources. The Hmβ to Hnα ratios reveal that the ionized gas is emitted under local thermodynamic equilibrium conditions in these regions. We find a He to H mass fraction of 0.29±0.01 consistent with the typical GC value, supporting the idea that massive stars have increased the He abundance compared to its primordial value. Physical properties are derived for the studied sources. We propose that the negative velocity component of both Sgr A sources is part of gas streams considered previously to model the GC cloud kinematics. Associated massive stars with what are presumably the closest H II regions to LOS-0.11 (positive velocity gas), LOS-0.02, and LOS+0.693 could be the main sources of ultraviolet photons ionizing the gas. The negative velocity components of both Sgr A sources might be ionized by the same massive stars, but only if they are in the same gas stream.
Time Domain Filtering of Resolved Images of Sgr A{sup ∗}
Energy Technology Data Exchange (ETDEWEB)
Shiokawa, Hotaka; Doeleman, Sheperd S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gammie, Charles F. [Department of Physics, University of Illinois, 1110 West Green Street, Urbana, IL 61801 (United States)
2017-09-01
The goal of the Event Horizon Telescope (EHT) is to provide spatially resolved images of Sgr A*, the source associated with the Galactic Center black hole. Because Sgr A* varies on timescales that are short compared to an EHT observing campaign, it is interesting to ask whether variability contains information about the structure and dynamics of the accretion flow. In this paper, we introduce “time-domain filtering,” a technique to filter time fluctuating images with specific temporal frequency ranges and to demonstrate the power and usage of the technique by applying it to mock millimeter wavelength images of Sgr A*. The mock image data is generated from the General Relativistic Magnetohydrodynamic (GRMHD) simulation and the general relativistic ray-tracing method. We show that the variability on each line of sight is tightly correlated with a typical radius of emission. This is because disk emissivity fluctuates on a timescale of the order of the local orbital period. Time-domain filtered images therefore reflect the model dependent emission radius distribution, which is not accessible in time-averaged images. We show that, in principle, filtered data have the power to distinguish between models with different black-hole spins, different disk viewing angles, and different disk orientations in the sky.
International Nuclear Information System (INIS)
Johnson, Michael D.; Doeleman, Sheperd S.; Fish, Vincent L.; Broderick, Avery E.; Wardle, John F. C.; Marrone, Daniel P.
2014-01-01
We demonstrate that polarimetric interferometry can be used to extract precise spatial information about compact polarized flares of Sgr A*. We show that, for a faint dynamical component, a single interferometric baseline suffices to determine both its polarization and projected displacement from the quiescent intensity centroid. A second baseline enables two-dimensional reconstruction of the displacement, and additional baselines can self-calibrate using the flare, enhancing synthesis imaging of the quiescent emission. We apply this technique to simulated 1.3 mm wavelength observations of a 'hot spot' embedded in a radiatively inefficient accretion disk around Sgr A*. Our results indicate that, even with current sensitivities, polarimetric interferometry with the Event Horizon Telescope can achieve ∼5 μas relative astrometry of compact flaring structures near Sgr A* on timescales of minutes.
a Look at Nitrile Chemistry in SGR B2(N) Using the Combined Power of the GBT and the VLA
Steber, Amanda; Zaleski, Daniel P.; Seifert, Nathan A.; Neill, Justin; Muckle, Matt; Pate, Brooks; Corby, Joanna F.; Remijan, Anthony
2014-06-01
Nitriles form the most prolific family of molecules known in the ISM, and laboratory work shows that radical-driven chemistry can account for the formation of a diverse set of nitrile and imine molecules. Broadband reaction screening of nitrile chemistry in a pulsed discharge nozzle coupled to a chirped-pulse Fourier transform rotational spectrometer has enabled detections of several new interstellar species including E- and Z-ethanimine and E-cyanomethanimine. The detections were made by direct comparisons of laboratory broadband rotational spectra with the Robert C. Byrd Green Bank Telescope (GBT) PRebiotic Interstellar MOlecule Survery (PRIMOS) survey towards Sgr B2(N), the most chemically complex interstellar region known. In order to probe nitrile chemistry in Sgr B2, we targeted low energy rotational transitions in the 18-21 GHz range of several nitriles with the Karl G. Jansky Very Large Array (VLA) at ˜1 arcsecond resolution. The data indicate that most nitriles and nitrile derivatives are co-spatial with shell shaped continuum features thought to be expanding ionization fronts. The CH2CN radical and imine species in particular are NOT associated with the hot core known as the "Large Molecule Heimat", where most large organic molecules are thought to reside. This result suggests radical driven nitrile chemistry may be promoted by near-UV radiation in moderate density regions of molecular clouds, and the data will be useful for evaluating possible formation mechanisms. R.A. Loomis et al. Ap. J. L., 765, (L9), 2013. D.P. Zaleski et al. Ap. J. L., 765, (L10), 2013.
LONG-TERM RADIATIVE BEHAVIOR OF SGR 1900+14
International Nuclear Information System (INIS)
Goegues, Ersin; Guever, Tolga; Oezel, Feryal; Eichler, David; Kouveliotou, Chryssa
2011-01-01
The prolific magnetar SGR 1900+14 showed two outbursts in the last decade and has been closely monitored in the X-rays to track the changes in its radiative properties. We use archival Chandra and XMM-Newton observations of SGR 1900+14 to construct a history of its spectrum and persistent X-ray flux spanning a period of about seven years. We show that the decline of its X-ray flux in these two outburst episodes follows the same trend. The flux begins to decline promptly and rapidly subsequent to the flares, then decreases gradually for about 600 days, at which point it resumes a more rapid decline. Utilizing the high-quality spectral data in each epoch, we also study the spectral coevolution of the source with its flux. We find that neither the magnetic field strength nor the magnetospheric properties change over the period spanned by the observations, while the surface temperature as well as the inferred emitting area both decline with time following both outbursts. We also show that the source reached the same minimum flux level in its decline from these two subsequent outbursts, suggesting that this flux level may be its steady quiescent flux.
Testing General Relativity with the Shadow Size of Sgr A(*).
Johannsen, Tim; Broderick, Avery E; Plewa, Philipp M; Chatzopoulos, Sotiris; Doeleman, Sheperd S; Eisenhauer, Frank; Fish, Vincent L; Genzel, Reinhard; Gerhard, Ortwin; Johnson, Michael D
2016-01-22
In general relativity, the angular radius of the shadow of a black hole is primarily determined by its mass-to-distance ratio and depends only weakly on its spin and inclination. If general relativity is violated, however, the shadow size may also depend strongly on parametric deviations from the Kerr metric. Based on a reconstructed image of Sagittarius A^{*} (Sgr A^{*}) from a simulated one-day observing run of a seven-station Event Horizon Telescope (EHT) array, we employ a Markov chain Monte Carlo algorithm to demonstrate that such an observation can measure the angular radius of the shadow of Sgr A^{*} with an uncertainty of ∼1.5 μas (6%). We show that existing mass and distance measurements can be improved significantly when combined with upcoming EHT measurements of the shadow size and that tight constraints on potential deviations from the Kerr metric can be obtained.
Energy Technology Data Exchange (ETDEWEB)
Goicoechea, Javier R.; Etxaluze, M.; Cernicharo, J.; Bell, T. A. [Departamento de Astrofisica, Centro de Astrobiologia, CSIC-INTA, Carretera de Ajalvir, Km 4, Torrejon de Ardoz, E-28850 Madrid (Spain); Gerin, M.; De Luca, M.; Encrenaz, P. [LERMA, UMR 8112 du CNRS, Observatoire de Paris, Ecole Normale Superieure (France); Neufeld, D. A.; Indriolo, N. [Johns Hopkins University, Baltimore, MD 21218 (United States); Contursi, A. [Max-Planck-Institut fuer extraterrestrische Physik (MPE), Postfach 1312, D-85741 Garching (Germany); Lis, D. C. [California Institute of Technology, Pasadena, CA 91125 (United States); Polehampton, E. T. [RAL Space, Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom); Sonnentrucker, P., E-mail: jr.goicoechea@cab.inta-csic.es [Space Telescope Science Institute, Baltimore, MD 21218 (United States)
2013-05-20
We present a {approx}52-671 {mu}m spectral scan toward Sgr A* taken with the PACS and SPIRE spectrometers on board Herschel. The achieved angular resolution allows us to separate, for the first time at far-IR wavelengths, the emission toward the central cavity (gas in the inner central parsec of the galaxy) from that of the surrounding circumnuclear disk. The spectrum toward Sgr A* is dominated by strong [O III], [O I], [C II], [N III], [N II], and [C I] fine-structure lines (in decreasing order of luminosity) arising in gas irradiated by UV photons from the central stellar cluster. In addition, rotationally excited lines of {sup 12}CO (from J = 4-3 to 24-23), {sup 13}CO, H{sub 2}O, OH, H{sub 3}O{sup +}, HCO{sup +}, and HCN, as well as ground-state absorption lines of OH{sup +}, H{sub 2}O{sup +}, H{sub 3}O{sup +}, CH{sup +}, H{sub 2}O, OH, HF, CH, and NH are detected. The excitation of the {sup 12}CO ladder is consistent with a hot isothermal component at T{sub k} {approx_equal} 10{sup 3.1} K and n(H{sub 2}) {approx}< 10{sup 4} cm{sup -3}. It is also consistent with a distribution of temperature components at higher density with most CO at T{sub k} {approx}< 300 K. The detected molecular features suggest that, at present, neither very enhanced X-ray nor cosmic-ray fluxes play a dominant role in the heating of the hot molecular gas. The hot CO component (either the bulk of the CO column or just a small fraction depending on the above scenario) results from a combination of UV- and shock-driven heating. If irradiated dense clumps/clouds do not exist, shocks likely dominate the heating of the hot molecular gas. This is consistent with the high-velocity gas detected toward Sgr A*.
Sgr A* flares: tidal disruption of asteroids and planets?
Zubovas, K.; Nayakshin, S.; Markoff, S.
2012-01-01
It is theoretically expected that a supermassive black hole (SMBH) in the centre of a typical nearby galaxy disrupts a solar-type star every ∼105 yr, resulting in a bright flare lasting for months. Sgr A*, the resident SMBH of the Milky Way, produces (by comparison) tiny flares that last only hours
EARLY-STAGE MASSIVE STAR FORMATION NEAR THE GALACTIC CENTER: Sgr C
Energy Technology Data Exchange (ETDEWEB)
Kendrew, S.; Johnston, K.; Beuther, H. [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Ginsburg, A.; Bally, J.; Battersby, C. [CASA, University of Colorado at Boulder, UCB 389, Boulder, CO 80309 (United States); Cyganowski, C. J., E-mail: kendrew@mpia.de [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States)
2013-10-01
We present near-infrared spectroscopy and 1 mm line and continuum observations of a recently identified site of high mass star formation likely to be located in the Central Molecular Zone (CMZ) near Sgr C. Located on the outskirts of the massive evolved H II region associated with Sgr C, the area is characterized by an Extended Green Object (EGO) measuring ∼10'' in size (0.4 pc), whose observational characteristics suggest the presence of an embedded massive protostar driving an outflow. Our data confirm that early-stage star formation is taking place on the periphery of the Sgr C H II region, with detections of two protostellar cores and several knots of H{sub 2} and Brackett γ emission alongside a previously detected compact radio source. We calculate the cores' joint mass to be ∼10{sup 3} M {sub ☉}, with column densities of 1-2 × 10{sup 24} cm{sup –2}. We show the host molecular cloud to hold ∼10{sup 5} M {sub ☉} of gas and dust with temperatures and column densities favorable for massive star formation to occur, however, there is no evidence of star formation outside of the EGO, indicating that the cloud is predominantly quiescent. Given its mass, density, and temperature, the cloud is comparable to other remarkable non-star-forming clouds such as G0.253 in the eastern CMZ.
Fermi bubbles inflated by winds launched from the hot accretion flow in Sgr A*
International Nuclear Information System (INIS)
Mou, Guobin; Yuan, Feng; Bu, Defu; Sun, Mouyuan; Su, Meng
2014-01-01
A pair of giant gamma-ray Bubbles has been revealed by Fermi-LAT. In this paper we investigate their formation mechanism. Observations have indicated that the activity of the supermassive black hole located at the Galactic center, Sgr A*, was much stronger than at the present time. Specifically, one possibility is that while Sgr A* was also in the hot accretion regime, the accretion rate should be 10 3 -10 4 times higher during the past ∼10 7 yr. On the other hand, recent magnetohydrodynamic numerical simulations of hot accretion flows have unambiguously shown the existence and obtained the properties of strong winds. Based on this knowledge, by performing three-dimensional hydrodynamical simulations, we show in this paper that the Fermi Bubbles could be inflated by winds launched from the 'past' hot accretion flow in Sgr A*. In our model, the active phase of Sgr A* is required to last for about 10 million years and it was quenched no more than 0.2 million years ago. The central molecular zone (CMZ) is included and it collimates the wind orientation toward the Galactic poles. Viscosity suppresses the Rayleigh-Taylor and Kelvin-Helmholtz instabilities and results in the smoothness of the Bubbles edge. The main observational features of the Bubbles can be well explained. Specifically, the ROSAT X-ray features are interpreted by the shocked interstellar medium and the interaction region between the wind and CMZ gas. The thermal pressure and temperature obtained in our model are consistent with recent Suzaku observations.
Spitzer/IRAC observations of the variability of Sgr A* and the object G2 at 4.5 μm
Energy Technology Data Exchange (ETDEWEB)
Hora, J. L.; Ashby, M. L. N.; Fazio, G. G.; Smith, H. A.; Willner, S. P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Witzel, G.; Becklin, E. E.; Ghez, A.; Meyer, L.; Morris, M. R. [University of California, Los Angeles, CA 90095 (United States); Carey, S.; Ingalls, J. [Spitzer Science Center, California Institute of Technology, Pasadena, CA 91125 (United States)
2014-10-01
We present the first detection from the Spitzer Space Telescope of 4.5 μm variability from Sgr A*, the emitting source associated with the Milky Way's central black hole. The >23 hr continuous light curve was obtained with the Infrared Array Camera (IRAC) instrument in 2013 December. The result characterizes the variability of Sgr A* prior to the closest approach of the tidally deformed G2 object, a putative infalling gas cloud that orbits close to Sgr A*. The high stellar density at the location of Sgr A* produces a background of ∼250 mJy at 4.5 μm in each pixel with a large pixel-to-pixel gradient, but the light curve for the highly variable Sgr A* source was successfully measured by modeling and removing the variations due to pointing wobble. The observed flux densities range from the noise level of ∼0.7 mJy rms in a 6.4 s measurement to ≳10 mJy. Emission was seen above the noise level ∼34% of the time. The light-curve characteristics, including the flux density distribution and structure function, are consistent with those previously derived at shorter infrared wavelengths. We see no evidence in the light curve for activity attributable to the G2 interaction at the observing epoch, ∼100 days before the expected G2 periapsis passage. The IRAC light curve is more than a factor of two longer than any previous infrared observation, improving constraints on the timescale of the break in the power spectral distribution of Sgr A* flux densities. The data favor the longer of the two previously published values for the timescale.
The Sleeping Monster: NuSTAR Observations of SGR 1806-20, 11 Years After the Giant Flare
Younes, George; Baring, Matthew G.; Kouveliotou, Chryssa; Harding, Alice; Donovan, Sophia; Göğüş, Ersin; Kaspi, Victoria; Granot, Jonathan
2017-12-01
We report the analysis of five Nuclear Spectroscopic Telescope Array (NuSTAR) observations of SGR 1806-20 spread over a year from 2015 April to 2016 April, more than 11 years following its giant flare (GF) of 2004. The source spin frequency during the NuSTAR observations follows a linear trend with a frequency derivative \\dot{ν }=(-1.25+/- 0.03)× {10}-12 Hz s-1, implying a surface dipole equatorial magnetic field B≈ 7.7× {10}14 G. Thus, SGR 1806-20 has finally returned to its historical minimum torque level measured between 1993 and 1998. The source showed strong timing noise for at least 12 years starting in 2000, with \\dot{ν } increasing one order of magnitude between 2005 and 2011, following its 2004 major bursting episode and GF. SGR 1806-20 has not shown strong transient activity since 2009, and we do not find short bursts in the NuSTAR data. The pulse profile is complex with a pulsed fraction of ˜ 8 % with no indication of energy dependence. The NuSTAR spectra are well fit with an absorbed blackbody, {kT}=0.62+/- 0.06 {keV}, plus a power law, {{Γ }}=1.33+/- 0.03. We find no evidence for variability among the five observations, indicating that SGR 1806-20 has reached a persistent and potentially its quiescent X-ray flux level after its 2004 major bursting episode. Extrapolating the NuSTAR model to lower energies, we find that the 0.5-10 keV flux decay follows an exponential form with a characteristic timescale τ =543+/- 75 days. Interestingly, the NuSTAR flux in this energy range is a factor of ˜2 weaker than the long-term average measured between 1993 and 2003, a behavior also exhibited in SGR 1900+14. We discuss our findings in the context of the magnetar model.
The Outburst Decay of the Low Magnetic Field Magnetar SGR 0418+5729
Rea, N.; Israel, G. L.; Pons, J. A.; Turolla, R.; Viganò, D.; Zane, S.; Esposito, P.; Perna, R.; Papitto, A.; Terreran, G.; Tiengo, A.; Salvetti, D.; Girart, J. M.; Palau, Aina; Possenti, A.; Burgay, M.; Göğüş, E.; Caliandro, G. A.; Kouveliotou, C.; Götz, D.; Mignani, R. P.; Ratti, E.; Stella, L.
2013-06-01
We report on the long-term X-ray monitoring of the outburst decay of the low magnetic field magnetar SGR 0418+5729 using all the available X-ray data obtained with RXTE, Swift, Chandra, and XMM-Newton observations from the discovery of the source in 2009 June up to 2012 August. The timing analysis allowed us to obtain the first measurement of the period derivative of SGR 0418+5729: \\dot{P}=4(1)\\times 10^{-15} s s-1, significant at a ~3.5σ confidence level. This leads to a surface dipolar magnetic field of B dip ~= 6 × 1012 G. This measurement confirms SGR 0418+5729 as the lowest magnetic field magnetar. Following the flux and spectral evolution from the beginning of the outburst up to ~1200 days, we observe a gradual cooling of the tiny hot spot responsible for the X-ray emission, from a temperature of ~0.9 to 0.3 keV. Simultaneously, the X-ray flux decreased by about three orders of magnitude: from about 1.4 × 10-11 to 1.2 × 10-14 erg s-1 cm-2. Deep radio, millimeter, optical, and gamma-ray observations did not detect the source counterpart, implying stringent limits on its multi-band emission, as well as constraints on the presence of a fossil disk. By modeling the magneto-thermal secular evolution of SGR 0418+5729, we infer a realistic age of ~550 kyr, and a dipolar magnetic field at birth of ~1014 G. The outburst characteristics suggest the presence of a thin twisted bundle with a small heated spot at its base. The bundle untwisted in the first few months following the outburst, while the hot spot decreases in temperature and size. We estimate the outburst rate of low magnetic field magnetars to be about one per year per galaxy, and we briefly discuss the consequences of such a result in several other astrophysical contexts.
THE OUTBURST DECAY OF THE LOW MAGNETIC FIELD MAGNETAR SGR 0418+5729
International Nuclear Information System (INIS)
Rea, N.; Papitto, A.; Terreran, G.; Girart, J. M.; Palau, Aina; Caliandro, G. A.; Israel, G. L.; Pons, J. A.; Viganò, D.; Turolla, R.; Zane, S.; Esposito, P.; Tiengo, A.; Salvetti, D.; Perna, R.; Possenti, A.; Burgay, M.; Göğüş, E.; Kouveliotou, C.; Götz, D.
2013-01-01
We report on the long-term X-ray monitoring of the outburst decay of the low magnetic field magnetar SGR 0418+5729 using all the available X-ray data obtained with RXTE, Swift, Chandra, and XMM-Newton observations from the discovery of the source in 2009 June up to 2012 August. The timing analysis allowed us to obtain the first measurement of the period derivative of SGR 0418+5729: P-dot =4(1)×10 -15 s s –1 , significant at a ∼3.5σ confidence level. This leads to a surface dipolar magnetic field of B dip ≅ 6 × 10 12 G. This measurement confirms SGR 0418+5729 as the lowest magnetic field magnetar. Following the flux and spectral evolution from the beginning of the outburst up to ∼1200 days, we observe a gradual cooling of the tiny hot spot responsible for the X-ray emission, from a temperature of ∼0.9 to 0.3 keV. Simultaneously, the X-ray flux decreased by about three orders of magnitude: from about 1.4 × 10 –11 to 1.2 × 10 –14 erg s –1 cm –2 . Deep radio, millimeter, optical, and gamma-ray observations did not detect the source counterpart, implying stringent limits on its multi-band emission, as well as constraints on the presence of a fossil disk. By modeling the magneto-thermal secular evolution of SGR 0418+5729, we infer a realistic age of ∼550 kyr, and a dipolar magnetic field at birth of ∼10 14 G. The outburst characteristics suggest the presence of a thin twisted bundle with a small heated spot at its base. The bundle untwisted in the first few months following the outburst, while the hot spot decreases in temperature and size. We estimate the outburst rate of low magnetic field magnetars to be about one per year per galaxy, and we briefly discuss the consequences of such a result in several other astrophysical contexts.
A new study of the interacting binary star V356 Sgr
Polidan, R. S.
1988-01-01
Results on V356 Sgr from IUE and Voyager ultraviolet (500 to 3200 A) observations obtained in 1986 and 1987, primarily during 2 total eclipses are presented. The eclipse of Aug. 15, 1986 was fully covered with IUE low dispersion images and 9 hr of Voyager UVS data. The eclipse of Mar. 25, 1987 was covered with IUE low dispersion images and 1 high dispersion SWP image. During both eclipses the total strength of the emission lines is found to be invariant. An uneclipsed UV continuum is detected at wavelengths shorter than 1500 A. The high dispersion SWP spectrum reveals that the emission lines are extremely broad, almost symmetrical emissions with weak, slightly blue shifted absorption components. No evidence of carbon, C I, C II, C III, or C IV, is seen in the emission or absorption spectrum of V356 Sgr in eclipse. Models for this binary system are presented.
GBT Measurements of the Physical Properties of the Sgr B2 Region
Langston, Glen; Schmidt, D. R.; Christiansen, K.
2012-01-01
We present NRAO GBT observations of ammonia 1-1 and 2-2 emission in the Sgr B2 region, in order to estimate the physical temperature of this region. The observations were made with the 7-beam K-band Focal Plane Array (KFPA) collecting spectra over a 11' by 9' region. We compare these observations with molecular line spectra obtained with the GBT in the frequency range 12.4 to 15.0 GHz. In this frequency range, Hydrogen α, β, and γ recombination lines, Helium α recombination lines and emission from the SO molecule are detected. Molecular absorption lines from OH, H2CO and CH3CO are detected at velocity 62×3 km/sec. Measurements of the line widths and intensities are presented for the central region of Sgr B2.
Directory of Open Access Journals (Sweden)
Ke Teng
2016-12-01
Full Text Available Senescence is not only an important developmental process, but also a responsive regulation to abiotic and biotic stress for plants. Stay-green protein plays crucial roles in plant senescence and chlorophyll degradation. However, the underlying mechanisms were not well studied, particularly in non-model plants. In this study, a novel stay-green gene, ZjSGR, was isolated from Zoysia japonica. Subcellular localization result demonstrated that ZjSGR was localized in the chloroplasts. Quantitative real-time PCR results together with promoter activity determination using transgenic Arabidopsis confirmed that ZjSGR could be induced by darkness, ABA and MeJA. Its expression levels could also be up-regulated by natural senescence, but suppressed by SA treatments. Overexpression of ZjSGR in Arabidopsis resulted in a rapid yellowing phenotype; complementary experiments proved that ZjSGR was a functional homologue of AtNYE1 from Arabidopsis thaliana. Overexpression of ZjSGR accelerated chlorophyll degradation and impaired photosynthesis in Arabidopsis. Transmission electron microscopy observation revealed that overexpression of ZjSGR decomposed the chloroplasts structure. RNA sequencing analysis showed that ZjSGR could play multiple roles in senescence and chlorophyll degradation by regulating hormone signal transduction and the expression of a large number of senescence and environmental stress related genes. Our study provides a better understanding of the roles of SGRs, and new insight into the senescence and chlorophyll degradation mechanisms in plants.
The 1833-1834 Cholera Epidemics at the Diocese of Guadalajara. Contagion routes and mortality
David Carbajal López
2011-01-01
This paper studies the contagion routes of cholera morbus inMexico, as well as the dissemination routes and the mortality caused by the cholera bacterium in the 130 parishes of the diocese ofGuadalajara during 1833 and 1843. The goal of this essay is to establish the differentiated demographic impact of the Asian illness in the various parishes of the large Guadalajaran diocese.
Crowdsourcing, the great meteor storm of 1833, and the founding of meteor science.
Littmann, Mark; Suomela, Todd
2014-06-01
Yale science professor Denison Olmsted used crowdsourcing to gather observations from across the United States of the unexpected deluge of meteors on 13 November 1833--more than 72,000/h. He used these observations (and newspaper accounts and correspondence from scientists) to make a commendably accurate interpretation of the meteor storm, overturning 2100 years of erroneous teachings about shooting stars and establishing meteor science as a new branch of astronomy. Olmsted's success was substantially based on his use of newspapers and their practice of news pooling to solicit observations from throughout the country by lay and expert observers professionally unaffiliated with Yale College and him. In today's parlance, Olmsted was a remarkably successful early practitioner of scientific crowdsourcing, also known as citizen science. He may have been the first to use mass media for crowdsourcing in science. He pioneered many of the citizen-science crowdsourcing practices that are still in use today: an open call for citizen participation, a clearly defined task, a large geographical distribution for gathering data and a rapid response to opportunistic events. Olmsted's achievement is not just that he used crowdsourcing in 1833 but that crowdsourcing helped him to advance science significantly. Copyright © 2014 Elsevier Ltd. All rights reserved.
The 1833-1834 Cholera Epidemics at the Diocese of Guadalajara. Contagion routes and mortality
Directory of Open Access Journals (Sweden)
David Carbajal López
2011-04-01
Full Text Available This paper studies the contagion routes of cholera morbus inMexico, as well as the dissemination routes and the mortality caused by the cholera bacterium in the 130 parishes of the diocese ofGuadalajara during 1833 and 1843. The goal of this essay is to establish the differentiated demographic impact of the Asian illness in the various parishes of the large Guadalajaran diocese.
[Pharmacists in transition. Academy and Pharmacy in Mexico from 1833 to 1865].
Morales-Cosme, Alba Dolores; Viesca-Treviño, Carlos
2016-01-01
From the second half of the 19th century, health disciplines went through an institutional and professional restructuring, which progressively altered the guild order that had characterized them to that point. In the case of Pharmacy, this process implied the generation of officially recognized spaces, as the chairs of Pharmacy and Medical Substance, founded during the Establecimiento de Ciencias Médicas (Establishment of Medical Sciences) (1833). In those spaces it was sought to institutionalize knowledge and modern practices related to Pharmacy. In this work we look over the first academic experience of the pharmaceutical community in that new space of instruction, based on the records belonging to the students enrolled in the Establecimiento de Ciencias Médicas from 1833 to 1865, year of the enrollment of the last generation. The information contained in those 163 records displays the way the pharmaceutical field was transformed, after the aforementioned restructuring. The reader will notice the diverse normativity, which regulated the joining of pharmacists to academic life (of which, until then, they were excluded). He will also realize how, among the first students enrolled in the Establecimiento de Ciencias Médicas, said normativity was broke in order to adapt it to the known ways of students and professors. Progressively, the guild instruction would be ousted by the institutional instruction (for example, the years of practice in the drugstores were rejected), so that the guild ways of teaching were changing to turn the pharmacist into an individual of institutional instruction.
Pan, Junsong; Tan, Junyi; Wang, Yuhui; Zheng, Xiangyang; Owens, Ken; Li, Dawei; Li, Yuhong; Weng, Yiqun
2018-04-21
Map-based cloning identified a candidate gene for resistance to the anthracnose fungal pathogen Colletotrichum orbiculare in cucumber, which reveals a novel function for the highly conserved STAYGREEN family genes for host disease resistance in plants. Colletotrichum orbiculare is a hemibiotrophic fungal pathogen that causes anthracnose disease in cucumber and other cucurbit crops. No host resistance genes against the anthracnose pathogens have been cloned in crop plants. Here, we reported fine mapping and cloning of a resistance gene to the race 1 anthracnose pathogen in cucumber inbred lines Gy14 and WI 2757. Phenotypic and QTL analysis in multiple populations revealed that a single recessive gene, cla, was underlying anthracnose resistance in both lines, but WI2757 carried an additional minor-effect QTL. Fine mapping using 150 Gy14 × 9930 recombinant inbred lines and 1043 F 2 individuals delimited the cla locus into a 32 kb region in cucumber Chromosome 5 with three predicted genes. Multiple lines of evidence suggested that the cucumber STAYGREEN (CsSGR) gene is a candidate for the anthracnose resistance locus. A single nucleotide mutation in the third exon of CsSGR resulted in the substitution of Glutamine in 9930 to Arginine in Gy14 in CsSGR protein which seems responsible for the differential anthracnose inoculation responses between Gy14 and 9930. Quantitative real-time PCR analysis indicated that CsSGR was significantly upregulated upon anthracnose pathogen inoculation in the susceptible 9930, while its expression was much lower in the resistant Gy14. Investigation of allelic diversities in natural cucumber populations revealed that the resistance allele in almost all improved cultivars or breeding lines of the U.S. origin was derived from PI 197087. This work reveals an unknown function for the highly conserved STAYGREEN (SGR) family genes for host disease resistance in plants.
Polarization and long-term variability of Sgr A* X-ray echo
Churazov, E.; Khabibullin, I.; Ponti, G.; Sunyaev, R.
2017-06-01
We use a model of the molecular gas distribution within ˜100 pc from the centre of the Milky Way (Kruijssen, Dale & Longmore) to simulate time evolution and polarization properties of the reflected X-ray emission, associated with the past outbursts from Sgr A*. While this model is too simple to describe the complexity of the true gas distribution, it illustrates the importance and power of long-term observations of the reflected emission. We show that the variable part of X-ray emission observed by Chandra and XMM-Newton from prominent molecular clouds is well described by a pure reflection model, providing strong support of the reflection scenario. While the identification of Sgr A* as a primary source for this reflected emission is already a very appealing hypothesis, a decisive test of this model can be provided by future X-ray polarimetric observations, which will allow placing constraints on the location of the primary source. In addition, X-ray polarimeters (like, e.g. XIPE) have sufficient sensitivity to constrain the line-of-sight positions of molecular complexes, removing major uncertainty in the model.
Six Years of Monitoring of the Sgr B2 Molecular Cloud with INTEGRAL
Terrier, R.; Bélanger, G.; Ponti, G.; Trap, G.; Goldwurm, A.; Decourchelle, A.
2009-05-01
Several molecular clouds around the Galactic Centre (GC) emit strong neutral iron fluorescence line at 6.4 keV, as well as hard X-ray emission up to 100 keV. The origin of this emission has long been a matter of controversy: irradiation by low energy cosmic ray electrons or X-rays emitted by a nearby flaring source in the central region. A recent evidence for time variability in the iron line intensity that has been detected in the Sgr B2 cloud favors the reflexion scenario. We present here the data obtained after 6 years of INTEGRAL monitoring of the GC. In particular, we show a lightcurve of Sgr B2 that reveals a decrease in the hard X-ray flux over the last years and discuss its implications. We finally discuss perspectives with Simbol-X.
Le système de sûreté lyonnais selon les arrêtés du 6 décembre 1833
Directory of Open Access Journals (Sweden)
Amos Frappa
2010-01-01
Full Text Available Le 6 décembre 1833, le maire de Lyon Gabriel Prunelle adopte trois arrêtés instaurant un service de sûreté. Il s’agit de la seconde ville française à se doter d’un groupe de policiers spécialisé dans la recherche et l’arrestation des malfaiteurs. Un an plus tôt, le préfet de police Gisquet met à profit l’expérience de « la Rousse », surnom donné à la brigade de l’ancien bagnard Vidocq, pour équiper la capitale d’une telle structure. Le premier des textes du 6 décembre 1833 fixe les attributi...
Directory of Open Access Journals (Sweden)
Francisco Javier Martínez Antonio
2006-06-01
Full Text Available Este trabajo plantea la consideración de los imperios como unidades socio-históricas básicas para el estudio de la historia de la ciencia, la medicina y la tecnología. Para ello se empieza por desarrollar algunas claves historiográficas y conceptuales desde las cuales modificar el concepto habitual de imperio en un sentido más simétrico, transversal y relacional. Sobre esta base, se estudia la articulación de la salud pública en el Imperio español en el periodo 1833-1868, en concreto, de una de sus ramas: la sanidad militar. El resultado es una imagen más compleja de la misma donde se revelan conexiones transimperiales, la heterogeneidad y apertura de los espacios metropolitano y colonial y la iniciativa de distintos grupos y territorios al margen de la legislación y discursos oficiales.The article analyzes the relations between public health and empire in Spain under the reign of Isabel II (1833-68. After presenting certain conceptual notions, the case of military health is proposed as a specific example of these relations. On a journey through the Empire's different settings (the Iberian peninsula, Cuba, Porto Rico, and the Philippines, the text explains the role played by different groups, often marginalized from historical accounts.
Dust Radiative Transfer Modeling of the Infrared Ring around the Magnetar SGR 1900+14
Energy Technology Data Exchange (ETDEWEB)
Natale, G. [Jeremiah Horrocks Institute, University of Central Lancashire, Preston PR1 2HE (United Kingdom); Rea, N.; Torres, D. F.; Girart, J. M. [Institute of Space Sciences (IEEC–CSIC), Campus UAB, Carrer de Can Magrans S/N, E-08193 Barcelona (Spain); Lazzati, D. [Department of Physics, Oregon State University, 301 Weniger Hall, Corvallis, OR 97331 (United States); Perna, R., E-mail: gnatale@uclan.ac.uk [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States)
2017-03-01
A peculiar infrared ring-like structure was discovered by Spitzer around the strongly magnetized neutron star SGR 1900+14. This infrared (IR) structure was suggested to be due to a dust-free cavity, produced by the Soft Gamma-ray Repeaters (SGRs) Giant Flare occurring in 1998, and kept illuminated by surrounding stars. Using a 3D dust radiative transfer code, we aimed to reproduce the emission morphology and the integrated emission flux of this structure assuming different spatial distributions and densities for the dust, and different positions for the illuminating stars. We found that a dust-free ellipsoidal cavity can reproduce the shape, flux, and spectrum of the ring-like IR emission, provided that the illuminating stars are inside the cavity and that the interstellar medium has high gas density ( n {sub H} ∼ 1000 cm{sup −3}). We further constrain the emitting region to have a sharp inner boundary and to be significantly extended in the radial direction, possibly even just a cavity in a smooth molecular cloud. We discuss possible scenarios for the formation of the dustless cavity and the particular geometry that allows it to be IR-bright.
RADIO NONDETECTION OF THE SGR 1806−20 GIANT FLARE AND IMPLICATIONS FOR FAST RADIO BURSTS
International Nuclear Information System (INIS)
Tendulkar, Shriharsh P.; Kaspi, Victoria M.; Patel, Chitrang
2016-01-01
We analyze archival data from the Parkes radio telescope, which was observing a location 35.°6 away from SGR 1806−20 during its giant γ -ray flare of 2004 December 27. We show that no fast radio burst (FRB)-like burst counterpart was detected, and set a radio limit of 110 MJy at 1.4 GHz, including the estimated 70 dB suppression of the signal due to its location in the far sidelobe of Parkes and the predicted scattering from the interstellar medium. The upper limit for the ratio of magnetar giant flare radio to γ -ray fluence is η SGR ≲ 10 7 Jy ms erg −1 cm 2 . Based on the nondetection of a short and prompt γ -ray counterpart of 15 FRBs in γ -ray transient monitors, we set a lower limit on the fluence ratios of FRBs to be η FRB ≳ 10 7–9 Jy ms erg −1 cm 2 . The fluence ratio limit for SGR 1806−20 is inconsistent with all but one of the 15 FRBs. We discuss possible variations in the magnetar-FRB emission mechanism and observational caveats that may reconcile the theory with observations.
RADIO NONDETECTION OF THE SGR 1806−20 GIANT FLARE AND IMPLICATIONS FOR FAST RADIO BURSTS
Energy Technology Data Exchange (ETDEWEB)
Tendulkar, Shriharsh P.; Kaspi, Victoria M.; Patel, Chitrang, E-mail: shriharsh@physics.mcgill.ca [Department of Physics and McGill Space Institute, 3600 University St., Montréal, QC H3A 2A8 (Canada)
2016-08-10
We analyze archival data from the Parkes radio telescope, which was observing a location 35.°6 away from SGR 1806−20 during its giant γ -ray flare of 2004 December 27. We show that no fast radio burst (FRB)-like burst counterpart was detected, and set a radio limit of 110 MJy at 1.4 GHz, including the estimated 70 dB suppression of the signal due to its location in the far sidelobe of Parkes and the predicted scattering from the interstellar medium. The upper limit for the ratio of magnetar giant flare radio to γ -ray fluence is η {sub SGR} ≲ 10{sup 7} Jy ms erg{sup −1} cm{sup 2}. Based on the nondetection of a short and prompt γ -ray counterpart of 15 FRBs in γ -ray transient monitors, we set a lower limit on the fluence ratios of FRBs to be η {sub FRB} ≳ 10{sup 7–9} Jy ms erg{sup −1} cm{sup 2}. The fluence ratio limit for SGR 1806−20 is inconsistent with all but one of the 15 FRBs. We discuss possible variations in the magnetar-FRB emission mechanism and observational caveats that may reconcile the theory with observations.
International Nuclear Information System (INIS)
Prieskorn, Zachary; Kaaret, Philip
2012-01-01
We study the fluence distributions of over 3040 bursts from SGR 1806–20 and over 1963 bursts from SGR 1900+14 using the complete set of observations available from the Rossi X-Ray Timing Explorer/Proportional Counter Array through 2011 March. Cumulative event distributions are presented for both sources and are fitted with single and broken power laws as well as an exponential cutoff. The distributions are best fitted by a broken power law with exponential cutoff; however the statistical significance of the cutoff is not high and the upper portion of the broken power law can be explained as the expected number of false bursts due to random noise fluctuations. Event distributions are also examined in high and low burst rate regimes and power-law indices are found to be consistent, independent of the burst rate. The contribution function of the event fluence is calculated. This distribution shows that the energy released in the soft gamma repeater (SGR) bursts is dominated by the most powerful events for both sources. The power-law nature of these distributions combined with the dominant energy dissipation of the system occurring in the large, less frequent bursts is indicative of a self-organized critical system, as suggested by Goğus et al. in 1999.
Testing a class of non-Kerr metrics with hot spots orbiting SgrA*
International Nuclear Information System (INIS)
Liu, Dan; Li, Zilong; Bambi, Cosimo
2015-01-01
SgrA*, the supermassive black hole candidate at the Galactic Center, exhibits flares in the X-ray, NIR, and sub-mm bands that may be interpreted within a hot spot model. Light curves and images of hot spots orbiting a black hole are affected by a number of special and general relativistic effects, and they can be potentially used to check whether the object is a Kerr black hole of general relativity. However, in a previous study we have shown that the relativistic features are usually subdominant with respect to the background noise and the model-dependent properties of the hot spot, and eventually it is at most possible to estimate the frequency of the innermost stable circular orbit. In this case, tests of the Kerr metric are only possible in combination with other measurements. In the present work, we consider a class of non-Kerr spacetimes in which the hot spot orbit may be outside the equatorial plane. These metrics are difficult to constrain from the study of accretion disks and indeed current X-ray observations of stellar-mass and supermassive black hole candidates cannot put interesting bounds. Here we show that near future observations of SgrA* may do it. If the hot spot is sufficiently close to the massive object, the image affected by Doppler blueshift is brighter than the other one and this provides a specific observational signature in the hot spot's centroid track. We conclude that accurate astrometric observations of SgrA* with an instrument like GRAVITY should be able to test this class of metrics, except in the more unlikely case of a small viewing angle
The Slave Ship Manuelita and the Story of a Yoruba Community, 1833-1834
Directory of Open Access Journals (Sweden)
Olatunji Ojo
Full Text Available Abstract: In 1833, a Cuban slave ship, the Manuelita, which embarked over 500 slaves in Lagos was seized and condemned by the Anglo-Spanish slave court. After the personal details of the Africans ‘liberated’ from the ship had been collected by court officials some of them were transported aboard the same ship to Trinidad as indentured workers and apprentices. Drawing on materials from the African Origins Database this paper investigates who these Africans were, where they came from, and what their stories highlight about slaving operations in the Lagos hinterland and the Americas in the age of abolition.
Cólera, Iglesia católica y gobierno civil en Chiapas, 1833-1835
José Javier Guillén Villafuerte
2017-01-01
En 1833, la República mexicana padeció el embate de la primera epidemia de cólera morbo de su historia. Este artículo estudia las medidas que adoptaron las autoridades civiles y religiosas de Chiapas para proteger de ese mal a los habitantes de la región. Asimismo, se busca mostrar cómo las diversas problemáticas —de carácter político y financiero en el caso del gobierno y de orden social en el de la Iglesia— que enfrentaban ambas instancias dificultaron su actuación durante el tiempo que la ...
Cólera, Iglesia católica y gobierno civil en Chiapas, 1833-1835
Guillén Villafuerte, José Javier
2017-01-01
Resumen: En 1833, la República mexicana padeció el embate de la primera epidemia de cólera morbo de su historia. Este artículo estudia las medidas que adoptaron las autoridades civiles y religiosas de Chiapas para proteger de ese mal a los habitantes de la región. Asimismo, se busca mostrar cómo las diversas problemáticas-de carácter político y financiero en el caso del gobierno y de orden social en el de la Iglesia-que enfrentaban ambas instancias dificultaron su actuación durante el tiempo ...
David Roberts en Córdoba. Vistas de paisaje y arquitectura hacia 1833
Directory of Open Access Journals (Sweden)
Gámiz Gordo, Antonio
2015-12-01
Full Text Available David Roberts' views of Córdoba were carried out in 1833 and later redrafted as lithographs, engravings, and oils. These artworks enjoyed great commercial success and international diffusion due to their thematic and undoubted artistic value. The authors analyze their documentary value as a graphic record -prior to the advent of photography- of the urban landscape and architecture of Cordoba, a city now denominated a World Heritage Site. These images are studied here for the first time as a group, since they are either virtually untraceable or dispersed in museums throughout the world. In addition, these views have been contextualized with information concerning the artist and his Spanish journey, including a letter that he wrote from Córdoba. The documentary reliability of every image is also assessed, while the significant transformations of the places represented are indicated.Las vistas realizadas en Córdoba por David Roberts en 1833, reelaboradas como litografías, grabados y óleos, han gozado de gran éxito comercial y difusión internacional por su temática e indudable interés artístico. Esta investigación profundiza en su valor documental como registros gráficos previos a la aparición de la fotografía, del paisaje y la arquitectura de una ciudad hoy considerada Patrimonio de la Humanidad. Las imágenes presentadas se analizan por primera vez como conjunto, pues algunas son de difícil localización o están dispersas en museos de todo el mundo, y se contextualizan con datos sobre el pintor y su viaje por España, considerando una carta que éste escribió desde Córdoba. También se valora la fiabilidad documental de cada vista, a la vez que se detectan significativas transformaciones de los lugares representados.
DISCOVERY OF SUBSTRUCTURE IN THE SCATTER-BROADENED IMAGE OF SGR A*
Energy Technology Data Exchange (ETDEWEB)
Gwinn, C. R. [Physics Department, Broida Hall, University of California, Santa Barbara, CA 93117 (United States); Kovalev, Y. Y.; Soglasnov, V. A. [Astro Space Center, Lebedev Physical Institute, Russian Academy of Sciences, Profsoyuznaya Str. 84/32, Moscow 117997 (Russian Federation); Johnson, M. D., E-mail: cgwinn@physics.ucsb.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)
2014-10-10
We have detected substructure within the smooth scattering disk of the celebrated Galactic center radio source Sagittarius A* (Sgr A*). We observed this structure at 1.3 cm wavelength with the Very Long Baseline Array together with the Green Bank Telescope, on baselines of up to 3000 km, long enough to completely resolve the average scattering disk. Such structure is predicted theoretically as a consequence of refraction by large-scale plasma fluctuations in the interstellar medium. Along with the much-studied θ{sub d}∝λ{sup 2} scaling of angular broadening θ{sub d} with observing wavelength λ, our observations indicate that the spectrum of interstellar turbulence is shallow with an inner scale larger than 300 km. The substructure is consistent with an intrinsic size of about 1 mas at 1.3 cm wavelength, as inferred from deconvolution of the average scattering. Further observations of the substructure can set stronger constraints on the properties of scattering material and on the intrinsic size of Sgr A*. These constraints will guide our understanding of the effects of scatter broadening and the emission physics near the black hole in images with the Event Horizon Telescope at millimeter wavelengths.
An exceptionally bright flare from SGR 1806-20 and the origins of short-duration gamma-ray bursts.
Hurley, K; Boggs, S E; Smith, D M; Duncan, R C; Lin, R; Zoglauer, A; Krucker, S; Hurford, G; Hudson, H; Wigger, C; Hajdas, W; Thompson, C; Mitrofanov, I; Sanin, A; Boynton, W; Fellows, C; von Kienlin, A; Lichti, G; Rau, A; Cline, T
2005-04-28
Soft-gamma-ray repeaters (SGRs) are galactic X-ray stars that emit numerous short-duration (about 0.1 s) bursts of hard X-rays during sporadic active periods. They are thought to be magnetars: strongly magnetized neutron stars with emissions powered by the dissipation of magnetic energy. Here we report the detection of a long (380 s) giant flare from SGR 1806-20, which was much more luminous than any previous transient event observed in our Galaxy. (In the first 0.2 s, the flare released as much energy as the Sun radiates in a quarter of a million years.) Its power can be explained by a catastrophic instability involving global crust failure and magnetic reconnection on a magnetar, with possible large-scale untwisting of magnetic field lines outside the star. From a great distance this event would appear to be a short-duration, hard-spectrum cosmic gamma-ray burst. At least a significant fraction of the mysterious short-duration gamma-ray bursts may therefore come from extragalactic magnetars.
Psaltis, Dimitrios; Özel, Feryal; Chan, Chi-Kwan; Marrone, Daniel P.
2015-12-01
The half opening angle of a Kerr black hole shadow is always equal to (5 ± 0.2)GM/Dc2, where M is the mass of the black hole and D is its distance from the Earth. Therefore, measuring the size of a shadow and verifying whether it is within this 4% range constitutes a null hypothesis test of general relativity. We show that the black hole in the center of the Milky Way, Sgr A*, is the optimal target for performing this test with upcoming observations using the Event Horizon Telescope (EHT). We use the results of optical/IR monitoring of stellar orbits to show that the mass-to-distance ratio for Sgr A* is already known to an accuracy of ∼4%. We investigate our prior knowledge of the properties of the scattering screen between Sgr A* and the Earth, the effects of which will need to be corrected for in order for the black hole shadow to appear sharp against the background emission. Finally, we explore an edge detection scheme for interferometric data and a pattern matching algorithm based on the Hough/Radon transform and demonstrate that the shadow of the black hole at 1.3 mm can be localized, in principle, to within ∼9%. All these results suggest that our prior knowledge of the properties of the black hole, of scattering broadening, and of the accretion flow can only limit this general relativistic null hypothesis test with EHT observations of Sgr A* to ≲10%.
Biodegradation of 2,4 dichlorophenol by Pleurotus ostreatus DSM 1833
Directory of Open Access Journals (Sweden)
Heloisa Helena Batista da Silva
2009-12-01
Full Text Available This work aimed to investigate the capacity of Pleurotus ostreatus DSM 1833 to degrade 2,4-dichlorophenol, important pollutant found in the wastewaters of the paper and cellulose industry. Using a factorial design 2², the concentrations of glucose and 2,4-dichlorophenol varied between 0 and 10g.L-1 and 5 and 30mg.L-1, respectively. The best global biodegradation rate was obtained using 30 mg.L-1 of 2,4- dichlorophenol in the absence of glucose. This culture medium was used for scaling up the process, resulting in a global biodegradation rate of 0.47mg.L-1.h-1. A comparative test between an inoculated medium and an abiotic control demonstrated that 54.1% of 2,4- dichlorophenol degradation could be attributed to the presence of P. ostreatus.A indústria de papel e celulose contribui para a contaminação ambiental devido aos resíduos gerados, especialmente, no processo de branqueamento da polpa Kraft, realizada com cloro. Basideomicetos saprófitas têm a capacidade de degradar compostos organoclorados como cloroligninas e clorofenóis. Este trabalho teve como objetivo investigar a capacidade de Pleurotus ostreatus DSM 1833 em degradar 2,4-diclorofenol, importante poluente encontrado nos efluentes da indústria de papel e celulose. Utilizando um planejamento fatorial 2², as concentrações de glicose e de 2,4-diclorofenol variaram entre 0 e 10 g.L-1 e 5 e 30 mg.L-1, respectivamente. A melhor taxa global de degradação foi obtida usando-se 30 mg.L-1 de 2,4-diclorofenol na ausência de glicose. Este meio de cultura foi utilizado para a ampliação da escala do processo, resultando em uma taxa global de biodegradação de 0,47 mg.L-1.h-1. Um teste comparativo entre o meio inoculado e o controle abiótico demonstrou que 54,1% da degradação do 2,4-diclorofenol pode ser atribuída à presença de Pleurotus ostreatus.
Testing General Relativity with High-Resolution Imaging of Sgr A*
International Nuclear Information System (INIS)
Broderick, Avery E; Loeb, Abraham
2006-01-01
Submilliarcsecond astrometry and imaging of the black hole Sgr A* at the Galactic Center may become possible in the near future at infrared and submillimetre wavelengths. This resolution is sufficient to observe the silhouette the supermassive black hole in the Galactic center casts upon background emission. However, more exciting is the prospect of observing 'hot spots' in the accretion fbw. Here we discuss how such measurements may be used to test not only the consistency of General Relativity, but also the validity of the Kerr metric in particular
Testing General Relativity with High-Resolution Imaging of Sgr A*
Energy Technology Data Exchange (ETDEWEB)
Broderick, Avery E; Loeb, Abraham [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, Cambridge, MA, 02145 (United States)
2006-12-15
Submilliarcsecond astrometry and imaging of the black hole Sgr A* at the Galactic Center may become possible in the near future at infrared and submillimetre wavelengths. This resolution is sufficient to observe the silhouette the supermassive black hole in the Galactic center casts upon background emission. However, more exciting is the prospect of observing 'hot spots' in the accretion fbw. Here we discuss how such measurements may be used to test not only the consistency of General Relativity, but also the validity of the Kerr metric in particular.
MAXI/GSC detection of a new outburst from SAX J1810.8-2609
Negoro, H.; Mihara, T.; Nakahira, S.; Yatabe, F.; Takao, Y.; Matsuoka, M.; Kawai, N.; Sugizaki, M.; Tachibana, Y.; Morita, K.; Sakamoto, T.; Serino, M.; Sugita, S.; Kawakubo, Y.; Hashimoto, T.; Yoshida, A.; Nakajima, M.; Sakamaki, A.; Maruyama, W.; Ueno, S.; Tomida, H.; Ishikawa, M.; Sugawara, Y.; Isobe, N.; Shimomukai, R.; Ueda, Y.; Tanimoto, A.; Morita, T.; Yamada, S.; Tsuboi, Y.; Iwakiri, W.; Sasaki, R.; Kawai, H.; Sato, T.; Tsunemi, H.; Yoneyama, T.; Yamauchi, M.; Hidaka, K.; Iwahori, S.; Kawamuro, T.; Yamaoka, K.; Shidatsu, M.
2018-05-01
We report a new X-ray outburst from the low-mass X-ray binary SAX J1810.8-2609 (aka V4722 Sgr; Ubertini et al. 1998, IAUC 6838) observed with MAXI/GSC. The enhancement was recognized from 2018 April 23 (MJD 58231), and X-ray count rates in the 2-4 keV and 4-10 keV bands peaked on April 26 at 0.085 +/- 0.008 c/s/cm2 ( 80 mCrab) and 0.096+/-0.008 c/s/cm2 ( 82 mCrab), respectively.
Gender Sensitivity and the Inheritance Act of The Bahamas, 1833
Directory of Open Access Journals (Sweden)
Sabrina A. Russell-Skinner
2008-02-01
Full Text Available The motivation for this paper stemmed from the realization that discrimination against women in the Bahamas still exists, is being continually perpetuated and, in fact, is institutionalized by the law which should enforce justice for all. Against the backdrop of preparation for the 1995 United Nations Conference on Women, a closer look is taken at gender discrimination in the Bahamas by examining the Constitution and the Inheritance Act of 1833. The assumption that institutionalized patriarchy gives rise to gender discrimination guides the analysis. The organs of male domination and the reasons for its perpetuation are discussed as well as obstacles to the passage of the draft Inheritance Bill (1983. It is recommended the inequities arising from an inbuilt structure of a male dominated society be addressed by legislation that will ensure equity and social justice for all. Finally, it is suggested that the draft Inheritance Bill (1983 with modifications to some provisions has the potential to accomplish this.
AN IMPROVED DISTANCE AND MASS ESTIMATE FOR SGR A* FROM A MULTISTAR ORBIT ANALYSIS
Energy Technology Data Exchange (ETDEWEB)
Boehle, A.; Ghez, A. M.; Meyer, L.; Yelda, S.; Albers, S.; Martinez, G. D.; Becklin, E. E.; Do, T.; Morris, M. R.; Sitarski, B.; Witzel, G. [UCLA, Department of Physics and Astronomy, Los Angeles, CA 90095 (United States); Schödel, R. [Instituto de Astrofísica de Andalucía (CSIC), Glorieta de la Astronomía S/N, E-18008 Granada (Spain); Lu, J. R. [Institute for Astronomy, University of Hawaii, Honolulu, HI 96822 (United States); Matthews, K., E-mail: aboehle@astro.ucla.edu [Division of Physics, Mathematics, and Astronomy, California Institute of Technology, MC 301-17, Pasadena, CA 91125 (United States)
2016-10-10
We present new, more precise measurements of the mass and distance of our Galaxy’s central supermassive black hole, Sgr A*. These results stem from a new analysis that more than doubles the time baseline for astrometry of faint stars orbiting Sgr A*, combining 2 decades of speckle imaging and adaptive optics data. Specifically, we improve our analysis of the speckle images by using information about a star’s orbit from the deep adaptive optics data (2005–2013) to inform the search for the star in the speckle years (1995–2005). When this new analysis technique is combined with the first complete re-reduction of Keck Galactic Center speckle images using speckle holography, we are able to track the short-period star S0-38 ( K -band magnitude = 17, orbital period = 19 yr) through the speckle years. We use the kinematic measurements from speckle holography and adaptive optics to estimate the orbits of S0-38 and S0-2 and thereby improve our constraints of the mass ( M {sub bh}) and distance ( R {sub o} ) of Sgr A*: M {sub bh} = (4.02 ± 0.16 ± 0.04) × 10{sup 6} M {sub ⊙} and 7.86 ± 0.14 ± 0.04 kpc. The uncertainties in M {sub bh} and R {sub o} as determined by the combined orbital fit of S0-2 and S0-38 are improved by a factor of 2 and 2.5, respectively, compared to an orbital fit of S0-2 alone and a factor of ∼2.5 compared to previous results from stellar orbits. This analysis also limits the extended dark mass within 0.01 pc to less than 0.13 × 10{sup 6} M {sub ⊙} at 99.7% confidence, a factor of 3 lower compared to prior work.
Directory of Open Access Journals (Sweden)
Ng Weng-Ian
2010-09-01
Full Text Available Abstract Background The effect of high glucose concentration on the transcription levels of the small RNA SgrS and the messenger RNA ptsG, (encoding the glucose transporter IICBGlc, was studied in both E. coli K-12 (MG1655 and JM109 and E. coli B (BL21. It is known that the transcription level of sgrS increases when E. coli K-12 (MG1655 and JM109 is exposed to the non-metabolized glucose alpha methyl glucoside (αMG or when the bacteria with a defective glycolysis pathway is grown in presence of glucose. The increased level of sRNA SgrS reduces the level of the ptsG mRNA and consequently lowers the level of the glucose transporter IICBGlc. The suggested trigger for this action is the accumulation of the corresponding phospho-sugars. Results In the course of the described work, it was found that E. coli B (BL21 and E. coli K-12 (JM109 and MG1655 responded similarly to αMG: both strains increased SgrS transcription and reduced ptsG transcription. However, the two strains reacted differently to high glucose concentration (40 g/L. E. coli B (BL21 reacted by increasing sgrS transcription and reducing ptsG transcription while E. coli K-12 (JM109 and MG1655 did not respond to the high glucose concentration, and, therefore, transcription of sgrS was not detected and ptsG mRNA level was not affected. Conclusions The results suggest that E. coli B (BL21 tolerates high glucose concentration not only by its more efficient central carbon metabolism, but also by controlling the glucose transport into the cells regulated by the sRNA SgrS, which may suggest a way to control glucose consumption and increase its efficient utilization.
Is the apparent dichotomy between bursting activity of magnetars and radio pulsars real ?
International Nuclear Information System (INIS)
Pons, J A; Perna, R
2012-01-01
Anomalous X-ray Pulsars (AXPs) and Soft Gamma-Ray Repeaters (SGRs) are a class of young neutron stars (NSs) characterized by high X-ray quiescent luminosities, short X-ray bursts, and giant flares (for SGRs). They are believed to be magnetars, i.e. NSs with magnetic fields ∼ 10 14 – 10 15 G. The discovery of magnetar-like X-ray bursts from the young pulsar PSR J1846-0258 [1], with an inferred surface dipolar magnetic field of B p = 4.9 × 10 13 G, lower than the traditionally considered magnetar range, and, more recently, by the discovery of SGR 0418+5729 with an even lower B p = 7.5 × 10 12 G [2], well within the range of the rotation powered pulsars which do not display any bursting behaviour, has raised the obvious question: why some 'high-B' pulsars (PSR J1119-6127 and PSR J1814-1744, with B ∼ 4 – 5 × 10 13 G) do not display any burst, while at least one case of 'low-B' NSs (SGR 0418+5729) does, if the magnetic field is their driving force ?
PARTICLE ACCELERATION AND THE ORIGIN OF X-RAY FLARES IN GRMHD SIMULATIONS OF SGR A*
Energy Technology Data Exchange (ETDEWEB)
Ball, David; Özel, Feryal; Psaltis, Dimitrios; Chan, Chi-kwan [Steward Observatory and Department of Astronomy, University of Arizona (United States)
2016-07-20
Significant X-ray variability and flaring has been observed from Sgr A* but is poorly understood from a theoretical standpoint. We perform general relativistic magnetohydrodynamic simulations that take into account a population of non-thermal electrons with energy distributions and injection rates that are motivated by PIC simulations of magnetic reconnection. We explore the effects of including these non-thermal electrons on the predicted broadband variability of Sgr A* and find that X-ray variability is a generic result of localizing non-thermal electrons to highly magnetized regions, where particles are likely to be accelerated via magnetic reconnection. The proximity of these high-field regions to the event horizon forms a natural connection between IR and X-ray variability and accounts for the rapid timescales associated with the X-ray flares. The qualitative nature of this variability is consistent with observations, producing X-ray flares that are always coincident with IR flares, but not vice versa, i.e., there are a number of IR flares without X-ray counterparts.
International Nuclear Information System (INIS)
Li, Zilong; Kong, Lingyao; Bambi, Cosimo
2014-01-01
General relativity makes clear predictions about the spacetime geometry around black holes. In the near future, new facilities will have the capability to explore the metric around SgrA*, the supermassive black hole candidate at the center of our Galaxy, and to open a new window to test the Kerr black hole hypothesis. In this paper, we compute light curves and images associated with compact emission regions (hot spots) orbiting around Kerr and non-Kerr black holes. We study how the analysis of the properties of the radiation emitted by a hot spot can be used to test the Kerr nature of SgrA*. We find that the sole observation of the hot spot light curve can at most constrain a combination of the black hole spin and of possible deviations from the Kerr solution. This happens because the same orbital frequency around a Kerr black hole can be found for a non-Kerr object with a different spin parameter. Second order corrections in the light curve due to the background geometry are typically too small to be identified. While the observation of the hot spot centroid track can potentially bound possible deviations from the Kerr solution, that is out of reach for the near future for the Very Large Telescope Interferometer instrument GRAVITY. The Kerr black hole hypothesis could really be tested in the case of the discovery of a radio pulsar in a compact orbit around SgrA*. Radio observations of such a pulsar would provide precise estimates of the mass and the spin of SgrA*, and the combination of these measurements (probing the weak field) with the hot spot light curve information (probing the strong field) may constrain/find possible deviations from the Kerr solution with quite good precision.
Energy Technology Data Exchange (ETDEWEB)
Li, Zilong; Kong, Lingyao; Bambi, Cosimo [Center for Field Theory and Particle Physics and Department of Physics, Fudan University, 200433 Shanghai (China)
2014-06-01
General relativity makes clear predictions about the spacetime geometry around black holes. In the near future, new facilities will have the capability to explore the metric around SgrA*, the supermassive black hole candidate at the center of our Galaxy, and to open a new window to test the Kerr black hole hypothesis. In this paper, we compute light curves and images associated with compact emission regions (hot spots) orbiting around Kerr and non-Kerr black holes. We study how the analysis of the properties of the radiation emitted by a hot spot can be used to test the Kerr nature of SgrA*. We find that the sole observation of the hot spot light curve can at most constrain a combination of the black hole spin and of possible deviations from the Kerr solution. This happens because the same orbital frequency around a Kerr black hole can be found for a non-Kerr object with a different spin parameter. Second order corrections in the light curve due to the background geometry are typically too small to be identified. While the observation of the hot spot centroid track can potentially bound possible deviations from the Kerr solution, that is out of reach for the near future for the Very Large Telescope Interferometer instrument GRAVITY. The Kerr black hole hypothesis could really be tested in the case of the discovery of a radio pulsar in a compact orbit around SgrA*. Radio observations of such a pulsar would provide precise estimates of the mass and the spin of SgrA*, and the combination of these measurements (probing the weak field) with the hot spot light curve information (probing the strong field) may constrain/find possible deviations from the Kerr solution with quite good precision.
CN in the Sgr A* environment - first results
International Nuclear Information System (INIS)
Stankovic, M; Seaquist, E R; Muehle, S
2006-01-01
The radical CN, through the CN/HCN ratio, has proven to be an exceptionally good tool to study the photodissociation regions (PDRs) dominated by FUV radiation. Our region of interest, the circumnuclear disk (CND) surrounding Sgr A*, is exposed to the strong UV radiation field originating from the central stellar cluster. It contains potentially star forming cores recently elucidated by interferometric HCN observations with OVRO by Christopher et al. (2005). We present the results of preliminary observations of CN (N = 2-l) transitions with the IRAM 30-m telescope and report, for the first time, detection of CN emission in the GC region indicative of PDR, activity. This work motivates the further investigation of the role of PDRs in the clumpy medium of the Galactic center (GC) environment in global photodissociation and in promoting or inhibiting star formation in the CND
International Nuclear Information System (INIS)
Moraes Rego, A.F. de; Rodrigues, Z.A.; Oliveira, M.L. de; Santana, M.D.
1986-01-01
Influence of gamma radiation on Zabrotes subfasciatus (Boh, 1833) (Coleoptera Bruchidae) and the beans Phaseolus vulgaris (L.). The effects of 60 CO gamma radiation, 50 Gy, on both Phaseolus vulgaris (L.) seedbeans and adults of Zabrotes subfasciatus were studied using the no free choise method. Radiation decreased insect fertility hence insect population and it damage loss of weight and germination of seedbeans. However, radiation resulted in abnamal seedlings, showing various degrees of morphological malformation, although there was no effect on germination rates or seedling vigor. (Author) [pt
Directory of Open Access Journals (Sweden)
HRISTO VALCHOVSKI
2018-03-01
Full Text Available Results of recent earthworm collectings in Bulgaria are presented. During the investigations altogether 18 species have been registered. Dendrobaena platyura (Fitzinger, 1833 is a new record for the country, and with D. hrabei (Černosvitov, 1934 and Octodrilus transpadanus (Rosa, 1884 also for the region of Stara Planina (Balkan Mts. D. hrabei, D. depressa (Rosa, 1893, D. octaedra (Savigny, 1826 and Eiseniella tetraedra (Savigny, 1826 represent new records for Pirin Mts.
Groundwater Seepage Estimation into Amirkabir Tunnel Using Analytical Methods and DEM and SGR Method
Hadi Farhadian; Homayoon Katibeh
2015-01-01
In this paper, groundwater seepage into Amirkabir tunnel has been estimated using analytical and numerical methods for 14 different sections of the tunnel. Site Groundwater Rating (SGR) method also has been performed for qualitative and quantitative classification of the tunnel sections. The obtained results of above mentioned methods were compared together. The study shows reasonable accordance with results of the all methods unless for two sections of tunnel. In these t...
Buttu, Marco; D'Amico, Nichi; Egron, Elise; Iacolina, Maria Noemi; Marongiu, Pasqualino; Migoni, Carlo; Pellizzoni, Alberto; Poppi, Sergio; Possenti, Andrea; Trois, Alessio; Vargiu, Gian Paolo
2013-05-01
During the Sardinia Radio Telescope (SRT) science verification phase, we observed PSR J1745-2900, firstly detected as an X-ray flare from Sgr A* by Swift and then identified as a 3.76 s X-ray magnetar with NuSTAR telescope (ATels #5006, #5020, #5027, #5032, #5033, #5035), at a central frequency of 7.30 GHz. We used a Beam Wave Guide focus cryogenically cooled receiver (system temperature ~25 K).
GRMHD Simulations of Visibility Amplitude Variability for Event Horizon Telescope Images of Sgr A*
Medeiros, Lia; Chan, Chi-kwan; Özel, Feryal; Psaltis, Dimitrios; Kim, Junhan; Marrone, Daniel P.; Sa¸dowski, Aleksander
2018-04-01
The Event Horizon Telescope will generate horizon scale images of the black hole in the center of the Milky Way, Sgr A*. Image reconstruction using interferometric visibilities rests on the assumption of a stationary image. We explore the limitations of this assumption using high-cadence disk- and jet-dominated GRMHD simulations of Sgr A*. We also employ analytic models that capture the basic characteristics of the images to understand the origin of the variability in the simulated visibility amplitudes. We find that, in all simulations, the visibility amplitudes for baselines oriented parallel and perpendicular to the spin axis of the black hole follow general trends that do not depend strongly on accretion-flow properties. This suggests that fitting Event Horizon Telescope observations with simple geometric models may lead to a reasonably accurate determination of the orientation of the black hole on the plane of the sky. However, in the disk-dominated models, the locations and depths of the minima in the visibility amplitudes are highly variable and are not related simply to the size of the black hole shadow. This suggests that using time-independent models to infer additional black hole parameters, such as the shadow size or the spin magnitude, will be severely affected by the variability of the accretion flow.
Simple sequence repeat marker development and genetic mapping ...
Indian Academy of Sciences (India)
polymorphic SSR (simple sequence repeats) markers from libraries enriched for GA, CAA and AAT repeats, as well as 6 ... ers for quinoa was the development of a genetic linkage map ...... Weber J. L. 1990 Informativeness of human (dC-dA)n.
Cólera, Iglesia católica y gobierno civil en Chiapas, 1833-1835
Directory of Open Access Journals (Sweden)
José Javier Guillén Villafuerte
2017-12-01
Full Text Available En 1833, la República mexicana padeció el embate de la primera epidemia de cólera morbo de su historia. Este artículo estudia las medidas que adoptaron las autoridades civiles y religiosas de Chiapas para proteger de ese mal a los habitantes de la región. Asimismo, se busca mostrar cómo las diversas problemáticas —de carácter político y financiero en el caso del gobierno y de orden social en el de la Iglesia— que enfrentaban ambas instancias dificultaron su actuación durante el tiempo que la epidemia se cebó sobre la población de Chiapas. Finalmente, establecer, después de un ejercicio de crítica documental, cuál pudo ser su impacto demográfico.
Magnetar Observations with Fermi/GBM
Kouveliotou, Chryssa
2009-01-01
NASA's Fermi Observatory was launched June 11, 2009; the Fermi Gamma Ray Burst Monitor (GBM) began normal operations on July 14, about a month after launch, when the trigger algorithms were enabled. In the first year of operations we recorded emission from four magnetar sources; of these, only one was an old magnetar: SGR 1806+20. The other three detections were: SGR J0501+4516, newly discovered with Swift and extensively monitored with both Swift and GBM, SGR J1550-5418, a source originally classified as an Anomalous X-ray Pulsar (AXP) and a very recently discovered new source, SGR 0418+5729. I report below on the current status of the analyses efforts of the GBM data.
Energy Technology Data Exchange (ETDEWEB)
De Pree, C. G.; Monsrud, A. [Agnes Scott College, 141 East College Avenue, Decatur, GA 30030 (United States); Peters, T. [Institut für Theoretische Physik, Universität Zürich, CH-8057 Zürich (Switzerland); Mac Low, M.-M. [American Museum of Natural History, New York, NY 10024 (United States); Wilner, D. J.; Keto, E. R. [Harvard-Smithsonian CfA, Cambridge, MA 02138 (United States); Goss, W. M. [National Radio Astronomy Observatory, Socorro, NM 87801 (United States); Galván-Madrid, R. [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany); Klessen, R. S. [Zentrum für Astronomie, Institut für Theoretische Astrophysik, Universität Heidelberg, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany)
2014-02-01
Accretion flows onto massive stars must transfer mass so quickly that they are themselves gravitationally unstable, forming dense clumps and filaments. These density perturbations interact with young massive stars, emitting ionizing radiation, alternately exposing and confining their H II regions. As a result, the H II regions are predicted to flicker in flux density over periods of decades to centuries rather than increase monotonically in size as predicted by simple Spitzer solutions. We have recently observed the Sgr B2 region at 1.3 cm with the Very Large Array in its three hybrid configurations (DnC, CnB, and BnA) at a resolution of ∼0.''25. These observations were made to compare in detail with matched continuum observations from 1989. At 0.''25 resolution, Sgr B2 contains 41 ultracompact (UC) H II regions, 6 of which are hypercompact. The new observations of Sgr B2 allow comparison of relative peak flux densities for the H II regions in Sgr B2 over a 23 year time baseline (1989-2012) in one of the most source-rich massive star forming regions in the Milky Way. The new 1.3 cm continuum images indicate that four of the 41 UC H II regions exhibit significant changes in their peak flux density, with one source (K3) dropping in peak flux density, and the other three sources (F10.303, F1, and F3) increasing in peak flux density. The results are consistent with statistical predictions from simulations of high mass star formation, suggesting that they offer a solution to the lifetime problem for UC H II regions.
G2 and Sgr A *: A Cosmic Fizzle at the Galactic Center
Energy Technology Data Exchange (ETDEWEB)
Morsony, Brian J. [Dept. of Astronomy, University of Maryland, 1113 Physical Sciences Complex, College Park, MD, 20742-2421 (United States); Gracey, Brandon T.; Workman, Jared C. [Dept. of Physical and Environmental Sciences, Colorado Mesa University, Grand Junction, CO, 81501 (United States); Yoon, DooSoo [Dept. of Astronomy, University of Wisconsin-Madison, 2535 Sterling Hall, 475 N. Charter Street, Madison, WI, 53706-1582 (United States)
2017-07-01
We carry out a series of simulations of G2-type clouds interacting with the black hole at the galactic center, to determine why no large changes in the luminosity of Sgr A * were seen, and to determine the nature of G2. We measure the accretion rate from the gas cloud onto Sgr A * for a range of simulation parameters, such as cloud structure, background structure, background density, grid resolution, and accretion radius. For a broad range of parameters, the amount of cloud material accreted is small relative to the amount of background material accreted. The total accretion rate is not significantly effected for at least 30 yr after periapsis. We find that reproducing observations of G2 likely requires two components for the object: an extended, cold gas cloud responsible for the Br- γ emission, and a compact core or dusty stellar object dominating the bolometric luminosity. In simulations, the bolometric and X-ray luminosity have a peak lasting from about one year before to one year after periapsis, a feature not detected in observations. Our simulated Br- γ emission is largely consistent with observations leading up to periapsis, with a slight increase in luminosity and a large increase in the FWHM of the line velocity. All emission from a gaseous component of G2 should fade rapidly after periapsis and be undetectable after one year, due to shock heating and expansion of the cloud. Any remaining emission should be from the compact component of G2.
Directory of Open Access Journals (Sweden)
Pablo Fuentes Olivares
2016-04-01
Full Text Available Se reporta por primera vez, un individuo en estado larval del cerambícido Acanthinodera cumingii (Hope, 1833 viviendo dentro del tocón de un arbusto exótico. Anteriormente, la larva de ésta especie se había registrado en 28 especies leñosas (14 nativos y 14 exóticos. Este registro aumenta su espectro alimenticio a un total de 29 especies leñosas. Se discute la incidencia de éste arbusto sobre la distribución de la especie.
NuSTAR DISCOVERY OF A 3.76 s TRANSIENT MAGNETAR NEAR SAGITTARIUS A*
DEFF Research Database (Denmark)
Mori, Kaya; Gotthelf, Eric V.; Zhang, Shuo
2013-01-01
We report the discovery of 3.76 s pulsations from a new burst source near Sgr A* observed by the NuSTAR observatory. The strong signal from SGR J1745-29 presents a complex pulse profile modulated with pulsed fraction 27% +/- 3% in the 3-10 keV band. Two observations spaced nine days apart yield a......-ray band or have been detected as high-B radio pulsars. The peculiar location of SGR J1745-29 has important implications for the formation and dynamics of neutron stars in the Galactic center region....
Mul, Joram D; Zheng, Jia; Goodyear, Laurie J
2016-01-01
The development of animal models with construct, face, and predictive validity to accurately model human depression has been a major challenge. One proposed rodent model is the 5 d repeated forced swim stress (5d-RFSS) paradigm, which progressively increases floating during individual swim sessions. The onset and persistence of this floating behavior has been anthropomorphically characterized as a measure of depression. This interpretation has been under debate because a progressive increase in floating over time may reflect an adaptive learned behavioral response promoting survival, and not depression (Molendijk and de Kloet, 2015). To assess construct and face validity, we applied 5d-RFSS to C57BL/6J and BALB/cJ mice, two mouse strains commonly used in neuropsychiatric research, and measured a combination of emotional, homeostatic, and psychomotor symptoms indicative of a depressive-like state. We also compared the efficacy of 5d-RFSS and chronic social defeat stress (CSDS), a validated depression model, to induce a depressive-like state in C57BL/6J mice. In both strains, 5d-RFSS progressively increased floating behavior that persisted for at least 4 weeks. 5d-RFSS did not alter sucrose preference, body weight, appetite, locomotor activity, anxiety-like behavior, or immobility behavior during a tail-suspension test compared with nonstressed controls. In contrast, CSDS altered several of these parameters, suggesting a depressive-like state. Finally, predictive validity was assessed using voluntary wheel running (VWR), a known antidepressant intervention. Four weeks of VWR after 5d-RFSS normalized floating behavior toward nonstressed levels. These observations suggest that 5d-RFSS has no construct or face validity but might have predictive validity to model human depression.
El cólera morbus en una ciudad de la provincia mexicana. Puebla de los Ángeles en 1833
Cuenya, Miguel Ángel
2006-01-01
In the first half of the XIX century, the city of Puebla, located in the central high plateau of Mexico suffered, on the occasion of the civil wars, the deterioration of great part of the center. The city also lived a serious economic depression which affected all the social sectors, especially the poor and the unprotected mass. The conditions of public health were deplorable, and became more complex due to the serious financial problems of the municipality. In this context, in 1833 arrive, f...
International Nuclear Information System (INIS)
Matheson, Heather; Safi-Harb, Samar
2010-01-01
In 1999, the Chandra X-ray Observatory revealed a 150'' radius halo surrounding the 40'' radius pulsar wind nebula (PWN) G21.5-0.9. A 2005 imaging study of G21.5-0.9 showed that the halo is limb-brightened and suggested that this feature is a candidate for the long-sought supernova remnant (SNR) shell. We present a spectral analysis of SNR G21.5-0.9, using the longest effective observation to date (578.6 ks with the Advanced CCD Imaging Spectrometer (ACIS) and 278.4 ks with the High-Resolution Camera (HRC)) to study unresolved questions about the spectral nature of remnant features, such as the limb brightening of the X-ray halo and the bright knot in the northern part of the halo. The Chandra analysis favors the non-thermal interpretation of the limb. Its spectrum is fit well with a power-law model with a photon index Γ = 2.13 (1.94-2.33) and a luminosity of L x (0.5-8 keV) = (2.3 ± 0.6) x 10 33 erg s -1 (at an assumed distance of 5.0 kpc). An srcut model was also used to fit the spectrum between the radio and X-ray energies. While the absence of a shell in the radio still prohibits constraining the spectrum at radio wavelengths, we assume a range of spectral indices to infer the 1 GHz flux density and the rolloff frequency of the synchrotron spectrum in X-rays and find that the maximum energy to which electrons are accelerated at the shock ranges from ∼60 to 130 TeV (B/10 μG) -1/2 , where B is the magnetic field in units of μG. For the northern knot, we constrain previous models and find that a two-component power-law (or srcut) + pshock model provides an adequate fit, with the pshock model requiring a very low ionization timescale and solar abundances for Mg and Si. Our spectroscopic study of PSR J1833-1034, the highly energetic pulsar powering G21.5-0.9, shows that its spectrum is dominated by hard non-thermal X-ray emission with some evidence of a thermal component that represents ∼9% of the observed non-thermal emission and that suggests non
Strong gravitational lensing by Sgr A*
International Nuclear Information System (INIS)
Bin-Nun, Amitai Y
2011-01-01
In recent years, there has been increasing recognition of the potential to use the galactic center as a probe of general relativity in the strong field. There is almost certainly a black hole at Sgr A* in the galactic center, and this would allow us to have the opportunity to probe dynamics near the exterior of the black hole. In the last decade, there has been theoretical research into extreme gravitational lensing in the galactic center. Unlike in most applications of gravitational lensing, where the bending angle is of the order of, at most, an arc minute, very large bending angles are possible for light that closely approaches a black hole. Photons may even loop multiple times around a black hole before reaching the observer. There have been many proposals to use light's close approach to the black hole as a probe of the black hole metric. Of particular interest are the properties of images formed from the light of S stars orbiting in the galactic center. This paper will review some of the attempts made to study extreme lensing as well as extend the analysis of S star lensing. In particular, we are interested in the effect of a Reissner-Nordstrom like 1/r 2 term in the metric and how this would affect the properties of relativistic images.
Rolffs, R.; Schilke, P.; Comito, C.; Bergin, E. A.; van der Tak, F. F. S.; Lis, D. C.; Qin, S.-L.; Menten, K. M.; Guesten, R.; Bell, T. A.; Blake, G.A.; Caux, E.; Ceccarelli, C.; Cernicharo, J.; Crockett, N. R.; Daniel, F.; Dubernet, M. -L.; Emprechtinger, M.; Encrenaz, P.; Gerin, M.; Giesen, T. F.; Goicoechea, J. R.; Goldsmith, P. F.; Gupta, H.; Herbst, E.; Joblin, C.; Johnstone, D.; Langer, W. D.; Latter, W. D.; Lord, S. D.; Maret, S.; Martin, P. G.; Melnick, G. J.; Morris, P.; Mueller, H. S. P.; Murphy, J. A.; Ossenkopf, V.; Pearson, J. C.; Perault, M.; Phillips, T. G.; Plume, R.; Schlemmer, S.; Stutzki, J.; Trappe, N.; Vastel, C.; Wang, S.; Yorke, H. W.; Yu, S.; Zmuidzinas, J.; Diez-Gonzalez, M. C.; Bachiller, R.; Martin-Pintado, J.; Baechtold, W.; Olberg, M.; Nordh, L. H.; Gill, J. J.; Chattopadhyay, G.
2010-01-01
Aims. To investigate the accretion and feedback processes in massive star formation, we analyze the shapes of emission lines from hot molecular cores, whose asymmetries trace infall and expansion motions. Methods. The high-mass star forming region SgrB2(M) was observed with Herschel/HIFI (HEXOS key
Polarimetry, photometry and spectroscopy of the intermediate polar V1223 Sgr
Energy Technology Data Exchange (ETDEWEB)
Watts, D J; Giles, A B; Greenhill, J G; Hill, K [Tasmania Univ., Sandy Bay (Australia). Dept. of Physics; Bailey, J [Anglo-Australian Observatory, Epping (Australia)
1985-07-01
Optical and IR polarization studies of the intermediate polar V1223 Sgr are reported. The optical and IR light curves have assisted in the determination of the photometric period of 0.14 day. The IR flux of the 794-s pulsations is consistent with X-ray heating of a cool atmosphere. The white-dwarf spin period of 746s was not detected. The IR data are consistent with the published fit of a steady state optically thick disc model to the optical and UV continua. No IR excess from the secondary is apparent. High-dispersion spectroscopic observations over half the orbital period show a small radial velocity change accompanied by complex line profile changes. The low mass function implies a low inclination for a main-sequence companion.
High-Resolution Spectroscopy of the Hydrogen-Deficient Binary υ Sgr
Directory of Open Access Journals (Sweden)
Kipper Tõnu
2012-09-01
Full Text Available The high resolution spectra of hydrogen-deficient binary υ Sgr are analyzed. The atmospheric parameters are Teff = 12300±200 K, log g = 2:5±0:5 and ξt = 5 - 15 kms−1 depending on the element. For Fe II ξt = 9:3 ± 0:3 kms−1. Iron is slightly underabundant (-0.2 dex. Nitrogen is overabundant with [N/Fe]ͬ ≈ 1.0, carbon and oxygen are underabundant with [C/Fe] ≈ -1.6 and [O/Fe] ≈ -1.1. The s-process elements Y, Zr and Ba are overabundant about 0.5 dex. Quite large number of emission lines, both permitted and forbidden, originating from low excitation levels of neutral and ionized metals, are identified. Radial velocities of these emission lines indicate that an accretion disk in the system is present.
Broadband Spectral Investigations of Magnetar Bursts
Kırmızıbayrak, Demet; Şaşmaz Muş, Sinem; Kaneko, Yuki; Göğüş, Ersin
2017-09-01
We present our broadband (2-250 keV) time-averaged spectral analysis of 388 bursts from SGR J1550-5418, SGR 1900+14, and SGR 1806-20 detected with the Rossi X-ray Timing Explorer (RXTE) here and as a database in a companion web-catalog. We find that two blackbody functions (BB+BB), the sum of two modified blackbody functions (LB+LB), the sum of a blackbody function and a power-law function (BB+PO), and a power law with a high-energy exponential cutoff (COMPT) all provide acceptable fits at similar levels. We performed numerical simulations to constrain the best fitting model for each burst spectrum and found that 67.6% of burst spectra with well-constrained parameters are better described by the Comptonized model. We also found that 64.7% of these burst spectra are better described with the LB+LB model, which is employed in the spectral analysis of a soft gamma repeater (SGR) for the first time here, than with the BB+BB and BB+PO models. We found a significant positive lower bound trend on photon index, suggesting a decreasing upper bound on hardness, with respect to total flux and fluence. We compare this result with bursts observed from SGR and AXP (anomalous X-ray pulsar) sources and suggest that the relationship is a distinctive characteristic between the two. We confirm a significant anticorrelation between burst emission area and blackbody temperature, and find that it varies between the hot and cool blackbody temperatures differently than previously discussed. We expand on the interpretation of our results in the framework of a strongly magnetized neutron star.
Broadband Spectral Investigations of Magnetar Bursts
Energy Technology Data Exchange (ETDEWEB)
Kırmızıbayrak, Demet; Şaşmaz Muş, Sinem; Kaneko, Yuki; Göğüş, Ersin, E-mail: demetk@sabanciuniv.edu [Faculty of Engineering and Natural Sciences, Sabancı University, Orhanlı Tuzla, Istanbul 34956 (Turkey)
2017-09-01
We present our broadband (2–250 keV) time-averaged spectral analysis of 388 bursts from SGR J1550−5418, SGR 1900+14, and SGR 1806−20 detected with the Rossi X-ray Timing Explorer ( RXTE ) here and as a database in a companion web-catalog. We find that two blackbody functions (BB+BB), the sum of two modified blackbody functions (LB+LB), the sum of a blackbody function and a power-law function (BB+PO), and a power law with a high-energy exponential cutoff (COMPT) all provide acceptable fits at similar levels. We performed numerical simulations to constrain the best fitting model for each burst spectrum and found that 67.6% of burst spectra with well-constrained parameters are better described by the Comptonized model. We also found that 64.7% of these burst spectra are better described with the LB+LB model, which is employed in the spectral analysis of a soft gamma repeater (SGR) for the first time here, than with the BB+BB and BB+PO models. We found a significant positive lower bound trend on photon index, suggesting a decreasing upper bound on hardness, with respect to total flux and fluence. We compare this result with bursts observed from SGR and AXP (anomalous X-ray pulsar) sources and suggest that the relationship is a distinctive characteristic between the two. We confirm a significant anticorrelation between burst emission area and blackbody temperature, and find that it varies between the hot and cool blackbody temperatures differently than previously discussed. We expand on the interpretation of our results in the framework of a strongly magnetized neutron star.
Evolution of Supernova Remnants Near the Galactic Center
Energy Technology Data Exchange (ETDEWEB)
Yalinewich, A.; Piran, T.; Sari, R. [Racah Institute of Physics, the Hebrew University, 91904, Jerusalem (Israel)
2017-03-20
Supernovae near the Galactic center (GC) evolve differently from regular Galactic supernovae. This is mainly due to the environment into which the supernova remnants (SNRs) propagate. SNRs near the GC propagate into a wind swept environment with a velocity directed away from the GC, and a graded density profile. This causes these SNRs to be non-spherical, and to evolve faster than their Galactic counterparts. We develop an analytic theory for the evolution of explosions within a stellar wind, and verify it using a hydrodynamic code. We show that such explosions can evolve in one of three possible morphologies. Using these results we discuss the association between the two SNRs (SGR East and SGR A’s bipolar radio/X-ray lobes) and the two neutron stars (the Cannonball and SGR J1745-2900) near the GC. We show that, given the morphologies of the SNR and positions of the neutron stars, the only possible association is between SGR A’s bipolar radio/X-ray lobes and SGR J1745-2900. If a compact object was created in the explosion of SGR East, it remains undetected, and the SNR of the supernova that created the Cannonball has already disappeared.
Directory of Open Access Journals (Sweden)
Jason Gibbs
2012-11-01
Full Text Available Capalictus, a new subgenus of Lasioglossum Curtis, 1833 (Hymenoptera, Apoidea, Halic-tidae, endemic to the South African Cape Province, is described. The type species is Halictus mosselinus Cockerell, 1945. Evylaeus (Sellalictus fynbosensis (Pauly et al., 2008 is a new junior synonym of L. (C. mosselinum. Three new species are described: Lasioglossum (Capalictus hantamense sp. nov., L. (C. tigrinum sp. nov. and L. (C. timmermanni sp. nov. DNA sequence data from three nuclear genes support morphologically-determined species limits. Capalictus is a basal clade of the Hemihalictus series of Lasioglossum.
Reference: 408 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available o T et al. 2006 Aug. Plant J. 47(4):619-28. Plants can sense the direction of gravity and change the growth ...orientation of their organs. To elucidate the molecular mechanisms of gravity perception and the signal tran...SGR5 promoter revealed that SGR5 is mainly expressed in the endodermis, the gravity-sensing tissue in inflor...f SGR5 using the SCR promoter in the sgr5-1 mutant restores shoot gravitropism indicates that it could function in the gravity...st all amyloplasts in the endodermal cells of the sgr5-1 mutant sedimented in the direction of gravity. Take
Development of Repeated Sprint Ability in Talented Youth Basketball Players
te Wierike, Sanne C. M.; de Jong, Mark C.; Tromp, Eveline J. Y.; Vuijk, Pieter J.; Lemmink, Koen A. P. M.; Malina, Robert M.; Elferink-Gemser, Marije T.; Visscher, Chris
te Wierike, SCM, de Jong, MC, Tromp, EJY, Vuijk, PJ, Lemmink, KAPM, Malina, RM, Elferink-Gemser, MT, and Visscher, C. Development of repeated sprint ability in talented youth basketball players. J Strength Cond Res 28(4): 928-934, 2014-Factors affecting repeated sprint ability (RSA) were evaluated
Massive binaries in the vicinity of Sgr A*
Energy Technology Data Exchange (ETDEWEB)
Pfuhl, O.; Gillessen, S.; Genzel, R.; Eisenhauer, F.; Fritz, T. K.; Ott, T. [Max-Planck-Institut für Extraterrestrische Physik, D-85748 Garching (Germany); Alexander, T. [Faculty of Physics, Weizmann Institute of Science, P.O. Box 26, Rehovot 76100 (Israel); Martins, F., E-mail: pfuhl@mpe.mpg.de [LUPM, Université Montpelier 2, CNRS, Place Eugéne Bataillon, F-34095, Montpellier (France)
2014-02-20
A long-term spectroscopic and photometric survey of the most luminous and massive stars in the vicinity of the supermassive black hole Sgr A* revealed two new binaries: a long-period Ofpe/WN9 binary, IRS 16NE, with a modest eccentricity of 0.3 and a period of 224 days, and an eclipsing Wolf-Rayet binary with a period of 2.3 days. Together with the already identified binary IRS 16SW, there are now three confirmed OB/WR binaries in the inner 0.2 pc of the Galactic center. Using radial velocity change upper limits, we were able to constrain the spectroscopic binary fraction in the Galactic center to F{sub SB}=0.30{sub −0.21}{sup +0.34} at a confidence level of 95%, a massive binary fraction close to that observed in dense clusters. The fraction of eclipsing binaries with photometric amplitudes Δm > 0.4 is F{sub EB}{sup GC}=3%±2%, which is consistent with local OB star clusters (F {sub EB} = 1%). Overall, the Galactic center binary fraction seems to be similar to the binary fraction in comparable young clusters.
Coordinated hybrid automatic repeat request
Makki, Behrooz
2014-11-01
We develop a coordinated hybrid automatic repeat request (HARQ) approach. With the proposed scheme, if a user message is correctly decoded in the first HARQ rounds, its spectrum is allocated to other users, to improve the network outage probability and the users\\' fairness. The results, which are obtained for single- and multiple-antenna setups, demonstrate the efficiency of the proposed approach in different conditions. For instance, with a maximum of M retransmissions and single transmit/receive antennas, the diversity gain of a user increases from M to (J+1)(M-1)+1 where J is the number of users helping that user.
Directory of Open Access Journals (Sweden)
Flávia Rabelo Barbosa
1999-10-01
Full Text Available Arcelin is a seed protein found in wild beans (Phaseolus vulgaris which gives resistance to Mexican bean weevil, Zabrotes subfasciatus (Boheman 1833 (Coleoptera: Bruchidae. Studies were carried out with the objective of estimating the effect of four alleles of protein arcelin (Arc1, Arc2, Arc3 and Arc4 on the biology of Z. subfasciatus. The experiment was carried out in laboratory at Embrapa-Centro Nacional de Pesquisa de Arroz e Feijão, in Santo Antônio de Goiás, GO, Brazil, under non controlled conditions. The highest levels of antibiosis to Z. subfasciatus were observed in Arc1, with reduction in the number of eggs, number of emerged adults, adults longevity. In the line Arc2 only reduction in the number of emerged adults was observed. The lines Arc3 and Arc4 showed low efficiency on the reduction of progeny of Z. subfasciatus and effects in the longevity and egg-adult cycle were not detected. Insect sexual ratio was not altered by the presence of Arc1, Arc2, Arc3 and Arc4 in the seeds.A arcelina é uma proteína encontrada em feijões silvestres (Phaseolus vulgaris e que confere resistência ao caruncho-do-feijão, Zabrotes subfasciatus (Boheman 1833 (Coleoptera: Bruchidae. Estudos foram conduzidos com o objetivo de conhecer o efeito de quatro alelos da proteína arcelina (Arc1, Arc2, Arc3 e Arc4, na biologia de Z. subfasciatus. O experimento foi conduzido no laboratório da Embrapa-Centro Nacional de Pesquisa de Arroz e Feijão, no município de Santo Antônio de Goiás, GO, em condições não controladas. O mais alto nível de antibiose a Z. subfasciatus foi constatado na linhagem portadora do alelo Arc1, observando-se redução do número de ovos produzidos, redução do número de adultos emergidos, redução da longevidade de adultos. Na linhagem Arc2 constatou-se redução apenas no número de adultos emergidos. As linhagens Arc3 e Arc4 apresentaram baixa eficiência na redução da progênie de Z. subfasciatus, não observando
A systematic catalogue of the Coleopterous family Helotidae in the Leiden Museum
Ritsema, C.
1915-01-01
Gen. HELOTA Mc L.1) Mc Leay, Annulosa Javanica, 1825, p. 42; ed. Lequien, 1833, p. 151. INDOMALAYAN SPECIES. (Nos. 1—69). 1. Vigorsi Mc L. Annul. Javan. 1825, p. 43, tab. 1, fig. 9; ed. Lequien, 1833, p. 152, tab. 5, fig. 4. a. ♀. Java or.: Mt. Ardjoeno (W. E. J. Hekmeyer). b. ♀. Java (A. B. v.
Directory of Open Access Journals (Sweden)
L. Lebedeva
2012-12-01
Full Text Available Biological peculiarities of the rye scald fungus Rhynchosporium secalis (Oud. J. J. Davis, in one population of North-West region were examined. Seventy-eight isolates, the causal agent of scald, were taken from infected rye plants. This isolates were analalysed on rate of growth on artificial test medium, structure and color and temperature dependence. Single-spore strains were obtained from each natural isolate. Color and structure of some single-spore isolates remained stable through repeated transfers to fresh PDA medium.
Statistics of Magnetar Crusts Magnetoemission
Directory of Open Access Journals (Sweden)
Kondratyev V. N.
2016-01-01
Full Text Available Soft repeating gamma-ray (SGR bursts are considered as magnetoemission of crusts of magnetars (ultranamagnetized neutron stars. It is shown that all the SGR burst observations can be described and systematized within randomly jumping interacting moments model including quantum fluctuations and internuclear magnetic interaction in an inhomogeneous crusty nuclear matter.
Energy Technology Data Exchange (ETDEWEB)
Psaltis, Dimitrios [Astronomy Department, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Wex, Norbert; Kramer, Michael [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121, Bonn (Germany)
2016-02-20
The black hole in the center of the Milky Way, Sgr A*, has the largest mass-to-distance ratio among all known black holes in the universe. This property makes Sgr A* the optimal target for testing the gravitational no-hair theorem. In the near future, major developments in instrumentation will provide the tools for high-precision studies of its spacetime via observations of relativistic effects in stellar orbits, in the timing of pulsars, and in horizon-scale images of its accretion flow. We explore here the prospect of measuring the properties of the black hole spacetime using all of these three types of observations. We show that the correlated uncertainties in the measurements of the black hole spin and quadrupole moment using the orbits of stars and pulsars are nearly orthogonal to those obtained from measuring the shape and size of the shadow the black hole casts on the surrounding emission. Combining these three types of observations will therefore allow us to assess and quantify systematic biases and uncertainties in each measurement and lead to a highly accurate, quantitative test of the gravitational no-hair theorem.
The Giant Flare From SGR 1806-20 And Its Radio Afterglow
Energy Technology Data Exchange (ETDEWEB)
Taylor, G.B.; /New Mexico U. /NRAO, Socorro; Granot, J.; /KIPAC, Menlo Park
2006-09-26
The multi-wavelength observations of the 2004 December 27 Giant Flare (GF) from SGR 1806-20 and its long-lived radio afterglow are briefly reviewed. The GF appears to have been produced by a dramatic reconfiguration of the magnetic field near the surface of the neutron star, possibly accompanied by fractures in the crust. The explosive release of over 10{sup 46} erg (isotropic equivalent) powered a one-sided mildly relativistic outflow. The outflow produced a new expanding radio nebula, that is still visible over a year after the GF. Also considered are the constraints on the total energy in the GF, the energy and mass in the outflow, and on the external density, as well as possible implications for short {gamma}-ray bursts and potential signatures in high energy neutrinos, photons, or cosmic rays. Some possible future observations of this and other GFs are briefly discussed.
Lunar occultation observation of μ Sgr: A progress report
Energy Technology Data Exchange (ETDEWEB)
Jatmiko, A. T. P. [Bosscha Observatory, Institut Teknologi Bandung (Indonesia); Puannandra, G. P.; Hapsari, R. D.; Putri, R. A.; Arifin, Z. M.; Haans, G. K.; Hadiputrawan, I. P. W. [Bosscha Observatory, Institut Teknologi Bandung, Indonesia and Astronomy Study Program, Institut Teknologi Bandung (Indonesia)
2014-03-24
Lunar Occultation (LO) is an event where limb of the Moon passing over a particular heavenly bodies such as stars, asteroids, or planets. In other words, during the event, stars, asteroids and planets are occulted by the Moon. When occulted objects contact the lunar limb, there will be a diffraction fringe(s) which can be measured photometrically, until the signal vanishes into noise. This event will give us a valuable information about binarities (of stars) and/or angular diameters estimation (of stars, planets, asteroids) in milliarcsecond resolution, by fitting with theoretical LO pattern. CCDs are common for LO observation because of its fast read out, and recently are developed for sub-meter class telescope. In this paper, our LO observation attempt of μ Sgr and its progress report are presented. The observation was conducted on July 30{sup th}, 2012 at Bosscha Observatory, Indonesia, using 45cm f/12 GOTO telescope combined with ST-9 XE CCD camera and Bessel B filter. We used drift-scan method to obtain light curve of the star as it was disappearing behind Moon's dark limb. Our goal is to detect binarity (or multiplicity) of this particular object.
Energy Technology Data Exchange (ETDEWEB)
Gold, Roman; McKinney, Jonathan C. [Department of Physics and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States); Johnson, Michael D.; Doeleman, Sheperd S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)
2017-03-10
Magnetic fields are believed to drive accretion and relativistic jets in black hole accretion systems, but the magnetic field structure that controls these phenomena remains uncertain. We perform general relativistic (GR) polarized radiative transfer of time-dependent three-dimensional GR magnetohydrodynamical simulations to model thermal synchrotron emission from the Galactic Center source Sagittarius A* (Sgr A*). We compare our results to new polarimetry measurements by the Event Horizon Telescope (EHT) and show how polarization in the visibility (Fourier) domain distinguishes and constrains accretion flow models with different magnetic field structures. These include models with small-scale fields in disks driven by the magnetorotational instability as well as models with large-scale ordered fields in magnetically arrested disks. We also consider different electron temperature and jet mass-loading prescriptions that control the brightness of the disk, funnel-wall jet, and Blandford–Znajek-driven funnel jet. Our comparisons between the simulations and observations favor models with ordered magnetic fields near the black hole event horizon in Sgr A*, though both disk- and jet-dominated emission can satisfactorily explain most of the current EHT data. We also discuss how the black hole shadow can be filled-in by jet emission or mimicked by the absence of funnel jet emission. We show that stronger model constraints should be possible with upcoming circular polarization and higher frequency (349 GHz) measurements.
Energy Technology Data Exchange (ETDEWEB)
Meyer, L.; Witzel, G.; Ghez, A. M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095-1547 (United States); Longstaff, F. A. [UCLA Anderson School of Management, University of California, Los Angeles, CA 90095-1481 (United States)
2014-08-10
Continuously time variable sources are often characterized by their power spectral density and flux distribution. These quantities can undergo dramatic changes over time if the underlying physical processes change. However, some changes can be subtle and not distinguishable using standard statistical approaches. Here, we report a methodology that aims to identify distinct but similar states of time variability. We apply this method to the Galactic supermassive black hole, where 2.2 μm flux is observed from a source associated with Sgr A* and where two distinct states have recently been suggested. Our approach is taken from mathematical finance and works with conditional flux density distributions that depend on the previous flux value. The discrete, unobserved (hidden) state variable is modeled as a stochastic process and the transition probabilities are inferred from the flux density time series. Using the most comprehensive data set to date, in which all Keck and a majority of the publicly available Very Large Telescope data have been merged, we show that Sgr A* is sufficiently described by a single intrinsic state. However, the observed flux densities exhibit two states: noise dominated and source dominated. Our methodology reported here will prove extremely useful to assess the effects of the putative gas cloud G2 that is on its way toward the black hole and might create a new state of variability.
Rings of Molecular Line Emission in the Disk Orbiting the Young, Close Binary V4046 Sgr
Dickson-Vandervelde, Dorothy; Kastner, Joel H.; Qi, C.; Forveille, Thierry; Hily-Blant, Pierre; Oberg, Karin; Wilner, David; Andrews, Sean; Gorti, Uma; Rapson, Valerie; Sacco, Germano; Principe, David
2018-01-01
We present analysis of a suite of subarcsecond ALMA Band 6 (1.1 - 1.4 mm) molecular line images of the circumbinary, protoplanetary disk orbiting V4046 Sgr. The ~20 Myr-old V4046 Sgr system, which lies a mere ~73 pc from Earth, consists of a close (separation ~10 Rsun) pair of roughly solar-mass stars that are orbited by a gas-rich crcumbinary disk extending to ~350 AU in radius. The ALMA images reveal that the molecules CO and HCN and their isotopologues display centrally peaked surface brightness morphologies, whereas the cyanide group molecules (HC3N, CH3CN), deuterated molecules (DCN, DCO+), hydrocarbons (as traced by C2H), and potential CO ice line tracers (N2H+, and H2CO) appear as a sequence of sharp and diffuse rings of increasing radii. The characteristic sizes of these molecular emission rings, which range from ~25 to >100 AU in radius, are evident in radial emission-line surface brightness profiles extracted from the deprojected disk images. We find that emission from 13CO emission transitions from optically thin to thick within ~50 AU, whereas C18O emission remains optically thin within this radius. We summarize the insight into the physical and chemical processes within this evolved protoplanetary disk that can be obtained from comparisons of the various emission-line morphologies with each other and with that of the continuum (large-grain) emission on size scales of tens of AU.This research is supported by NASA Exoplanets program grant NNX16AB43G to RIT
NSV 11749, AN ELDER SIBLING OF THE BORN-AGAIN STARS V605 Aql AND V4334 Sgr?
Energy Technology Data Exchange (ETDEWEB)
Miller Bertolami, M. M.; Althaus, L. G. [Facultad de Ciencias Astronomicas y Geofisicas, Universidad Nacional de La Plata, Paseo del Bosque s/n, 1900 La Plata (Argentina); Rohrmann, R. D. [Instituto de Ciencias Astronomicas, de la Tierra y del Espacio, CONICET, Av. de Espana 1512 (Sur) CC 49, 5400 San Juan (Argentina); Granada, A., E-mail: mmiller@fcaglp.unlp.edu.ar [Observatoire Astronomique de l' Universite de Geneve 51, Chemin des Maillettes, CH-1290, Sauverny (Switzerland)
2011-12-20
We argue that NSV 11749, an eruption observed in the early twentieth century, was a rare event known as 'very late thermal pulse' (VLTP). To support our argument we compare the light curve of NSV 11749 with those of the two bona fide VLTP objects known to date, V4334 Sgr and V605 Aql, and with those predicted by state-of-the-art stellar evolution models. Next, we explore the INT Photometric H-Alpha Survey (IPHAS) and Two Micron All Sky Survey (2MASS) catalogs for possible counterparts of the eruption. Our analysis shows that the VLTP scenario outperforms all other proposed scenarios as an explanation of NSV 11749. We identify an IPHAS/2MASS source at the eruption location of NSV 11749. The derived colors suggest that the object is not enshrouded in a thick dust shell as V605 Aql and V4334 Sgr. Also, the absence of an apparent planetary nebula at the eruption location suggests differences with known VLTP objects which might be linked to the intensity of the eruption and the mass of the object. Further exploration of this source and scenario seems desirable. If NSV 11749 was a born-again star, it would be the third event of its kind to have been observed and will strongly help us to increase our understanding of the later stages of stellar evolution and violent reactive convective burning.
NSV 11749, AN ELDER SIBLING OF THE BORN-AGAIN STARS V605 Aql AND V4334 Sgr?
International Nuclear Information System (INIS)
Miller Bertolami, M. M.; Althaus, L. G.; Rohrmann, R. D.; Granada, A.
2011-01-01
We argue that NSV 11749, an eruption observed in the early twentieth century, was a rare event known as 'very late thermal pulse' (VLTP). To support our argument we compare the light curve of NSV 11749 with those of the two bona fide VLTP objects known to date, V4334 Sgr and V605 Aql, and with those predicted by state-of-the-art stellar evolution models. Next, we explore the INT Photometric H-Alpha Survey (IPHAS) and Two Micron All Sky Survey (2MASS) catalogs for possible counterparts of the eruption. Our analysis shows that the VLTP scenario outperforms all other proposed scenarios as an explanation of NSV 11749. We identify an IPHAS/2MASS source at the eruption location of NSV 11749. The derived colors suggest that the object is not enshrouded in a thick dust shell as V605 Aql and V4334 Sgr. Also, the absence of an apparent planetary nebula at the eruption location suggests differences with known VLTP objects which might be linked to the intensity of the eruption and the mass of the object. Further exploration of this source and scenario seems desirable. If NSV 11749 was a born-again star, it would be the third event of its kind to have been observed and will strongly help us to increase our understanding of the later stages of stellar evolution and violent reactive convective burning.
DEFF Research Database (Denmark)
Zhang, Shuo; Hailey, Charles J.; Baganoff, Frederick K.
2014-01-01
of 8.0 kpc. Based on theoretical predictions and observations, we conclude that Sgr A–E is unlikely to be a pulsar wind nebula (PWN) or supernova remnant-molecular cloud (SNR-MC) interaction, as previously hypothesized. Instead, the emission could be due to a magnetic flux tube which traps Te...
Magnetars: Challenging the Extremes of Nature
Kouveliotou, Chryssa
2011-01-01
Magnetars are magnetically powered rotating neutron stars with extreme magnetic fields (over 10(exp 14) Gauss). They are discovered and emit predominantly in the X- and gamma-rays. Very few sources (roughly 15) have been found since their discovery in 1987. NASA s Fermi Observatory was launched June 11, 2009; the Fermi Gamma Ray Burst Monitor (GBM) began normal operations on July 14, about a month after launch, when the trigger algorithms were enabled. Since then, we recorded emission from four magnetar sources; of these, only one was an old magnetar: SGR 1806+20. The other three detections were two brand new sources, SGR J0501+4516, discovered with Swift and extensively monitored with both Swift and GBM, SGR J0418+5729, discovered with GBM and the Interplanetary Network (IPN), and SGR J1550-5418, a source originally classified as an Anomalous X-ray Pulsar (AXP 1E1547.0-5408). In my talk I will give a short history of the discovery of magnetars and describe how this, once relatively esoteric field, has emerged as a link between several astrophysical areas including Gamma-Ray Bursts. Finally, I will describe the properties of these sources and the current status of our knowledge of the magnetar population and birth rate.
High Resolution Optical Spectroscopy of the Classical Nova V5668 Sgr Showing the Presence of Lithium
Wagner, R. Mark; Woodward, Charles E.; Starrfield, Sumner; Ilyin, Ilya; Strassmeier, Klaus
2018-01-01
The classical nova (CN) V5668 Sgr was discovered on 2015 March 15.634 and initial optical spectra implied it was an Fe II-class CN. We obtained high resolution optical spectroscopy on 30 nights between 2015 April 3 and 2016 June 5 with the 2 x 8.4 m Large Binocular Telescope (LBT) and the 1.8 m Vatican Advanced Technology Telescope (VATT) using the Potsdam Echelle Polarimetric Spectroscopic Instrument (PEPSI). The spectra cover all or part of the 3830-9065 Å spectral region at a spectral resolution of up to 270,000 (1 km/s); the highest resolution currently available on any 8-10 m class telescope. The early spectra are dominated by emission lines of the Balmer and Paschen series of hydrogen, Fe II, Ca II, and Na I with P Cyg-type line profiles as well as emission lines of [O I]. Numerous interstellar lines and bands are readily apparent at high spectral resolution. The permitted line profiles show complex and dramatic variations in the multi-component P Cyg-type line profiles with time. We detect a weak blue-shifted absorption line at a velocity consistent with Li I 6708 Å when compared with the line profiles of Hβ, Fe II 5169 Å, and Na I D. This line is present in spectra obtained on 7 of 8 consecutive nights up to day 21 of the outburst; but absent on day 42 when it is evident that the ionization of the ejecta has significantly increased. The equivalent width of the line converted to a column density, and the resulting mass fraction, imply a significant enrichment of 7Li in the ejecta. 7Li is produced by the decay of unstable 7Be created during the thermonuclear runaway. The discovery of the resonance lines of 7Be II in the optical spectra of the recent CNe V339 Del, V2944 Oph, and V5668 Sgr by Tajitsu et al. (2016) and its subsequent decay to 7Li (half life of 53 days) suggests a significant enrichment of 7Li in the Galaxy from CNe is possible. Our observations of the Li I 6708 Å line in the early optical spectra of V5668 Sgr mark the second direct
Kuan, Yi-Jehng; Snyder, Lewis E.
1994-01-01
We present the first full synthesis maps of the small molecules HNO, CCS, and HC(13)CCN in Sgr B2. We have observed the 3.8 mm continuum, the HNO J(sub K(sub -1)K(sub 1)) = 1(sub O1)-0(sub OO), the CCS J(sub N) = 7(sub 6)-6(sub 5), and the HC(13)CCN J = 9-8 transitions in the core of the Sgr B2 molecular cloud, using the Berkeley Illinois Maryland Association (BIMA) millimeter array and the NRAO 12 m telescope. We have found that HNO exists in five major gas clumps in the Sgr B2 region, which we have labeled HNO(N), HNO(NW), HNO(E), HNO(M), and HNO(S). Of particular interest is HNO(M), a major molecular gas concentration approximately 15 sec west of Sgr B2(M) in a region of young star formation. HNO is found to be closely associated with the ionized gas and might be depleted around bright H II complexes. In general, the peak intensity of the HNO emission is found to be offset from the peak of the continuum emission. We found evidence for some chemical differentiation among the three species, HNO, CCS, and HC(13)CCN, but the abundance ratios are in fair agreement with theoretical models. Two unidentified lines, U81420 and U81518, were observed, and a previously unknown compact dust source was detected. Our HNO data indicate the presence of a rotating approximately (2.2-4.4) x 10(exp 3)solar mass gas envelope surrounding Sgr B2(N), a possible bipolar gas outflow in HNO(M), and possibly a large (approximately 4.2 x 10(exp 4)solar mass) extended rotating disk associated with HNO(S). In addition, the CCS and HC(13)CCN data approximately outline the extended component of Sgr B2 and clearly show that the southern continuum source Sgr B2(S) is actually a major molecular source as well. Consequently, the kinematics of the Sgr B2 molecular cloud is quite complex, but in moving from the northwest to south, the LSR velocity generally changes from 79 to 46 km/s.
Expected satiation after repeated consumption of low- or high-energy-dense soup
Hogenkamp, P.S.; Brunstrom, J.M.; Stafleu, A.; Mars, M.; Graaf, de C.
2012-01-01
We investigated whether repeated consumption of a low-energy-dense (LED; 208 kJ/100 g) or high-energy-dense (HED; 645 kJ/100 g) soup modifies expectations relating to the satiating capacity of the food, and its subsequent intake. In study 1, participants consumed either a novel-flavoured LED (n 32;
Expected satiation after repeated consumption of low-or high-energy-dense soup
Hogenkamp, P.S.; Brunstrom, J.M.; Stafleu, A.; Mars, M.; Graaf, C. de
2012-01-01
We investigated whether repeated consumption of a low-energy-dense (LED; 208 kJ/100 g) or high-energy-dense (HED; 645 kJ/100 g) soup modifies expectations relating to the satiating capacity of the food, and its subsequent intake. In study 1, participants consumed either a novel-flavoured LED (n 32;
Directory of Open Access Journals (Sweden)
Sha-Sha Yu
2017-11-01
Full Text Available AIM: To determine the repeatability of Ophtha Top topography and assess the consistency with intraocular lens (IOL-Master and LenstarLS900 (Lenstar in measuring corneal parameters among cataract patients. METHODS: Totally 125 eyes were enrolled. Corneas were successively measured with Ophtha Top, IOL-Master and Lenstar at least three times. The flattest meridian power (Kf, the steepest meridian power (Ks, mean power (Km, J0 and J45 were recorded. Intra-class correlation coefficients (ICCs, the coefficient of variance (COV, within subject standard deviation (Sw, and test-retest repeatability (2.77Sw were adopted to determine the repeatability. The 95% limit of agreement (95%LOA and Bland-Altman plots were used to assess comparability. RESULTS: Repeatability of Ophtha Top topography for measuring corneal parameters showed the ICCs were all above 0.93, 2.77Sw was lower than 0.31, and the COV of the Kf and Ks was lower than 0.25. The keratometric readings with Ophtha Top topography were flatter than with the IOL-Master and Lenstar devices, while the Pearson correlation coefficients were over 0.97. The J0 and J45 with Ophtha Top topography were smaller compared with Lenstar and IOL-Master, while was comparable between Lenstar and IOL-Master. CONCLUSION: Ophtha Top topography shows excellent repeatability for measuring corneal parameters. However, differences between the Ophtha TOP topography and Lenstar, IOL-Master both in cornea curvature and the astigmatism should be noted clinically.
NEAR-INFRARED AND X-RAY QUASI-PERIODIC OSCILLATIONS IN NUMERICAL MODELS OF Sgr A*
International Nuclear Information System (INIS)
Dolence, Joshua C.; Gammie, Charles F.; Shiokawa, Hotaka; Noble, Scott C.
2012-01-01
We report transient quasi-periodic oscillations (QPOs) on minute timescales in relativistic, radiative models of the galactic center source Sgr A*. The QPOs result from nonaxisymmetric m = 1 structure in the accretion flow excited by MHD turbulence. Near-infrared (NIR) and X-ray power spectra show significant peaks at frequencies comparable to the orbital frequency at the innermost stable circular orbit (ISCO) f o . The excess power is associated with inward propagating magnetic filaments inside the ISCO. The amplitudes of the QPOs are sensitive to the electron distribution function. We argue that transient QPOs appear at a range of frequencies in the neighborhood of f o and that the power spectra, averaged over long times, likely show a broad bump near f o rather than distinct, narrow QPO features.
Muscle Damage and Metabolic Responses to Repeated-Sprint Running With and Without Deceleration.
Minahan, Clare L; Poke, Daniel P; Morrison, Jaime; Bellinger, Phillip M
2018-04-04
Minahan, CL, Poke, DP, Morrison, J, and Bellinger, PM. Muscle damage and metabolic responses to repeated-sprint running with and without deceleration. J Strength Cond Res XX(X): 000-000, 2017-This study aimed to determine whether repeated-sprint running with deceleration aggravates markers of muscle damage or delays the recovery of performance compared with repeated-sprint running without deceleration. Fourteen male team-sport athletes performed 2 randomly ordered testing sessions on a nonmotorized treadmill with one session requiring participants to decelerate (TMd) within 4 seconds before stopping or immediately step to the side of the treadmill belt at the completion of each sprint (TMa). Peak and mean velocities, speed decrement, blood lactate concentrations, and oxygen uptake were monitored during the repeated-sprint running protocols. Countermovement vertical jump (CMJ) performance, perceived muscle soreness, sit-and-reach flexibility, plasma creatine kinase (CK), lactate dehydrogenase (LDH), and myoglobin (Mb) concentrations were quantified immediately before and after and 45 minutes, 24 and 48 hours after repeated-sprint running protocols. Although muscle damage was indicated by increases in CK, LDH, and Mb (p ≤ 0.05) in both groups, there was no significant effect of condition (TMa vs. TMd) on any of the measured performance or physiological variables (p > 0.05). The present study indicated that the removal of deceleration from repeated-sprint running on a nonmotorized treadmill has no effect on metabolism or performance during or after repeated-sprint running or markers of muscle damage.
Directory of Open Access Journals (Sweden)
José Onildo B. Contel
1999-12-01
Full Text Available INTRODUÇÃO: O familiar é a ponte, entre o ambiente da casa do paciente e o ambiente terapêutico do hospital-dia (HD, onde o paciente permanece das 7h30 às 15h30, de segunda a sexta-feira. A complexidade para a integração do exercício dessa tarefa e suas conseqüências para o tratamento em HD, levou-nos a criar a Psicoterapia de Grupo de Apoio multifamiliar (PGA para facilitar o exame das vissicitudes desta via de duas mãos entre a residência e o HD. OBJETIVOS: As características, liderança e fatores terapêuticos de Yalom nessa PGA serão objetos do presente trabalho MÉTODO: A PGA é um grupo aberto com 1 h e 15 minutos de duração, de freqüência semanal e com coordenação, em coterapia, de um psicoterapeuta de grupo e de uma enfermeira psiquiátrica. RESULTADOS E DISCUSSÃO: Os resultados foram obtidos pelo exame de 20 grupos sucessivos, tanto após cada sessão, pelos coterapeutas e observador mudo, durante 20-30 min, como pela análise de conteúdo de 20 sessões transcritas. A presença sempre foi maior que 80% dos familiares esperados, com predomínio de mulheres, especialmente mães de pacientes. A estrutura oferecida pela liderança apressou a obtenção de resultados no curto prazo, entre 4 a 6 sessões. A Coesão Grupal de Yalom apareceu em situações comuns e criou um senso de união entre todos. CONCLUSÃO: A adesão de familiares à PGA facilita e abrevia a terapia em HD. Questiona-se quanto, no futuro, a família orientada assumirá na condução do tratamento dos seus pacientes.INTRODUCTION: The relative is the bridge between the patient's home environment and the therapeutic environment of the day-hospital (DH. The difficulties for the relative to play this task gave birth to the multi-family support group therapy (SGR. To describe the features, leadership and Yalom's therapeutic factors in the SGR is the aim of this paper. METHOD: The SGR is an open group that last for one hour and 15 minutes, meets once weekly
Peniche Moreno, Paola
2016-01-01
This article analyzes the pillars that supported the therapeutic practice in Yucatán to treat cholera patients during the outbreaks preceding the discovery of its bacterial etiology, one in 1833 and another in 1853. Due partly to a significant evolution in scientific and medical ideas, and the dissemination of the principles of positivism, a profound process of transformation was experienced, which brought, among other things, new perceptions of the disease as well as schemes different from t...
Coti Zelati, F.; Rea, N.; Turolla, R.; Pons, J.A.; Papitto, A.; Esposito, P.; Israel, G.L.; Campana, S.; Zane, S.; Tiengo, A.; Mignani, R.P.; Mereghetti, S.; Baganoff, F.K.; Haggard, D.; Ponti, G.; Torres, D.F.; Borghese, A.; Elfritz, J.
2017-01-01
We report on 3.5 yr of Chandra monitoring of the Galactic Centre magnetar SGR J1745−2900 since its outburst onset in 2013 April. The magnetar spin-down has shown at least two episodes of period derivative increases so far, and it has slowed down regularly in the past year or so. We observed a
Intriguing Misalignment Between Radio and Optical Structures in Classical Nova V5668 Sgr
Linford, Justin; Lawrence, Stephen; Chomiuk, Laura; Sokoloski, Jennifer; Nelson, Thomas; Mukai, Koji; Rupen, Michael; Mioduszewski, Amy; van der Horst, Alexander; Kawash, Adam
2018-01-01
The mass-loss and particle acceleration mechanism that drive gamma-ray production in classical novae remain largely unknown, but clues can be found in high spatial resolution images. The nova V5668 Sgr erupted in March of 2015 and was detected by the Fermi Gamma-ray Space Telescope approximately 2 days after its eruption. We obtained high-resolution radio images of the ejecta with the Karl G. Jansky Very Large Array (VLA) in December 2016 and January 2017. The VLA images reveal a bipolar morphology, very similar to that seen in V959 Mon. We obtained images of the ejecta with the Hubble Space Telescope (HST) in July 2017 using two narrow-band filters: F657N H-alpha+[N II] and F502N [O III]. The HST images also show a bipolar structure, but the HST structure is not aligned with the VLA structure. We present preliminary results of this multi-wavelength project.
Kolcsár, Levente-Péter; Török, Edina; Keresztes, Lujza
2015-01-01
Molophilus Curtis, 1833 is the most species-rich Limoniidae genus with a total number of 1006 species and subspecies, from which 97 are recorded in the Western-Palaearctic region so far. However new species are still expected from less investigated regions, like the Balkans or the Eastern Europe. In the present article, we desrcibe a new limonid crane fly species, Molophilus balcanicus Kolcsár sp. n. from the Central Balkan area (Bulgaria). This new taxa is closely related to M. serpentiger Edwards, 1938 and M. variispinus Starý, 1971 based on the external male genital structures, but differs from its siblings mostly in the structure of the inner and outer gonostylus. Additionally, a number of species are reported for the first time from various European countries, like M. variispinus Starý, 1971 and M. occultus de Meijere, 1918 from Romania; M. crassipygus de Meijere 1918, M. obsoletus Lackschewitz, 1940 and M. medius de Meijere, 1918 from Greece; M. flavus Goetghebuer, 1920 from Andorra; M. cinereifrons de Meijere, 1920 from Bulgaria and M. corniger Meijere, 1920 from Spain.
RADIATIVE MODELS OF SGR A* FROM GRMHD SIMULATIONS
International Nuclear Information System (INIS)
Moscibrodzka, Monika; Gammie, Charles F.; Dolence, Joshua C.; Shiokawa, Hotaka; Leung, Po Kin
2009-01-01
Using flow models based on axisymmetric general relativistic magnetohydrodynamics simulations, we construct radiative models for Sgr A*. Spectral energy distributions (SEDs) that include the effects of thermal synchrotron emission and absorption, and Compton scattering, are calculated using a Monte Carlo technique. Images are calculated using a ray-tracing scheme. All models are scaled so that the 230 GHz flux density is 3.4 Jy. The key model parameters are the dimensionless black hole spin a * , the inclination i, and the ion-to-electron temperature ratio T i /T e . We find that (1) models with T i /T e = 1 are inconsistent with the observed submillimeter spectral slope; (2) the X-ray flux is a strongly increasing function of a * ; (3) the X-ray flux is a strongly increasing function of i; (4) 230 GHz image size is a complicated function of i, a * , and T i /T e , but the T i /T e = 10 models are generally large and at most marginally consistent with the 230 GHz very long baseline interferometry (VLBI) data; (5) for models with T i /T e = 10 and i = 85 deg. the event horizon is cloaked behind a synchrotron photosphere at 230 GHz and will not be seen by VLBI, but these models overproduce near-infrared and X-ray flux; (6) in all models whose SEDs are consistent with observations, the event horizon is uncloaked at 230 GHz; (7) the models that are most consistent with the observations have a * ∼ 0.9. We finish with a discussion of the limitations of our model and prospects for future improvements.
Directory of Open Access Journals (Sweden)
Eliane Divina de Tolêdo Souza
2007-09-01
Full Text Available
Arcelin is a seed protein only found in wild beans which gives resistance to bean weevil (Zabrotes subfasciatus Bohemann, 1833. In this study the non preference for oviposition and feeding of the bean weevil was evaluated on a series of near isogenic bean lines: Arc 1, Arc 2, Arc 3 and Arc 4. The bean cultivars Porrillo 70 and Goiano Precoce were utilized as susceptible checks. There wasn’t oviposition preference among the six genotypes studied. The near isogenic lines that contain Arcelin 1 and Arcelin 2 were the last in preference for feeding.
KEY-WORDS: Resistance; non preference.
A arcelina é uma proteína encontrada somente em feijões silvestres e é o fator que confere resistência ao caruncho Zabrotes subfasciatus (Bohemann, 1833. Procurou-se verificar a não-preferência para oviposição e alimentação de Z. subfasciatus em uma série de linhagens de feijão quase isogênicas contendo diferentes alelos de arcelina: Arc 1, Arc 2, Arc 3 e Arc 4. Os controles suscetíveis utilizados foram Porrillo 70 e Goiano Precoce. Não houve preferência para oviposição entre os seis genótipos estudados. As linhagens quase isogênicas contendo Arcelina 1 e Arcelina 2 foram as menos preferidas para alimentação.
PALAVRAS-CHAVE: Resistência; Phaseolus; Zabrotes; não-preferência.
Further observations of GRO J1750-27 (AXJ1749.1-2639) with INTEGRAL
DEFF Research Database (Denmark)
Brandt, Søren Kristian; Shaw, S.; Hill, A.
2008-01-01
The transient accreting X-ray pulsar GRO J1750-27 (AX J1749.1-2639), which became active end of January 2008 (ATel #1376), has been repeatedly observed by the INTEGRAL Galactic Bulge monitoring program since mid February (ATel #1385) on 11, 20 and 23 Feb. 2008. During the three observations...
Radio emission from Sgr A*: pulsar transits through the accretion disc
Christie, I. M.; Petropoulou, M.; Mimica, P.; Giannios, D.
2017-06-01
Radiatively inefficient accretion flow models have been shown to accurately account for the spectrum and luminosity observed from Sgr A* in the X-ray regime down to mm wavelengths. However, observations at a few GHz cannot be explained by thermal electrons alone but require the presence of an additional non-thermal particle population. Here, we propose a model for the origin of such a population in the accretion flow via means of a pulsar orbiting the supermassive black hole in our Galaxy. Interactions between the relativistic pulsar wind with the disc lead to the formation of a bow shock in the wind. During the pulsar's transit through the accretion disc, relativistic pairs, accelerated at the shock front, are injected into the disc. The radio-emitting particles are long lived and remain within the disc long after the pulsar's transit. Periodic pulsar transits through the disc result in regular injection episodes of non-thermal particles. We show that for a pulsar with spin-down luminosity Lsd ˜ 3 × 1035 erg s-1 and a wind Lorentz factor of γw ˜ 104 a quasi-steady synchrotron emission is established with luminosities in the 1-10 GHz range comparable to the observed one.
On the improvement of signal repeatability in laser-induced air plasmas
Zhang, Shuai; Sheta, Sahar; Hou, Zong-Yu; Wang, Zhe
2018-04-01
The relatively low repeatability of laser-induced breakdown spectroscopy (LIBS) severely hinders its wide commercialization. In the present work, we investigate the optimization of LIBS system for repeatability improvement for both signal generation (plasma evolution) and signal collection. Timeintegrated spectra and images were obtained under different laser energies and focal lengths to investigate the optimum configuration for stable plasmas and repeatable signals. Using our experimental setup, the optimum conditions were found to be a laser energy of 250 mJ and a focus length of 100 mm. A stable and homogeneous plasma with the largest hot core area in the optimum condition yielded the most stable LIBS signal. Time-resolved images showed that the rebounding processes through the air plasma evolution caused the relative standard deviation (RSD) to increase with laser energies of > 250 mJ. In addition, the emission collection was improved by using a concave spherical mirror. The line intensities doubled as their RSDs decreased by approximately 25%. When the signal generation and collection were optimized simultaneously, the pulse-to-pulse RSDs were reduced to approximately 3% for O(I), N(I), and H(I) lines, which are better than the RSDs reported for solid samples and showed great potential for LIBS quantitative analysis by gasifying the solid or liquid samples.
International Nuclear Information System (INIS)
Domarco, R.E.
1981-01-01
The study was done in the laboratory of Entomology of the Centro de Energia Nuclear na Agricultura (CENA), University of Sao Paulo, in Piracicaba, State of Sao Paulo, Brazil. This research was carried out to observe the effect of irradiated beans (Phaseolus vulgaris, (L.), cultivar Rosinha) on the longevity and prolificity of Zabrotes subfasciatus (Boheman, 1833) (Coleoptera, Bruchidae). The first part of the study included the rearing of five generations of Zabrotes subfasciatus which were fed with irradiated beans (0, 10, 20, 100 e 200 krad, with a dose rate of approximately 70 krad/h). The second one consisted of growth of seven generations on irradiated beans (0, 100, 500, 1500 and 3000 krad, with a dose rate of approximately 70 krad/h). The data were obtained through daily countings of insect birth and death rates. It was concluded that irradiation modified the nutritional quality of beans, affecting the development of Zabrotes subfasciatus. This effect was studied through the longevity and prolificity, which were altered as compared with the control, once they were higher for the dosis of 1500 and 3000 krad. (author)
Cejka, Cestmír; Ardan, Taras; Sirc, Jakub; Michálek, Jiří; Beneš, Jiří; Brůnová, Blanka; Rosina, Jozef
2011-07-01
Exposure of the cornea to UV radiation from sunlight evokes intraocular inflammation, photokeratitis. Photokeratitis is caused by UVB radiation. It is accompanied by changes of corneal hydration and light absorption. The aim of this study was to examine the effect of two UVB doses on corneal optics in rabbits and to compare these UVB doses with the equivalent exposure of UVB radiation reaching the human cornea from sunlight. Rabbit corneas were irradiated with a daily UVB dose of 0.25 J/cm(2) or 0.5 J/cm(2) for 4 days. One day after finishing the irradiations the rabbits were sacrificed and corneal light absorption measured using our spectrophotometrical method. Corneal hydration was examined using an ultrasonic Pachymeter every experimental day before the irradiation procedure and the last day before sacrificing the animals. Changes in corneal optics appeared after the repeated exposure of the cornea to a UVB dose of 0.25 J/ cm(2) and massively increased after the repeated exposure of the cornea to a UVB dose of 0.5 J/cm(2). The first significant changes in corneal hydration appeared after a single exposure of the cornea to a UVB dose of 0.25 J/cm(2). Changes in corneal hydration appeared after the exposure of the rabbit cornea to a single UVB dose equivalent to 2.6 hours of solar UVB radiation reaching the human cornea, as measured by UVB sensors embedded in the eyes of mannequin heads facing the sun on a beach at noon in July. Repeated exposure of the rabbit cornea to the same UVB dose evoked profound changes in corneal optics. Although comparison of experimental and outdoor conditions are only approximate, the results in rabbits point to the danger for the human eye from UVB radiation when short stays in sunlight are repeated for several consecutive days without UV protection.
ACCUMULATION AND METABOLISM OF ARSENIC IN MICE AFTER REPEATED ADMINISTRATION OF ARSENATE
Accumulation and metabolism of arsenic in mice after repeated oral administration of arsenate, Hughes, M. F., Kenyon, E. M., Edwards, B. C., Mitchell, C. T., Del Razo, L. M., and Thomas, D. J. The human carcinogen inorganic arsenic (iAs) is a pervasive environmental ...
Two-Hierarchy Entanglement Swapping for a Linear Optical Quantum Repeater.
Xu, Ping; Yong, Hai-Lin; Chen, Luo-Kan; Liu, Chang; Xiang, Tong; Yao, Xing-Can; Lu, He; Li, Zheng-Da; Liu, Nai-Le; Li, Li; Yang, Tao; Peng, Cheng-Zhi; Zhao, Bo; Chen, Yu-Ao; Pan, Jian-Wei
2017-10-27
Quantum repeaters play a significant role in achieving long-distance quantum communication. In the past decades, tremendous effort has been devoted towards constructing a quantum repeater. As one of the crucial elements, entanglement has been created in different memory systems via entanglement swapping. The realization of j-hierarchy entanglement swapping, i.e., connecting quantum memory and further extending the communication distance, is important for implementing a practical quantum repeater. Here, we report the first demonstration of a fault-tolerant two-hierarchy entanglement swapping with linear optics using parametric down-conversion sources. In the experiment, the dominant or most probable noise terms in the one-hierarchy entanglement swapping, which is on the same order of magnitude as the desired state and prevents further entanglement connections, are automatically washed out by a proper design of the detection setting, and the communication distance can be extended. Given suitable quantum memory, our techniques can be directly applied to implementing an atomic ensemble based quantum repeater, and are of significant importance in the scalable quantum information processing.
Two-Hierarchy Entanglement Swapping for a Linear Optical Quantum Repeater
Xu, Ping; Yong, Hai-Lin; Chen, Luo-Kan; Liu, Chang; Xiang, Tong; Yao, Xing-Can; Lu, He; Li, Zheng-Da; Liu, Nai-Le; Li, Li; Yang, Tao; Peng, Cheng-Zhi; Zhao, Bo; Chen, Yu-Ao; Pan, Jian-Wei
2017-10-01
Quantum repeaters play a significant role in achieving long-distance quantum communication. In the past decades, tremendous effort has been devoted towards constructing a quantum repeater. As one of the crucial elements, entanglement has been created in different memory systems via entanglement swapping. The realization of j -hierarchy entanglement swapping, i.e., connecting quantum memory and further extending the communication distance, is important for implementing a practical quantum repeater. Here, we report the first demonstration of a fault-tolerant two-hierarchy entanglement swapping with linear optics using parametric down-conversion sources. In the experiment, the dominant or most probable noise terms in the one-hierarchy entanglement swapping, which is on the same order of magnitude as the desired state and prevents further entanglement connections, are automatically washed out by a proper design of the detection setting, and the communication distance can be extended. Given suitable quantum memory, our techniques can be directly applied to implementing an atomic ensemble based quantum repeater, and are of significant importance in the scalable quantum information processing.
SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; Humm, J; Nehmeh, S; Schoder, H [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)
2015-06-15
Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be.
SU-E-J-263: Repeatability of SUV and Texture Parameters in Serial PET Studies
International Nuclear Information System (INIS)
Schwartz, J; Humm, J; Nehmeh, S; Schoder, H
2015-01-01
Purpose: Standardized uptake values (SUV) are standard quantitative PET measures of FDG tumor uptake used,and are used as a tool to monitor response to therapy. Textural analysis is emerging as a new tool for assessing intratumoral heterogeneity which may allow better tissue characterization and improved prediction of response and survival rate.Understanding what variations may be expected in these parameters is key in order to make decisions based on how the change throughout the course of treatment. The aim of this study was to assess repeatability in SUV measures and texture parameters,and establish criteria that differentiate changes associated with treatment rather than statistical variability. Methods: Eighty patients,167 random lesions total,were scanned in a GE Discovery STE PET/CT Scanner. One field-of-view was chosen centered on the largest lesion observed in a clinical whole-body FDG PET.Immediately following,a gated 9 min scan was acquired in list mode,without changing the patient’s position between any scans. Data was replayed into 3 time bins,3 min each,in order to insure equivalent noise characteristics in each replicate.Data was reconstructed into 128×128×47 square matrices.One VOI was drawn over each lesion for each patient and used to segment all 3 replicates. The mean.max and peak SUV were calculated for each VOI and replicate. First-order textural features were also calculated (skewness and kurtosis). Repeatability was calculated as the average standard deviation over the mean for the 3 repeated measurements for each lesion. Results: The average percent error in the SUV max,peak and mean were 3.4%(0– 12.9%),1.9% (0–7.5%),2.8% (0–12.2%),respectively.For skewness and kurtosis they were 10.9% and 17.8%. Conclusion: We have shown that there is a large variation in %error in SUV measures across patients. SUVpeak is the least variable and kurtosis and skewness parameters are less reliable thatn SUVs.Higher order textures are be
X-Ray Observations of Magnetar SGR 0501+4516 from Outburst to Quiescence
Mong, Y.-L.; Ng, C.-Y.
2018-01-01
Magnetars are neutron stars having extreme magnetic field strengths. Study of their emission properties in quiescent state can help understand effects of a strong magnetic field on neutron stars. SGR 0501+4516 is a magnetar that was discovered in 2008 during an outburst, which has recently returned to quiescence. We report its spectral and timing properties measured with new and archival observations from the Chandra X-ray Observatory, XMM-Newton, and Suzaku. We found that the quiescent spectrum is best fit by a power-law plus two blackbody model, with temperatures of kT low ∼ 0.26 keV and kT high ∼ 0.62 keV. We interpret these two blackbody components as emission from a hotspot and the entire surface. The hotspot radius shrunk from 1.4 km to 0.49 km since the outburst, and there was a significant correlation between its area and the X-ray luminosity, which agrees well with the prediction by the twisted magnetosphere model. We applied the two-temperature spectral model to all magnetars in quiescence and found that it could be a common feature among the population. Moreover, the temperature of the cooler blackbody shows a general trend with the magnetar field strength, which supports the simple scenario of heating by magnetic field decay.
CONFRONTING THE JET MODEL OF Sgr A* WITH THE FARADAY ROTATION MEASURE OBSERVATIONS
Energy Technology Data Exchange (ETDEWEB)
Li, Ya-Ping; Yuan, Feng [Department of Astronomy and Institute of Theoretical Physics and Astrophysics, Xiamen University, Xiamen, Fujian 361005 (China); Daniel Wang, Q., E-mail: fyuan@shao.ac.cn, E-mail: wqd@astro.umass.edu [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States)
2015-01-01
Sgr A* is probably the supermassive black hole being investigated most extensively due to its proximity to Earth. Several theoretical models for its steady state emission have been proposed in the past two decades. Both the radiative-inefficient accretion flow and the jet model have been shown to well explain the observed spectral energy distribution. The Faraday rotation measure (RM) has been unambiguously measured at the submillimeter wavelength, but it has only been tested against the accretion flow model. Here we first calculate the RM based on the jet model and find that the predicted value is two orders of magnitude lower than the measured value. We then include an additional contribution from the accretion flow in front of the jet and show that the measured RM may be reconciled with the model under some tight constraints. The main constraint is that the inclination angle should be greater than ∼73°. However, this requirement is not consistent with an existing observational estimate of the inclination angle.
DEVIATION OF STELLAR ORBITS FROM TEST PARTICLE TRAJECTORIES AROUND SGr A* DUE TO TIDES AND WINDS
International Nuclear Information System (INIS)
Psaltis, Dimitrios; Li, Gongjie; Loeb, Abraham
2013-01-01
Monitoring the orbits of stars around Sgr A* offers the possibility of detecting the precession of their orbital planes due to frame dragging, of measuring the spin and quadrupole moment of the black hole, and of testing the no-hair theorem. Here we investigate whether the deviations of stellar orbits from test-particle trajectories due to wind mass loss and tidal dissipation of the orbital energy compromise such measurements. We find that the effects of stellar winds are, in general, negligible. On the other hand, for the most eccentric orbits (e > 0.96) for which an optical interferometer, such as GRAVITY, will detect orbital plane precession due to frame dragging, the tidal dissipation of orbital energy occurs at timescales comparable to the timescale of precession due to the quadrupole moment of the black hole. As a result, this non-conservative effect is a potential source of systematic uncertainty in testing the no-hair theorem with stellar orbits
DEVIATION OF STELLAR ORBITS FROM TEST PARTICLE TRAJECTORIES AROUND SGr A* DUE TO TIDES AND WINDS
Energy Technology Data Exchange (ETDEWEB)
Psaltis, Dimitrios [Astronomy Department, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Li, Gongjie; Loeb, Abraham, E-mail: dpsaltis@email.arizona.edu, E-mail: gli@cfa.harvard.edu, E-mail: aloeb@cfa.harvard.edu [Institute for Theory and Computation, Harvard-Smithsonian CfA, 60 Garden Street, Cambridge, MA (United States)
2013-11-01
Monitoring the orbits of stars around Sgr A* offers the possibility of detecting the precession of their orbital planes due to frame dragging, of measuring the spin and quadrupole moment of the black hole, and of testing the no-hair theorem. Here we investigate whether the deviations of stellar orbits from test-particle trajectories due to wind mass loss and tidal dissipation of the orbital energy compromise such measurements. We find that the effects of stellar winds are, in general, negligible. On the other hand, for the most eccentric orbits (e > 0.96) for which an optical interferometer, such as GRAVITY, will detect orbital plane precession due to frame dragging, the tidal dissipation of orbital energy occurs at timescales comparable to the timescale of precession due to the quadrupole moment of the black hole. As a result, this non-conservative effect is a potential source of systematic uncertainty in testing the no-hair theorem with stellar orbits.
Fermi/GBM Results of Magnetars
Kouveliotou, chryssa
2011-01-01
Magnetars are magnetically powered rotating neutron stars with extreme magnetic fields (over 10(exp 14) Gauss). They were discovered in the X- and gamma-rays where they predominantly emit their radiation. Very few sources (roughly 18) have been found since their discovery in 1987. NASA's Fermi Gamma-ray Space Telescope was launched June 11,2009; since then the Fermi Gamma-ray Burst Monitor (GBM) recorded emission from four magnetar sources. Two of these were brand new sources, SGR J0501 +4516, discovered with Swift and extensively monitored with Swift and GBM, SGR J0418+5729, discovered with GBM and the Interplanetary Network (IPN). A third was SGR Jl550-5418, a source originally classified as an Anomalous X-ray Pulsar (AXP IEI547.0-5408), but exhibiting a very prolific outburst with over 400 events recorded in January 2009. In my talk I will give a short history of magnetars and describe how this, once relatively esoteric field, has emerged as a link between several astrophysical areas including Gamma-Ray Bursts. Finally, I will describe the exciting new results of Fermi in this field and the current status of our knowledge of the magnetar population properties and magnetic fields.
Czech Academy of Sciences Publication Activity Database
Khalaji, A.D.; Gholinejad, M.; Rad, S.M.; Grivani, G.; Fejfarová, Karla; Dušek, Michal
2015-01-01
Roč. 41, č. 3 (2015), 1635-1645 ISSN 0922-6168 R&D Projects: GA ČR(CZ) GC202/07/J007 Institutional support: RVO:68378271 Keywords : Schiff base * crystal structure * DFT calculation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.833, year: 2015
The effect of single and repeated UVB radiation on rabbit cornea.
Fris, Miroslav; Tessem, May-Britt; Cejková, Jitka; Midelfart, Anna
2006-12-01
Cumulative effect of ultraviolet radiation (UVR) is an important aspect of UV corneal damage. The purpose of this study was to apply high resolution magic angle spinning proton nuclear magnetic resonance (HR-MAS 1H NMR) spectroscopy to evaluate the effect of single and repeated UV radiation exposure of the same overall dose on the rabbit cornea. Corneal surfaces of 24 normal rabbit eyes were examined for the effects of UVB exposure (312 nm). In the first group (UVB1), animals were irradiated with a single dose (3.12 J/cm2; 21 min) of UVB radiation. The animals in the second group (UVB2) were irradiated three times for 7 min every other day (dose of 1.04 J/cm2; days 1, 3, 5) to give the same overall dose (3.12 J/cm2). The third group served as an untreated control group. One day after the last irradiation, the animals were sacrificed, and the corneas were removed and frozen. HR-MAS 1H NMR spectra from intact corneas were obtained. Special grouping patterns among the tissue samples and the relative percentage changes in particular metabolite concentrations were evaluated using modern statistical methods (multivariate analysis, one-way ANOVA). The metabolic profile of both groups of UVB-irradiated samples was significantly different from the control corneas. Substantial decreases in taurine, hypo-taurine and choline-derivatives concentrations and substantial elevation in glucose and betaine levels were observed following the UVR exposure. There was no significant difference between the effect of a single and repeated UVB irradiation of the same overall dose. For the first time, the effects of single and repeated UVR doses on the metabolic profile of the rabbit cornea were analysed and compared. The combination of HR-MAS 1H NMR spectroscopy and modern statistical methods (multivariate analysis, one-way ANOVA) proved suitable to assess the overall view of the metabolic alterations in the rabbit corneal tissue following UVB radiation exposure.
Avaliação experimental do efeito tóxico de metais em Paramecium caudatum Ehrenberg, 1833.
Directory of Open Access Journals (Sweden)
Fernandes Martins Nicolas
2014-07-01
Full Text Available No presente trabalho o protozoário ciliado Paramecium caudatum Ehrenberg, 1833 foi isolado da Represa do Monjolinho (São Carlos-SP e mantido em cultura monoxênica sob condições de cultivo previamente estabelecidas, e seguindo recomendações de otimização para cultivo do protozoário; usado em experimentos para avaliar a toxicidade de dezessete metais sob a forma de íons cloreto (alumínio, arsênio, bário, cádmio, chumbo, cobalto, cobre, cromo, estanho, estrôncio, ferro (II, lítio, manganês, mercúrio, molibdênio, níquel, e zinco e nitrato de prata; visando a possibilidade de sua utilização como organismo-teste e indicador ambiental em um bioensaio padronizado. Foi verificado previamente, por meio dos ensaios que o Paramecium caudatum apresenta pouca tolerância aos metais usados nos testes, revelando uma maior tolerância ao Lítio, sugere que se realize testes definitivos com os resultados aqui obtidos visando estabelecer criteriosamente através de testes de concetração letal a 50% (LC50-24h., visando estabelecer com maior precisão as faixas de mortalidade e tolerância do protozoário para cada íon metal aqui utilizado nos ensaios preliminares.
Prakash, Gaurav; Srivastava, Dhruv; Choudhuri, Sounak
2015-12-01
The purpose of this study is to analyze the repeatability and agreement of corneal power using a new Hartman type topographer in comparison to Scheimpflug+Placido and autorefractor devices. In this cross sectional, observational study performed at the cornea services of a specialty hospital, 100 normal eyes (100 consecutive candidates) without any previous ocular surgery or morbidity except refractive error were evaluated. All candidates underwent three measurements each on a Full gradient, Hartman type topographer (FG) (iDesign, AMO), Scheimpflug+Placido topographer (SP) (Sirius, CSO) and rotating prism auto-keratorefractor (AR) (KR1, Nidek). The parameters assessed were flat keratometry (K1), steep keratometry (K2), steep axis (K2 axis), mean K, J 0 and J 45. Intra-device repeatability and inter-device agreement were evaluated. On repeatability analysis, the intra-device means were not significantly different (ANOVA, p > 0.05). Intraclass correlations (ICC) were >0.98 except for J 0 and J 45. In terms of intra-measurement standard deviation (Sw), the SP and FG groups fared better than AR group (p 0.05, R (2) 0.05). ICC ranged from 0.92 to 0.99 (p < 0.001). Regression fits on Bland-Altman plots suggested no clinically significant effect of average values over difference in means. The repeatability of Hartman type topographer in normal eyes is comparable to SP combination device and better than AR. The agreement between the three devices is good. However, we recommend against interchanging these devices between follow-ups or pooling their data.
ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...
African Journals Online (AJOL)
Prof Kakande
Table 2. Therapeutic Procedures and Postoperative Recommendations of Patients who Underwent URS for ureteric stone. Procedure. Frequency. Percent. Post-operative recommendation. Frequency. Percent. None. 6. 15.8. Discharge. 24. 63.2. Only J stenting. 9. 23.7. Repeat URS. 2. 5.3. Stone extraction 19. 50. ESWL. 4.
Kadrioru loss ja selle loo killuke / Aleksandra Murre
Murre, Aleksandra
2008-01-01
Näitusest "Kadriorg 290. Loss ja tema lugu" Kadrioru Kunstimuuseumis. Täienduseks näitusel eksponeeritule katkend lossivalitseja J. von Gerneti (ametis 1831-1846) mälestustest, mis aitab aimu saada Kadrioru uue õitsengu algusest 19. sajandi II veerandil. Ka keiser Nikolai I ja keisrinna Aleksandra Fjodorovna visiidist Tallinna 1833. aastal
COMPARATIVE METABOLISM OF ARSENIC IN MICE AFTER A SINGLE OR REPEATED ORAL ADMINISTRATION OF ARSENATE
COMPARATIVE METABOLISM OF ARSENIC IN MICE AFTER A SINGLE OR REPEATED ORAL ADMINISTRATION OF ARSENATEMichael F. Hughes*1, Elaina M. Kenyon1, Brenda C. Edwards1, Carol T. Mitchell1, Luz Maria Del Razo2 and David J. Thomas11US EPA, ORD, NHEERL, ETD, PKB, Research Triangle Pa...
Energy Technology Data Exchange (ETDEWEB)
Waddell, Michael [South Carolina Research Foundation, Columbia, SC (United States)
2015-02-10
This study focuses on evaluating the feasibility and suitability of using the Jurassic/Triassic (J/TR) sediments of the South Georgia Rift basin (SGR) for CO2 storage in southern South Carolina and southern Georgia The SGR basin in South Carolina (SC), prior to this project, was one of the least understood rift basin along the east coast of the U.S. In the SC part of the basin there was only one well (Norris Lightsey #1) the penetrated into J/TR. Because of the scarcity of data, a scaled approach used to evaluate the feasibility of storing CO2 in the SGR basin. In the SGR basin, 240 km (~149 mi) of 2-D seismic and 2.6 km2 3-D (1 mi2) seismic data was collected, process, and interpreted in SC. In southern Georgia 81.3 km (~50.5 mi) consisting of two 2-D seismic lines were acquired, process, and interpreted. Seismic analysis revealed that the SGR basin in SC has had a very complex structural history resulting the J/TR section being highly faulted. The seismic data is southern Georgia suggest SGR basin has not gone through a complex structural history as the study area in SC. The project drilled one characterization borehole (Rizer # 1) in SC. The Rizer #1 was drilled but due to geologic problems, the project team was only able to drill to 1890 meters (6200 feet) instead of the proposed final depth 2744 meters (9002 feet). The drilling goals outlined in the original scope of work were not met. The project was only able to obtain 18 meters (59 feet) of conventional core and 106 rotary sidewall cores. All the conventional core and sidewall cores were in sandstone. We were unable to core any potential igneous caprock. Petrographic analysis of the conventional core and sidewall cores determined that the average porosity of the sedimentary material was 3.4% and the average permeability was 0.065 millidarcy. Compaction and diagenetic studies of the samples determined there would not be any porosity or permeability at depth in SC. In Georgia there
Ages and Heavy Element Abundances from Very Metal-poor Stars in the Sagittarius Dwarf Galaxy
Hansen, Camilla Juul; El-Souri, Mariam; Monaco, Lorenzo; Villanova, Sandro; Bonifacio, Piercarlo; Caffau, Elisabetta; Sbordone, Luca
2018-03-01
Sagittarius (Sgr) is a massive disrupted dwarf spheroidal galaxy in the Milky Way halo that has undergone several stripping events. Previous chemical studies were restricted mainly to a few, metal-rich ([Fe/H] \\gtrapprox -1) stars that suggested a top-light initial mass function (IMF). Here we present the first high-resolution, very metal-poor ([Fe/H] =‑1 to ‑3) sample of 13 giant stars in the main body of Sgr. We derive abundances of 13 elements, namely C, Ca, Co, Fe, Sr, Ba, La, Ce, Nd, Eu, Dy, Pb, and Th, that challenge the interpretation based on previous studies. Our abundances from Sgr mimic those of the metal-poor halo, and our most metal-poor star ([Fe/H] ∼ -3) indicates a pure r-process pollution. Abundances of Sr, Pb, and Th are presented for the first time in Sgr, allowing for age determination using nuclear cosmochronology. We calculate ages of 9+/- 2.5 {Gyr}. Most of the sample stars have been enriched by a range of asymptotic giant branch (AGB) stars with masses between 1.3 and 5 M ⊙. Sgr J190651.47–320147.23 shows a large overabundance of Pb (2.05 dex) and a peculiar abundance pattern best fit by a 3 M ⊙ AGB star. Based on star-to-star scatter and observed abundance patterns, a mixture of low- and high-mass AGB stars and supernovae (15–25 M ⊙) is necessary to explain these patterns. The high level (0.29 ± 0.05 dex) of Ca indicates that massive supernovae must have existed and polluted the early ISM of Sgr before it lost its gas. This result is in contrast with a top-light IMF with no massive stars polluting Sgr. Based on data obtained UVES/VLT ID: 083.B-0774, 075.B-0127.
Numerical Optimization Algorithm for Engineering Problems Using Microcomputer.
1984-09-01
the two-dimension working array 3255 for i = 1 to niqm 3260 for j = 1 tc ndvm 3265 wrky (i,j) = 0. 3270 next 3 3275 next i 3280 return 3300 rem...sq gsa+dg (i, j) *2-422r nex 4230 gs( = sgr gq 44232 if gs q- tb~en gsg zro 4235 for j. to ndv 4240 wrky (i,j) = (1./gsq) *dg (i, j) 4245 next j 4250...constraints 4605 qosub 3350 4610 for i = 1 to navc 4620 for = 1 tc ndv 4630 aji,j) = wrky (i,j) 4640 next 4650 a (i,ndv+1) = thta(i) 4660 next i 467C
Directory of Open Access Journals (Sweden)
R Rajyalakshmi
2017-01-01
Full Text Available Purpose: To assess the reliability and repeatability of periorbital biometric measurements using ImageJ software and to assess if the horizontal visible iris diameter (HVID serves as a reliable scale for facial measurements. Methods: This study was a prospective, single-blind, comparative study. Two clinicians performed 12 periorbital measurements on 100 standardised face photographs. Each individual’s HVID was determined by Orbscan IIz and used as a scale for measurements using ImageJ software. All measurements were repeated using the ‘average’ HVID of the study population as a measurement scale. Intraclass correlation coefficient (ICC and Pearson product-moment coefficient were used as statistical tests to analyse the data. Results: The range of ICC for intra- and interobserver variability was 0.79–0.99 and 0.86–0.99, respectively. Test-retest reliability ranged from 0.66–1.0 to 0.77–0.98, respectively. When average HVID of the study population was used as scale, ICC ranged from 0.83 to 0.99, and the test-retest reliability ranged from 0.83 to 0.96 and the measurements correlated well with recordings done with individual Orbscan HVID measurements. Conclusion: Periorbital biometric measurements using ImageJ software are reproducible and repeatable. Average HVID of the population as measured by Orbscan is a reliable scale for facial measurements.
Repeated thinking promotes cooperation in spatial prisoner's dilemma game
International Nuclear Information System (INIS)
Zhang Jun; Cai Kaiquan; Du Wenbo; Cao Xianbin
2012-01-01
Inspired by the realistic process of taking decisions in social life, we have proposed a repeated thinking mechanism in the evolutionary spatial prisoner's dilemma game where players are denoted by the vertices and play games with their direct neighbors. Under our mechanism, a player i will randomly select a neighbor j and then deliberate for M times before strategy updating. It will remain unchanged if not all M considerations suggest it to learn the strategy of j. We mainly focus on the evolution of cooperation in the systems. Interestingly, we find that the cooperation level f C is remarkably promoted and f C has a monotonic dependence on the caution parameter M, indicating that being cautious facilitates the emergence and persistence of cooperation. We give a simple but clear explanation for this cooperation promotion via detecting the cooperator-defector transition process. Moreover, the robustness of this mechanism is also examined on different noise levels and game models. (paper)
Initial evaluation of an interactive test of sentence gist recognition.
Tye-Murray, N; Witt, S; Castelloe, J
1996-12-01
The laser videodisc-based Sentence Gist Recognition (SGR) test consists of sets of topically related sentences that are cued by short film clips. Clients respond to test items by selecting picture illustrations and may interact with the talker by using repair strategies when they do not recognize a test item. The two experiments, involving 40 and 35 adult subjects, respectively, indicated that the SGR may better predict subjective measures of speechreading and listening performance than more traditional audiologic sentence and nonsense syllable tests. Data from cochlear implant users indicated that the SGR accounted for a greater percentage of the variance for selected items of the Communication Profile for the Hearing-Impaired and the Speechreading Questionnaire for Cochlear-Implant Users than two other audiologic tests. As in previous work, subjects were most apt to ask the talker to repeat an utterance that they did not recognize than to ask the talker to restructure it. It is suggested that the SGR may reflect the interactive nature of conversation and provide a simulated real-world listening and/or speechreading task. The principles underlaying this test are consistent with the development of other computer technologies and concepts, such as compact discinteractive and virtual reality.
Directory of Open Access Journals (Sweden)
Anna Assenza
2016-01-01
Full Text Available Modifications of the iron profile in athlete horses during two international three star (*** show jumping competitions performed in two consecutive weekends were evaluated. Serum iron, ferritin, transferrin, and haptoglobin were assessed in 12 well-trained Italian Saddle horses. Blood samplings were performed before the first day of competition (R1, within 10 min from the end of each competition (J1, J2 and on the day after competition (R2. The same plan was followed during the second weekend (J3, J4 and R3. One-way repeated measures analysis of variance (ANOVA was applied on obtained data, and a significant effect of exercise (P < 0.05 on all studied indices was found. These results suggest that serum iron, transferrin, ferritin and haptoglobin are responsive to intense exercise and could be considered important indicators that may give important information about the horse’s performance.
Interstitial telomere-like repeats in the Arabidopsis thaliana genome.
Uchida, Wakana; Matsunaga, Sachihiro; Sugiyama, Ryuji; Kawano, Shigeyuki
2002-02-01
Eukaryotic chromosomal ends are protected by telomeres, which are thought to play an important role in ensuring the complete replication of chromosomes. On the other hand, non-functional telomere-like repeats in the interchromosomal regions (interstitial telomeric repeats; ITRs) have been reported in several eukaryotes. In this study, we identified eight ITRs in the Arabidopsis thaliana genome, each consisting of complete and degenerate 300- to 1200-bp sequences. The ITRs were grouped into three classes (class IA-B, class II, and class IIIA-E) based on the degeneracy of the telomeric repeats in ITRs. The telomeric repeats of the two ITRs in class I were conserved for the most part, whereas the single ITR in class II, and the five ITRs in class III were relatively degenerated. In addition, degenerate ITRs were surrounded by common sequences that shared 70-100% homology to each other; these are named ITR-adjacent sequences (IAS). Although the genomic regions around ITRs in class I lacked IAS, those around ITRs in class II contained IAS (IASa), and those around five ITRs in class III had nine types of IAS (IASb, c, d, e, f, g, h, i, and j). Ten IAS types in classes II and III showed no significant homology to each other. The chromosomal locations of ITRs and IAS were not category-related, but most of them were adjacent to, or part of, a centromere. These results show that the A. thaliana genome has undergone chromosomal rearrangements, such as end-fusions and segmental duplications.
Tracking the elusive 5' exonuclease activity of Chlamydomonas reinhardtii RNase J.
Liponska, Anna; Jamalli, Ailar; Kuras, Richard; Suay, Loreto; Garbe, Enrico; Wollman, Francis-André; Laalami, Soumaya; Putzer, Harald
2018-04-01
Chlamydomonas RNase J is the first member of this enzyme family that has endo- but no intrinsic 5' exoribonucleolytic activity. This questions its proposed role in chloroplast mRNA maturation. RNA maturation and stability in the chloroplast are controlled by nuclear-encoded ribonucleases and RNA binding proteins. Notably, mRNA 5' end maturation is thought to be achieved by the combined action of a 5' exoribonuclease and specific pentatricopeptide repeat proteins (PPR) that block the progression of the nuclease. In Arabidopsis the 5' exo- and endoribonuclease RNase J has been implicated in this process. Here, we verified the chloroplast localization of the orthologous Chlamydomonas (Cr) RNase J and studied its activity, both in vitro and in vivo in a heterologous B. subtilis system. Our data show that Cr RNase J has endo- but no significant intrinsic 5' exonuclease activity that would be compatible with its proposed role in mRNA maturation. This is the first example of an RNase J ortholog that does not possess a 5' exonuclease activity. A yeast two-hybrid screen revealed a number of potential interaction partners but three of the most promising candidates tested, failed to induce the latent exonuclease activity of Cr RNase J. We still favor the hypothesis that Cr RNase J plays an important role in RNA metabolism, but our findings suggest that it rather acts as an endoribonuclease in the chloroplast.
Gene : CBRC-PHAM-01-0832 [SEVENS
Lifescience Database Archive (English)
Full Text Available m berghei] 8e-35 53% MTFSVPTGNTQIHSQAYAHPHTSTHRGPHTFTHRGPHTSTHRSTHIHTQRSTHIHTQVHTHLHTEVHTHPHTEVHTHPHTQVHTHPHTGPHTSTHRGPHTST...HRPTHIHTQVHTHPHTEIHTHPHTGPYTSTHTGPHTSTHRSTHIHTHGFIHIHTHVHTHPHTEVHTHVHTHPHTGPHTSTHTGPHTSTHRSTHIXXXXXXXXXXXXXXXXX ...
Observations of interstellar silicon monoxide
International Nuclear Information System (INIS)
Dickinson, D.F.; Gottlieb, C.A.; Gottlieb, E.W.; Litvak, M.M.
1976-01-01
We report observations of rotational transitions of SiO in the ground vibrational state at 86.8 GHz (J=2→1) and 130.3 GHz (J=3→2). At 86.8 GHz, SiO emission in Orion A peaks in the direction of the Kleinmann-Low nebula. A possible secondary maximum occurs about 80'' southward. The 130.3 GHz line was also detected in Orion A. Mapping of the 86.8 GHz line in Sgr B2 shows the presence of two velocity components and a north-south extent of about 4'. Comparison of the data with radiative-transport calculations implies that if the hydrogen density is approximately 10 5 cm -3 then the SiO column density is approximately 10 15 cm -2 for Orion A at 60 K.Upper limits to the total HO 2 column density in Orion A and Sgr B2 are reported
Targeting Tryptophan Catabolism: A Novel Method to Block Triple-Negative Breast Cancer Metastasis
2017-04-01
Negative Breast Cancer Nicholas C. D’Amato1, Thomas J. Rogers1, Michael A. Gordon1, Lisa I. Greene1, Dawn R. Cochrane1, Nicole S. Spoelstra1, Travis G...cancer progression. Biochim Biophys Acta 2013;1833:3481–98. 10. Kamarajugadda S, Stemboroski L, Cai Q, Simpson NE, Nayak S, Tan M, et al. Glucose...4664. Published OnlineFirst September 11, 2015.Cancer Res Nicholas C. D’Amato, Thomas J. Rogers, Michael A. Gordon, et al. Metastasis in Triple
Sbordone, L.; Monaco, L.; Moni Bidin, C.; Bonifacio, P.; Villanova, S.; Bellazzini, M.; Ibata, R.; Chiba, M.; Geisler, D.; Caffau, E.; Duffau, S.
2015-07-01
Context. The tidal disruption of the Sagittarius dwarf spheroidal galaxy (Sgr dSph) is producing the most prominent substructure in the Milky Way (MW) halo, the Sagittarius Stream. Aside from field stars, it is suspected that the Sgr dSph has lost a number of globular clusters (GC). Many Galactic GC are thought to have originated in the Sgr dSph. While for some candidates an origin in the Sgr dSph has been confirmed owing to chemical similarities, others exist whose chemical composition has never been investigated. Aims: NGC 5053 and NGC 5634 are two of these scarcely studied Sgr dSph candidate-member clusters. To characterize their composition we analyzed one giant star in NGC 5053, and two in NGC 5634. Methods: We analyze high-resolution and signal-to-noise spectra by means of the MyGIsFOS code, determining atmospheric parameters and abundances for up to 21 species between O and Eu. The abundances are compared with those of MW halo field stars, of unassociated MW halo globulars, and of the metal-poor Sgr dSph main body population. Results: We derive a metallicity of [Fe ii/H] = -2.26 ± 0.10 for NGC 5053, and of [Fe i/H] = -1.99 ± 0.075 and -1.97 ± 0.076 for the two stars in NGC 5634. This makes NGC 5053 one of the most metal-poor globular clusters in the MW. Both clusters display an α enhancement similar to the one of the halo at comparable metallicity. The two stars in NGC 5634 clearly display the Na-O anticorrelation widespread among MW globulars. Most other abundances are in good agreement with standard MW halo trends. Conclusions: The chemistry of the Sgr dSph main body populations is similar to that of the halo at low metallicity. It is thus difficult to discriminate between an origin of NGC 5053 and NGC 5634 in the Sgr dSph, and one in the MW. However, the abundances of these clusters do appear closer to that of Sgr dSph than of the halo, favoring an origin in the Sgr dSph system. Appendix A is available in electronic form at http
Bright X-ray flares from Sgr A*
Czech Academy of Sciences Publication Activity Database
Karssen, G.; Bursa, Michal; Eckart, A.; Valencia-S, M.; Dovčiak, Michal; Karas, Vladimír; Horák, Jiří
2017-01-01
Roč. 472, č. 4 (2017), s. 4422-4433 ISSN 0035-8711 R&D Projects: GA ČR(CZ) GC13-00070J; GA MŠk(CZ) 7E13012 EU Projects: European Commission(XE) 312789 - STRONGGRAVITY Institutional support: RVO:67985815 Keywords : accretion, accretion discs * black hole physics * galaxtic center Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016
Study on Production of Exotic 0+ Meson D*sJ(2317) in Decays of ψ(4415)
International Nuclear Information System (INIS)
Guo Xinheng; Ke Hongwei; Li Xueqian; Liu Xiang; Zhao Shumin
2007-01-01
The newly observed D* sJ family containing D* sJ (2317), D sJ (2460), and D sJ (2632) attracts great interests. Determining their structures may be an important task for both theorists and experimentalists. In this work we use a non-relativistic model (the harmonic oscillator model) to evaluate the production rate of D* sJ (2317) from the decays of ψ(4415). For a comparison, we also employ the widely adopted heavy quark effective theory to repeat the calculation. We find that the rate is sizable and may be observed at BES III and CLEO, if it is a p-wave excited state of D s (1968). Unfortunately, the other two members of the family cannot be observed through decays of charmonia, because of the constraints from the final state phase space.
International Nuclear Information System (INIS)
Pahladsingh, R.R.
2002-01-01
Deregulation and liberalization are changing the global energy-markets. At the same time innovative technologies are introduced in the electricity industry; often as a requirement from the upcoming Digital Society. Energy solutions for the future are more seen as a mix of energy-sources for generation-, transmission- and distribution energy-services. The Internet Energy-web based 'Virtual' enterprises are coming up and will gradually change our society. It the fast changing world we have to realize that there will be less time to look for the adequate solutions to anticipate on global developments and the way they will influence our own societies. Global population may reach 9 billion people by 2030; this will put tremendous pressure on energy-, water- and food supply in the global economy. It is time to think about some major issues as described below and come up with the right answers. These are needed on very short term to secure a humane global economic growth and the sustainable global environment. The DOE (Department of Energy - USA) has started the Generation IV initiative for the new generation of nuclear reactors that must lead to much better safety, economics and public acceptance the new reactors. The SGR (Simplified Gas-cooled Reactor) is being proposed as a Generation IV modular nuclear reactor, using graphite pebbles as fuel, whereby an attempt has been made to meet all the DOE requirements, to be used for future nuclear reactors. The focus in this paper is on the changing and emerging global energy-markets and shows some relevant criteria to the nuclear industry and how we can anticipate with improved and new designs towards the coming Digital Society. (author)
Repeating and non-repeating fast radio bursts from binary neutron star mergers
Yamasaki, Shotaro; Totani, Tomonori; Kiuchi, Kenta
2018-04-01
Most fast radio bursts (FRB) do not show evidence of repetition, and such non-repeating FRBs may be produced at the time of a merger of binary neutron stars (BNS), provided that the BNS merger rate is close to the high end of the currently possible range. However, the merger environment is polluted by dynamical ejecta, which may prohibit the radio signal from propagating. We examine this by using a general-relativistic simulation of a BNS merger, and show that the ejecta appears about 1 ms after the rotation speed of the merged star becomes the maximum. Therefore there is a time window in which an FRB signal can reach outside, and the short duration of non-repeating FRBs can be explained by screening after ejecta formation. A fraction of BNS mergers may leave a rapidly rotating and stable neutron star, and such objects may be the origin of repeating FRBs like FRB 121102. We show that a merger remnant would appear as a repeating FRB on a time scale of ˜1-10 yr, and expected properties are consistent with the observations of FRB 121102. We construct an FRB rate evolution model that includes these two populations of repeating and non-repeating FRBs from BNS mergers, and show that the detection rate of repeating FRBs relative to non-repeating ones rapidly increases with improving search sensitivity. This may explain why only the repeating FRB 121102 was discovered by the most sensitive FRB search with Arecibo. Several predictions are made, including the appearance of a repeating FRB 1-10 yr after a BNS merger that is localized by gravitational waves and subsequent electromagnetic radiation.
Lee, Hong Jo; Lee, Kyung Youn; Jung, Kyung Min; Park, Kyung Je; Lee, Ko On; Suh, Jeong-Yong; Yao, Yongxiu; Nair, Venugopal; Han, Jae Yong
2017-12-01
Avian leukosis virus subgroup J (ALV-J), first isolated in the late 1980s, has caused economic losses to the poultry industry in many countries. As all chicken lines studied to date are susceptible to ALV infection, there is enormous interest in developing resistant chicken lines. The ALV-J receptor, chicken Na + /H + exchange 1 (chNHE1) and the critical amino acid sequences involved in viral attachment and entry have already been characterized. However, there are no reported attempts to induce resistance to the virus by targeted genome modification of the receptor sequences. In an attempt to induce resistance to ALV-J infection, we used clustered regularly interspaced short palindromic repeats (CRISPR)-associated (CRISPR/Cas9)-based genome editing approaches to modify critical residues of the chNHE1 receptor in chicken cells. The susceptibility of the modified cell lines to ALV-J infection was examined using enhanced green fluorescent protein (EGFP)-expressing marker viruses. We showed that modifying the chNHE1 receptor by artificially generating a premature stop codon induced absolute resistance to viral infection, with mutations of the tryptophan residue at position 38 (Trp38) being very critical. Single-stranded oligodeoxynucleotide (ssODN)-mediated targeted recombination of the Trp38 region revealed that deletions involving the Trp38 residue were most effective in conferring resistance to ALV-J. Moreover, protein structure analysis of the chNHE1 receptor sequence suggested that its intrinsically disordered region undergoes local conformational changes through genetic alteration. Collectively, these results demonstrate that targeted mutations on chNHE1 alter the susceptibility to ALV-J and the technique is expected to contribute to develop disease-resistant chicken lines. Copyright © 2017 Elsevier Ltd. All rights reserved.
GRB 070610: A Curious Galactic Transient
Kasliwal, M. M.; Cenko, S. B.; Kulkarni, S. R.; Cameron, P. B.; Nakar, E.; Ofek, E. O.; Rau, A.; Soderberg, A. M.; Campana, S.; Bloom, J. S.; Perley, D. A.; Pollack, L. K.; Barthelmy, S.; Cummings, J.; Gehrels, N.; Krimm, H. A.; Markwardt, C. B.; Sato, G.; Chandra, P.; Frail, D.; Fox, D. B.; Price, P. A.; Berger, E.; Grebenev, S. A.; Krivonos, R. A.; Sunyaev, R. A.
2008-05-01
GRB 070610 is a typical high-energy event with a duration of 5 s. Yet within the burst localization we detect a highly unusual X-ray and optical transient, Swift J195509.6+261406. We see high-amplitude X-ray and optical variability on very short timescales even at late times. Using near-infrared imaging assisted by a laser guide star and adaptive optics, we identified the counterpart of Swift J195509.6+261406. Late-time optical and near-infrared imaging constrain the spectral type of the counterpart to be fainter than a K-dwarf, assuming it is of Galactic origin. It is possible that GRB 070610 and Swift J195509.6+261406 are unrelated sources. However, the absence of a typical X-ray afterglow from GRB 070610 in conjunction with the spatial and temporal coincidence of the two motivate us to suggest that the sources are related. The closest (imperfect) analog to Swift J195509.6+261406 is V4641 Sgr, an unusual black hole binary. We suggest that Swift J195509.6+261406 along with V4641 Sgr define a subclass of stellar black hole binaries—the fast X-ray novae. We further suggest that fast X-ray novae are associated with bursts of gamma rays. If so, GRB 070610 defines a new class of celestial gamma-ray bursts and these bursts dominate the long-duration GRB demographics.
Energy Technology Data Exchange (ETDEWEB)
Chan, Chi-kwan; Psaltis, Dimitrios; Özel, Feryal; Marrone, Daniel [Steward Observatory and Department of Astronomy, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States); Medeiros, Lia [Department of Physics, Broida Hall, University of California, Santa Barbara, Santa Barbara, CA 93106 (United States); Sadowski, Aleksander [MIT Kavli Institute for Astrophysics and Space Research, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Narayan, Ramesh, E-mail: chanc@email.arizona.edu [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)
2015-10-20
We explore the variability properties of long, high-cadence general relativistic magnetohydrodynamic (GRMHD) simulations across the electromagnetic spectrum using an efficient, GPU-based radiative transfer algorithm. We focus on both standard and normal evolution (SANE) and magnetically arrested disk (MAD) simulations with parameters that successfully reproduce the time-averaged spectral properties of Sgr A* and the size of its image at 1.3 mm. We find that the SANE models produce short-timescale variability with amplitudes and power spectra that closely resemble those inferred observationally. In contrast, MAD models generate only slow variability at lower flux levels. Neither set of models shows any X-ray flares, which most likely indicates that additional physics, such as particle acceleration mechanisms, need to be incorporated into the GRMHD simulations to account for them. The SANE models show strong, short-lived millimeter/infrared (IR) flares, with short (≲1 hr) time lags between the millimeter and IR wavelengths, that arise from the combination of short-lived magnetic flux tubes and strong-field gravitational lensing near the horizon. Such events provide a natural explanation for the observed IR flares with no X-ray counterparts.
Energy Technology Data Exchange (ETDEWEB)
Halfen, D. T.; Ziurys, L. M. [Department of Chemistry and Biochemistry, University of Arizona, 1305 E. 4th Street, Tucson, AZ 85719 (United States); Woolf, N. J., E-mail: halfend@email.arizona.edu [Department of Astronomy, Arizona Radio Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States)
2017-08-20
A study has been conducted of {sup 12}C/{sup 13}C ratios in five complex molecules in the Galactic center. H{sub 2}CS, CH{sub 3}CCH, NH{sub 2}CHO, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN and their {sup 13}C-substituted species have been observed in numerous transitions at 1, 2, and 3 mm, acquired in a spectral-line survey of Sgr B2(N), conducted with the telescopes of the Arizona Radio Observatory (ARO). Between 22 and 54 individual, unblended lines for the {sup 12}C species and 2–54 for {sup 13}C-substituted analogs were modeled in a global radiative transfer analysis. All five molecules were found to consistently exhibit two velocity components near V {sub LSR} ∼ 64 and 73 km s{sup −1}, with column densities ranging from N {sub tot} ∼ 3 × 10{sup 14} − 4 × 10{sup 17} cm{sup −2} and ∼2 × 10{sup 13} − 1 × 10{sup 17} cm{sup −2} for the {sup 12}C and {sup 13}C species, respectively. Based on 14 different isotopic combinations, ratios were obtained in the range {sup 12}C/{sup 13}C = 15 ± 5 to 33 ± 13, with an average value of 24 ± 7, based on comparison of column densities. These measurements better anchor the {sup 12}C/{sup 13}C ratio at the Galactic center, and suggest a slightly revised isotope gradient of {sup 12}C/{sup 13}C = 5.21(0.52) D {sub GC} + 22.6(3.3). As indicated by the column densities, no preferential {sup 13}C enrichment was found on the differing carbon sites of CH{sub 3}CCH, CH{sub 2}CHCN, and CH{sub 3}CH{sub 2}CN. Because of the elevated temperatures in Sgr B2(N), {sup 13}C isotopic substitution is effectively “scrambled,” diminishing chemical fractionation effects. The resulting ratios thus reflect stellar nucleosynthesis and Galactic chemical evolution, as is likely the case for most warm clouds.
Directory of Open Access Journals (Sweden)
Peniche Moreno, Paola
2016-06-01
Full Text Available This article analyzes the pillars that supported the therapeutic practice in Yucatán to treat cholera patients during the outbreaks preceding the discovery of its bacterial etiology, one in 1833 and another in 1853. Due partly to a significant evolution in scientific and medical ideas, and the dissemination of the principles of positivism, a profound process of transformation was experienced, which brought, among other things, new perceptions of the disease as well as schemes different from the colonials to deal with emergencies and ensure public health. However, given the lack of consensus about the origin of cholera and its means of propagation, the government promoted different therapeutic techniques practiced in Europe or the United States, alongside local knowledge on the medicinal use of herbs, while also reviving old ideas on the impact of individual moral behavior in the tendency to contract the disease and eventually die.Este artículo analiza los pilares que sostuvieron la práctica terapéutica en Yucatán para tratar a los enfermos de cólera durante los brotes registrados antes del descubrimiento de su etiología bacteriana, uno en 1833 y otro en 1853. Debido en parte a una importante evolución del pensamiento médico-científico y a la divulgación de los principios del positivismo, en esta época se vivió un profundo proceso de transformación que significó, entre otras cosas, nuevas percepciones sobre la enfermedad y esquemas distintos a los coloniales para afrontar las emergencias y procurar la salud pública. Sin embargo, ante la falta de consensos en cuanto al origen del cólera y sus medios de propagación, el gobierno estatal promovió la difusión de diferentes técnicas terapéuticas empleadas en Europa o Estados Unidos, que se sumaron al conocimiento local respecto al empleo medicinal de la herbolaria, retomando también antiguas ideas sobre la incidencia de las conductas morales individuales en la propensión al
The effects of multiple UV exposures on HIV-LTR (long terminal repeat) expression
International Nuclear Information System (INIS)
Schreck, S.; Milton, J.; Panozzo, J.; Libertin, C.R.; Woloschak, G.E.; Loyola Univ., Maywood, IL
1995-01-01
Previous studies have shown that cellular stress agents such as UV radiation induce transcription from the long terminal repeat (LTR) of the human immunodeficiency virus (HIV). Using HeLa cells stably transfected with the HIV-LTR sequence, which transcriptionally drives the chloramphenicol acetyl transferase (CAT) reporter gene, we examined the effects of multiple exposures to UVC (254 nm) on HIV-LTR-CAT expression. Low doses (≤ 5 J m -2 ) had no effect on CAT expression, but up to 29-fold induction was observed with 10 J m -2 when cells were harvested 48 h after completion of the exposure. Little difference was noted in induction levels when cells were exposed to one 25 J m -2 dose, viable cells were harvested at 24 h, 48 h or 72 h, and cell lysates were assayed for CAT expression. Two sequential 12.5 J m -2 exposures, given 24 h apart, resulted in an additive effect on CAT expression; these two exposures produced CAT activity equivalent to that induced following a single 25 J m -2 dose. Our data suggest that HIV-LTR requires a specific threshold UV dose in order to elicit induction; a maximal induction dose is also evident; exposures higher than this maximal dose contribute no more to HIV-LTR induction in viable cells. (author)
Directory of Open Access Journals (Sweden)
Pilar Marchante Castellanos
2007-04-01
Full Text Available Se exponen los aspectos esenciales sobre la enseñanza de la Farmacia que asumió y puso en práctica en Cuba la Real Junta Superior Gubernativa de la Facultad de Farmacia en la etapa comprendida entre la desaparición del Real Tribunal del Protomedicato, en 1833, hasta la incorporación de los estudios de esa especialidad en el Plan Estudios de la Real Universidad de La Habana, en 1842. Los conceptos aplicados en la enseñanza de la Farmacia durante esta etapa pueden considerarse como precursores de lo que constituyó el primer plan de estudios de la carrera de Farmacia en Cuba. Se presenta este primer plan, así como los requisitos para la obtención de los diferentes grados universitarios de la especialidad y los datos de algunas tesis presentadas en opción del grado de Doctor en Farmacia. Aunque formando parte de la Facultad de Medicina, y bajo la dirección del mismo decano, la carrera de Farmacia estuvo asociada con el nombre de Facultad y dirigida por un Consiliario hasta la reforma general de la enseñanza que tuvo lugar en la Isla en 1863, mediante la cual nace con identidad propia la Facultad de Farmacia en la Real Universidad de La Habana.The essential aspects about Pharmacy teaching, adopted and implemented by the Royal Higher Board of Directors of the Faculty of Pharmacy in Cuba since the Royal Board of the Protomedicate disappeared in 1833, until the studies of this specialty were included in the Curriculum of the Royal University of Havana, in 1842, are exposed. The concepts about the teaching of Pharmacy applied during this stage could be considered as predecessors of the first curriculum of Pharmacy in Cuba. This first curriculum, as well as the requirements to obtain the various university degrees of this specialty and the data on some theses submitted to obtain the Doctor in Pharmacy degree, are presented. As part of the Faculty of Medicine, and under the direction of the same Dean, the Pharmacy course was associated with the
A Unified Model for Repeating and Non-repeating Fast Radio Bursts
International Nuclear Information System (INIS)
Bagchi, Manjari
2017-01-01
The model that fast radio bursts (FRBs) are caused by plunges of asteroids onto neutron stars can explain both repeating and non-repeating bursts. If a neutron star passes through an asteroid belt around another star, there would be a series of bursts caused by a series of asteroid impacts. Moreover, the neutron star would cross the same belt repetitively if it were in a binary with the star hosting the asteroid belt, leading to a repeated series of bursts. I explore the properties of neutron star binaries that could lead to the only known repeating FRB so far (FRB121102). In this model, the next two epochs of bursts are expected around 2017 February 27 and 2017 December 18. On the other hand, if the asteroid belt is located around the neutron star itself, then a chance fall of an asteroid from that belt onto the neutron star would lead to a non-repeating burst. Even a neutron star grazing an asteroid belt can lead to a non-repeating burst caused by just one asteroid plunge during the grazing. This is possible even when the neutron star is in a binary with the asteroid-hosting star, if the belt and the neutron star orbit are non-coplanar.
A Unified Model for Repeating and Non-repeating Fast Radio Bursts
Energy Technology Data Exchange (ETDEWEB)
Bagchi, Manjari, E-mail: manjari@imsc.res.in [The Institute of Mathematical Sciences (IMSc-HBNI), 4th Cross Road, CIT Campus, Taramani, Chennai 600113 (India)
2017-04-01
The model that fast radio bursts (FRBs) are caused by plunges of asteroids onto neutron stars can explain both repeating and non-repeating bursts. If a neutron star passes through an asteroid belt around another star, there would be a series of bursts caused by a series of asteroid impacts. Moreover, the neutron star would cross the same belt repetitively if it were in a binary with the star hosting the asteroid belt, leading to a repeated series of bursts. I explore the properties of neutron star binaries that could lead to the only known repeating FRB so far (FRB121102). In this model, the next two epochs of bursts are expected around 2017 February 27 and 2017 December 18. On the other hand, if the asteroid belt is located around the neutron star itself, then a chance fall of an asteroid from that belt onto the neutron star would lead to a non-repeating burst. Even a neutron star grazing an asteroid belt can lead to a non-repeating burst caused by just one asteroid plunge during the grazing. This is possible even when the neutron star is in a binary with the asteroid-hosting star, if the belt and the neutron star orbit are non-coplanar.
Repeatability of Cryogenic Multilayer Insulation
Johnson, W. L.; Vanderlaan, M.; Wood, J. J.; Rhys, N. O.; Guo, W.; Van Sciver, S.; Chato, D. J.
2017-12-01
Due to the variety of requirements across aerospace platforms, and one off projects, the repeatability of cryogenic multilayer insulation (MLI) has never been fully established. The objective of this test program is to provide a more basic understanding of the thermal performance repeatability of MLI systems that are applicable to large scale tanks. There are several different types of repeatability that can be accounted for: these include repeatability between identical blankets, repeatability of installation of the same blanket, and repeatability of a test apparatus. The focus of the work in this report is on the first two types of repeatability. Statistically, repeatability can mean many different things. In simplest form, it refers to the range of performance that a population exhibits and the average of the population. However, as more and more identical components are made (i.e. the population of concern grows), the simple range morphs into a standard deviation from an average performance. Initial repeatability testing on MLI blankets has been completed at Florida State University. Repeatability of five Glenn Research Center (GRC) provided coupons with 25 layers was shown to be +/- 8.4% whereas repeatability of repeatedly installing a single coupon was shown to be +/- 8.0%. A second group of 10 coupons has been fabricated by Yetispace and tested by Florida State University, the repeatability between coupons has been shown to be +/- 15-25%. Based on detailed statistical analysis, the data has been shown to be statistically significant.
International Nuclear Information System (INIS)
Biersack, H.J.; Hartmann, A.; Froescher, W.; Reske, S.-N.; Reichmann, K.; Knopp, R.; Winkler, C.
1984-01-01
Many amines can pass the blood brain barrier and accumulate in relatively large amounts in the brain tissue. For about 2 years 123-J amphetamines have, therefore, been used for brain imaging by several teams. Our experience sofar is based on 28 patients. Of these, 14 were epileptics, 10 had cerebrovascular diseases, 2 suffered from migraine and another 2 had brain tumors. In 3 patients with vascular lesions studies were repeated twice or three times. Amphetamine uptake in the brain was measured with a rotating gamma camera system (Gammatome T9000/CGR). At an examination time of 20 minutes 64 frames were acquired during one full rotation. The pulse rate was about 3000 second after injecting 6.5 mCi of 123-J amphetamine. Of the epileptics, 8 showed defects both on CT and SPECT, in 3 cases both studies were normal. While 1 patient with CT positivity had a normal SPECT, 2 cases were found to have lesions on SPECT inspite of a normal CT. The size of the lesion seen on amphetamine SPECT was lager than on CT in 3 of 9 patients. In the 10 patients with cerebrovascular lesions the 2 procedures showed concordant normal patterns in 1 and concordant abnormal patterns in 7 instances. 2 patients with normal CT were found to have a lesion on amphetamine scanning which corresponded to the neurologic findings. Regarding the size of the lesions, SPECT showed a more extensive involvement than CT in 2 cases. This again was in good agreement with the neurologic findings. Inspite of repeat studies cerebellar diaschisis was only seen in a single case with healed cerebral infarction and hemiplegia of some years' standing. Two patients suffered from migraine and compromised blood flow was identified as suggested by the neurologic findings inspite of a normal CT. (Author)
2016-04-01
evaluating the deployment repeatability builds upon the testing or analysis of deployment kinematics (Chapter 6) and adds repetition. Introduction...material yield or failure during a test. For the purposes of this chapter, zero shift will refer to permanent changes in the structure, while reversible ...the content of other chapters in this book: Gravity Compensation (Chapter 4) and Deployment Kinematics and Dynamics (Chapter 6). Repeating the
Reconfigurable multiport EPON repeater
Oishi, Masayuki; Inohara, Ryo; Agata, Akira; Horiuchi, Yukio
2009-11-01
An extended reach EPON repeater is one of the solutions to effectively expand FTTH service areas. In this paper, we propose a reconfigurable multi-port EPON repeater for effective accommodation of multiple ODNs with a single OLT line card. The proposed repeater, which has multi-ports in both OLT and ODN sides, consists of TRs, BTRs with the CDR function and a reconfigurable electrical matrix switch, can accommodate multiple ODNs to a single OLT line card by controlling the connection of the matrix switch. Although conventional EPON repeaters require full OLT line cards to accommodate subscribers from the initial installation stage, the proposed repeater can dramatically reduce the number of required line cards especially when the number of subscribers is less than a half of the maximum registerable users per OLT. Numerical calculation results show that the extended reach EPON system with the proposed EPON repeater can save 17.5% of the initial installation cost compared with a conventional repeater, and can be less expensive than conventional systems up to the maximum subscribers especially when the percentage of ODNs in lightly-populated areas is higher.
Jin, Chichuan; Ponti, Gabriele; Haberl, Frank; Smith, Randall; Valencic, Lynne
2018-04-01
AX J1745.6-2901 is an eclipsing low mass X-ray binary (LMXB) in the Galactic Centre (GC). It shows significant X-ray excess emission during the eclipse phase, and its eclipse light curve shows an asymmetric shape. We use archival XMM-Newton and Chandra observations to study the origin of these peculiar X-ray eclipsing phenomena. We find that the shape of the observed X-ray eclipse light curves depends on both photon energy and the shape of the source extraction region, and also shows differences between the two instruments. By performing detailed simulations for the time-dependent X-ray dust scattering halo, as well as directly modelling the observed eclipse and non-eclipse halo profiles of AX J1745.6-2901, we obtained solid evidence that its peculiar eclipse phenomena are indeed caused by the X-ray dust scattering in multiple foreground dust layers along the line-of-sight (LOS). The apparent dependence on the instruments is caused by different instrumental point-spread-functions. Our results can be used to assess the influence of dust scattering in other eclipsing X-ray sources, and raise the importance of considering the timing effects of dust scattering halo when studying the variability of other X-ray sources in the GC, such as Sgr A⋆. Moreover, our study of halo eclipse reinforces the existence of a dust layer local to AX J1745.6-2901 as reported by Jin et al. (2017), as well as identifying another dust layer within a few hundred parsecs to Earth, containing up to several tens of percent LOS dust, which is likely to be associated with the molecular clouds in the Solar neighbourhood. The remaining LOS dust is likely to be associated with the molecular clouds located in the Galactic disk in-between.
Interaction between the SNR Sagittarius A East and the 50-km s-1 Molecular Cloud
International Nuclear Information System (INIS)
Tsuboi, Masato; Okumura, Sachiko K; Miyazaki, Atsushi
2006-01-01
We performed high-resolution observations of the Galactic Center 50-km s -1 molecular cloud in the CS J = 1 - 0 line using the Nobeyama Millimeter Array. The 50-km s -1 molecular cloud corresponds to a break in the Sagittarius (Sgr) A east shell. A very broad and negative velocity wing feature is detected at an apparent contact spot between the molecular cloud and the Sgr A east shell. The velocity width of the wing feature is over 50-km s -1 . The width is three times wider than those of typical Galactic Center clouds. This strongly suggests that the shell is interacting physically with the molecular cloud. The asymmetric velocity profile of the wing feature indicates that the Sgr A east shell expands and crashes into the far side of the molecular cloud. About 50 clumps are identified in the cloud using CLUMPFIND. The velocity width-size relation and the mass spectrum of clumps in the cloud are similar to those in Central Molecular Zone (CMZ)
Expansion of protein domain repeats.
Directory of Open Access Journals (Sweden)
Asa K Björklund
2006-08-01
Full Text Available Many proteins, especially in eukaryotes, contain tandem repeats of several domains from the same family. These repeats have a variety of binding properties and are involved in protein-protein interactions as well as binding to other ligands such as DNA and RNA. The rapid expansion of protein domain repeats is assumed to have evolved through internal tandem duplications. However, the exact mechanisms behind these tandem duplications are not well-understood. Here, we have studied the evolution, function, protein structure, gene structure, and phylogenetic distribution of domain repeats. For this purpose we have assigned Pfam-A domain families to 24 proteomes with more sensitive domain assignments in the repeat regions. These assignments confirmed previous findings that eukaryotes, and in particular vertebrates, contain a much higher fraction of proteins with repeats compared with prokaryotes. The internal sequence similarity in each protein revealed that the domain repeats are often expanded through duplications of several domains at a time, while the duplication of one domain is less common. Many of the repeats appear to have been duplicated in the middle of the repeat region. This is in strong contrast to the evolution of other proteins that mainly works through additions of single domains at either terminus. Further, we found that some domain families show distinct duplication patterns, e.g., nebulin domains have mainly been expanded with a unit of seven domains at a time, while duplications of other domain families involve varying numbers of domains. Finally, no common mechanism for the expansion of all repeats could be detected. We found that the duplication patterns show no dependence on the size of the domains. Further, repeat expansion in some families can possibly be explained by shuffling of exons. However, exon shuffling could not have created all repeats.
The leucine-rich repeat structure.
Bella, J; Hindle, K L; McEwan, P A; Lovell, S C
2008-08-01
The leucine-rich repeat is a widespread structural motif of 20-30 amino acids with a characteristic repetitive sequence pattern rich in leucines. Leucine-rich repeat domains are built from tandems of two or more repeats and form curved solenoid structures that are particularly suitable for protein-protein interactions. Thousands of protein sequences containing leucine-rich repeats have been identified by automatic annotation methods. Three-dimensional structures of leucine-rich repeat domains determined to date reveal a degree of structural variability that translates into the considerable functional versatility of this protein superfamily. As the essential structural principles become well established, the leucine-rich repeat architecture is emerging as an attractive framework for structural prediction and protein engineering. This review presents an update of the current understanding of leucine-rich repeat structure at the primary, secondary, tertiary and quaternary levels and discusses specific examples from recently determined three-dimensional structures.
Bodden, Carina; Siestrup, Sophie; Palme, Rupert; Kaiser, Sylvia; Sachser, Norbert; Richter, S Helene
2018-01-15
According to current guidelines on animal experiments, a prospective assessment of the severity of each procedure is mandatory. However, so far, the classification of procedures into different severity categories mainly relies on theoretic considerations, since it is not entirely clear which of the various procedures compromise the welfare of animals, or, to what extent. Against this background, a systematic empirical investigation of the impact of each procedure, including behavioral testing, seems essential. Therefore, the present study was designed to elucidate the effects of repeated versus single testing on mouse welfare, using one of the most commonly used paradigms for behavioral phenotyping in behavioral neuroscience, the open-field test. In an independent groups design, laboratory mice (Mus musculus f. domestica) experienced either repeated, single, or no open-field testing - procedures that are assigned to different severity categories. Interestingly, testing experiences did not affect fecal corticosterone metabolites, body weights, elevated plus-maze or home cage behavior differentially. Thus, with respect to the assessed endocrinological, physical, and behavioral outcome measures, no signs of compromised welfare could be detected in mice that were tested in the open-field repeatedly, once, or, not at all. These findings challenge current classification guidelines and may, furthermore, stimulate systematic research on the severity of single procedures involving living animals. Copyright © 2017 Elsevier B.V. All rights reserved.
Hysteresis of magnetostructural transitions: Repeatable and non-repeatable processes
Provenzano, Virgil; Della Torre, Edward; Bennett, Lawrence H.; ElBidweihy, Hatem
2014-02-01
The Gd5Ge2Si2 alloy and the off-stoichiometric Ni50Mn35In15 Heusler alloy belong to a special class of metallic materials that exhibit first-order magnetostructural transitions near room temperature. The magnetic properties of this class of materials have been extensively studied due to their interesting magnetic behavior and their potential for a number of technological applications such as refrigerants for near-room-temperature magnetic refrigeration. The thermally driven first-order transitions in these materials can be field-induced in the reverse order by applying a strong enough field. The field-induced transitions are typically accompanied by the presence of large magnetic hysteresis, the characteristics of which are a complicated function of temperature, field, and magneto-thermal history. In this study we show that the virgin curve, the major loop, and sequentially measured MH loops are the results of both repeatable and non-repeatable processes, in which the starting magnetostructural state, prior to the cycling of field, plays a major role. Using the Gd5Ge2Si2 and Ni50Mn35In15 alloys, as model materials, we show that a starting single phase state results in fully repeatable processes and large magnetic hysteresis, whereas a mixed phase starting state results in non-repeatable processes and smaller hysteresis.
Hysteresis of magnetostructural transitions: Repeatable and non-repeatable processes
International Nuclear Information System (INIS)
Provenzano, Virgil; Della Torre, Edward; Bennett, Lawrence H.; ElBidweihy, Hatem
2014-01-01
The Gd 5 Ge 2 Si 2 alloy and the off-stoichiometric Ni 50 Mn 35 In 15 Heusler alloy belong to a special class of metallic materials that exhibit first-order magnetostructural transitions near room temperature. The magnetic properties of this class of materials have been extensively studied due to their interesting magnetic behavior and their potential for a number of technological applications such as refrigerants for near-room-temperature magnetic refrigeration. The thermally driven first-order transitions in these materials can be field-induced in the reverse order by applying a strong enough field. The field-induced transitions are typically accompanied by the presence of large magnetic hysteresis, the characteristics of which are a complicated function of temperature, field, and magneto-thermal history. In this study we show that the virgin curve, the major loop, and sequentially measured MH loops are the results of both repeatable and non-repeatable processes, in which the starting magnetostructural state, prior to the cycling of field, plays a major role. Using the Gd 5 Ge 2 Si 2 and Ni 50 Mn 35 In 15 alloys, as model materials, we show that a starting single phase state results in fully repeatable processes and large magnetic hysteresis, whereas a mixed phase starting state results in non-repeatable processes and smaller hysteresis
Deng, Dong; Yan, Chuangye; Wu, Jianping; Pan, Xiaojing; Yan, Nieng
2014-04-01
Transcription activator-like (TAL) effectors specifically bind to double stranded (ds) DNA through a central domain of tandem repeats. Each TAL effector (TALE) repeat comprises 33-35 amino acids and recognizes one specific DNA base through a highly variable residue at a fixed position in the repeat. Structural studies have revealed the molecular basis of DNA recognition by TALE repeats. Examination of the overall structure reveals that the basic building block of TALE protein, namely a helical hairpin, is one-helix shifted from the previously defined TALE motif. Here we wish to suggest a structure-based re-demarcation of the TALE repeat which starts with the residues that bind to the DNA backbone phosphate and concludes with the base-recognition hyper-variable residue. This new numbering system is consistent with the α-solenoid superfamily to which TALE belongs, and reflects the structural integrity of TAL effectors. In addition, it confers integral number of TALE repeats that matches the number of bound DNA bases. We then present fifteen crystal structures of engineered dHax3 variants in complex with target DNA molecules, which elucidate the structural basis for the recognition of bases adenine (A) and guanine (G) by reported or uncharacterized TALE codes. Finally, we analyzed the sequence-structure correlation of the amino acid residues within a TALE repeat. The structural analyses reported here may advance the mechanistic understanding of TALE proteins and facilitate the design of TALEN with improved affinity and specificity.
All-photonic quantum repeaters
Azuma, Koji; Tamaki, Kiyoshi; Lo, Hoi-Kwong
2015-01-01
Quantum communication holds promise for unconditionally secure transmission of secret messages and faithful transfer of unknown quantum states. Photons appear to be the medium of choice for quantum communication. Owing to photon losses, robust quantum communication over long lossy channels requires quantum repeaters. It is widely believed that a necessary and highly demanding requirement for quantum repeaters is the existence of matter quantum memories. Here we show that such a requirement is, in fact, unnecessary by introducing the concept of all-photonic quantum repeaters based on flying qubits. In particular, we present a protocol based on photonic cluster-state machine guns and a loss-tolerant measurement equipped with local high-speed active feedforwards. We show that, with such all-photonic quantum repeaters, the communication efficiency scales polynomially with the channel distance. Our result paves a new route towards quantum repeaters with efficient single-photon sources rather than matter quantum memories. PMID:25873153
SVX Sequence Crate Custom J2/J3 Backplane
International Nuclear Information System (INIS)
Utes, M.
1997-01-01
The Custom J2/J3 Backplane is a full length (21 slot) user specified custom 3U backplane to be used in both the J2 and J3 positions. Slot spacing is identical to that used for VME (0.8-inch), and each backplane shall fit into a standard Eurocard VME style crate. The purpose of the Custom J2/J3 Backplane is to send and receive control and clock signals from the SVX chips via 3M pleated foil cables (Slots 2-21), and in slot 1, accept a cable connector and route its signal through to a signal distribution board.
Observation of ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ.
Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Baldini Ferroli, R; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Dou, Z L; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Farinelli, R; Fava, L; Fedorov, O; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, L; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G S; Huang, J S; Huang, X T; Huang, X Z; Huang, Y; Huang, Z L; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kupsc, A; Kühn, W; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, Q Y; Li, T; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, Y B; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Ma, Y M; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales Morales, C; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, H R; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, B L; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, S Q; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y N; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H
2017-06-02
Using 4.479×10^{8} ψ(3686) events collected with the BESIII detector, we search for the decays ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ, where J=0, 1, 2. The decays ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ are observed for the first time. The measured branching fractions are B(ψ(3686)→e^{+}e^{-}χ_{cJ})=(11.7±2.5±1.0)×10^{-4}, (8.6±0.3±0.6)×10^{-4}, (6.9±0.5±0.6)×10^{-4} for J=0, 1, 2, and B(χ_{cJ}→e^{+}e^{-}J/ψ)=(1.51±0.30±0.13)×10^{-4}, (3.73±0.09±0.25)×10^{-3}, (2.48±0.08±0.16)×10^{-3} for J=0, 1, 2, respectively. The ratios of the branching fractions B(ψ(3686)→e^{+}e^{-}χ_{cJ})/B(ψ(3686)→γχ_{cJ}) and B(χ_{cJ}→e^{+}e^{-}J/ψ)/B(χ_{cJ}→γJ/ψ) are also reported. Also, the α values of helicity angular distributions of the e^{+}e^{-} pair are determined for ψ(3686)→e^{+}e^{-}χ_{c1,2} and χ_{c1,2}→e^{+}e^{-}J/ψ.
Exact computation of the 3-j and 6-j symbols
International Nuclear Information System (INIS)
Lai Shantao; Chiu Yingnan
1990-01-01
A simple FORTRAN program for the exaxt computation of 3-j and 6-j symbols has been written for the VAX with VMS version v5.1 in our university's computing center. It goes beyond and contains all of the 3-j and 6-j symbols evaluated in the book by M. Rotenberg, R. Bivins, N. Metropolis and J.K. Wooten Jr. The 3-j symbols up to (30/m 1 30/m 2 30/m 3 ) and 6-j symbols up to {20/20 20/20 20/20} can be computed exactly by this program. Approximate values for larger j's up to (200/m 1 200/m 2 200/m 3 ) and {200/200 200/200 200/220} can also be computed by this program. (orig.)
SEARCH FOR GRAVITATIONAL WAVE BURSTS FROM SIX MAGNETARS
International Nuclear Information System (INIS)
Abadie, J.; Abbott, B. P.; Abbott, R.; Adhikari, R.; Anderson, S. B.; Arai, K.; Araya, M. C.; Abernathy, M.; Accadia, T.; Acernese, F.; Adams, C.; Affeldt, C.; Allen, B.; Allen, G. S.; Amador Ceron, E.; Anderson, W. G.; Amariutei, D.; Arain, M. A.; Amin, R. S.; Antonucci, F.
2011-01-01
Soft gamma repeaters (SGRs) and anomalous X-ray pulsars (AXPs) are thought to be magnetars: neutron stars powered by extreme magnetic fields. These rare objects are characterized by repeated and sometimes spectacular gamma-ray bursts. The burst mechanism might involve crustal fractures and excitation of non-radial modes which would emit gravitational waves (GWs). We present the results of a search for GW bursts from six galactic magnetars that is sensitive to neutron star f-modes, thought to be the most efficient GW emitting oscillatory modes in compact stars. One of them, SGR 0501+4516, is likely ∼1 kpc from Earth, an order of magnitude closer than magnetars targeted in previous GW searches. A second, AXP 1E 1547.0-5408, gave a burst with an estimated isotropic energy >10 44 erg which is comparable to the giant flares. We find no evidence of GWs associated with a sample of 1279 electromagnetic triggers from six magnetars occurring between 2006 November and 2009 June, in GW data from the LIGO, Virgo, and GEO600 detectors. Our lowest model-dependent GW emission energy upper limits for band- and time-limited white noise bursts in the detector sensitive band, and for f-mode ringdowns (at 1090 Hz), are 3.0 x 10 44 d 2 1 erg and 1.4 x 10 47 d 2 1 erg, respectively, where d 1 = (d 0501 )/1 kpc and d 0501 is the distance to SGR 0501+4516. These limits on GW emission from f-modes are an order of magnitude lower than any previous, and approach the range of electromagnetic energies seen in SGR giant flares for the first time.
Indian Academy of Sciences (India)
Resonance - Origins and Usage · J Chandrasekhar · More Details ... Molecule of the Month Maitotoxin - Holder of Two World Records · J Chandrasekhar ... Molecule of the Month Adamantane - A Plastic Piece of Diamond · J Chandrasekhar.
Spiral correlations in frustrated one-dimensional spin-1/2 Heisenberg J1-J2-J3 ferromagnets
International Nuclear Information System (INIS)
Zinke, R; Richter, J; Drechsler, S-L
2010-01-01
We use the coupled cluster method for infinite chains complemented by exact diagonalization of finite periodic chains to discuss the influence of a third-neighbor exchange J 3 on the ground state of the spin- 1/2 Heisenberg chain with ferromagnetic nearest-neighbor interaction J 1 and frustrating antiferromagnetic next-nearest-neighbor interaction J 2 . A third-neighbor exchange J 3 might be relevant to describe the magnetic properties of the quasi-one-dimensional edge-shared cuprates, such as LiVCuO 4 or LiCu 2 O 2 . In particular, we calculate the critical point J 2 c as a function of J 3 , where the ferromagnetic ground state gives way for a ground state with incommensurate spiral correlations. For antiferromagnetic J 3 the ferro-spiral transition is always continuous and the critical values J 2 c of the classical and the quantum model coincide. On the other hand, for ferromagnetic J 3 ∼ 1 | the critical value J 2 c of the quantum model is smaller than that of the classical model. Moreover, the transition becomes discontinuous, i.e. the model exhibits a quantum tricritical point. We also calculate the height of the jump of the spiral pitch angle at the discontinuous ferro-spiral transition.
Energy Technology Data Exchange (ETDEWEB)
Mori, Kaya; Hailey, Charles J.; Perez, Kerstin; Nynka, Melania; Zhang, Shuo; Canipe, Alicia M. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Krivonos, Roman; Tomsick, John A.; Barrière, Nicolas; Boggs, Steven E.; Craig, William W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Hong, Jaesub [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Ponti, Gabriele [Max-Planck-Institut f. extraterrestrische Physik, HEG, Garching (Germany); Bauer, Franz [Instituto de Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, 306, Santiago 22 (Chile); Alexander, David M. [Department of Physics, Durham University, Durham DH1 3LE (United Kingdom); Baganoff, Frederick K. [Kavli Institute for Astrophysics and Space Research, Massachusets Institute of Technology, Cambridge, MA 02139 (United States); Barret, Didier [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Christensen, Finn E. [DTU Space—National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Forster, Karl [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Giommi, Paolo, E-mail: kaya@astro.columbia.edu [ASI Science Data Center, Via del Politecnico snc I-00133, Roma (Italy); and others
2015-12-01
We present the first sub-arcminute images of the Galactic Center above 10 keV, obtained with NuSTAR. NuSTAR resolves the hard X-ray source IGR J17456–2901 into non-thermal X-ray filaments, molecular clouds, point sources, and a previously unknown central component of hard X-ray emission (CHXE). NuSTAR detects four non-thermal X-ray filaments, extending the detection of their power-law spectra with Γ ∼ 1.3–2.3 up to ∼50 keV. A morphological and spectral study of the filaments suggests that their origin may be heterogeneous, where previous studies suggested a common origin in young pulsar wind nebulae (PWNe). NuSTAR detects non-thermal X-ray continuum emission spatially correlated with the 6.4 keV Fe Kα fluorescence line emission associated with two Sgr A molecular clouds: MC1 and the Bridge. Broadband X-ray spectral analysis with a Monte-Carlo based X-ray reflection model self-consistently determined their intrinsic column density (∼10{sup 23} cm{sup −2}), primary X-ray spectra (power-laws with Γ ∼ 2) and set a lower limit of the X-ray luminosity of Sgr A* flare illuminating the Sgr A clouds to L{sub X} ≳ 10{sup 38} erg s{sup −1}. Above ∼20 keV, hard X-ray emission in the central 10 pc region around Sgr A* consists of the candidate PWN G359.95–0.04 and the CHXE, possibly resulting from an unresolved population of massive CVs with white dwarf masses M{sub WD} ∼ 0.9 M{sub ⊙}. Spectral energy distribution analysis suggests that G359.95–0.04 is likely the hard X-ray counterpart of the ultra-high gamma-ray source HESS J1745–290, strongly favoring a leptonic origin of the GC TeV emission.
78 FR 65594 - Vehicular Repeaters
2013-11-01
... coordinators estimate the effect on coordination fees? Does the supposed benefit that mobile repeater stations... allow the licensing and operation of vehicular repeater systems and other mobile repeaters by public... email: [email protected] or phone: 202-418- 0530 or TTY: 202-418-0432. For detailed instructions for...
Tevatron serial data repeater system
International Nuclear Information System (INIS)
Ducar, R.J.
1981-01-01
A ten megabit per second serial data repeater system has been developed for the 6.28km Tevatron accelerator. The repeaters are positioned at each of the thirty service buildings and accommodate control and abort system communications as well as distribution of the Tevatron time and energy clocks. The repeaters are transparent to the particular protocol of the transmissions. Serial data are encoded locally as unipolar two volt signals employing the self-clocking Manchester Bi-Phase code. The repeaters modulate the local signals to low-power bursts of 50 MHz rf carrier for the 260m transmission between service buildings. The repeaters also demodulate the transmission and restructure the data for local utilization. The employment of frequency discrimination techniques yields high immunity to the characteristic noise spectrum
Expected satiation after repeated consumption of low- or high-energy-dense soup.
Hogenkamp, Pleunie S; Brunstrom, Jeffrey M; Stafleu, Annette; Mars, Monica; de Graaf, Cees
2012-07-14
We investigated whether repeated consumption of a low-energy-dense (LED; 208 kJ/100 g) or high-energy-dense (HED; 645 kJ/100 g) soup modifies expectations relating to the satiating capacity of the food, and its subsequent intake. In study 1, participants consumed either a novel-flavoured LED (n 32; 21 (SD 1·6) years, BMI 21·4 (SD 1·6) kg/m(2)) or HED soup (n 32; 21 (SD 1·6) years, BMI 21·3 (SD 1·7) kg/m(2)). Soup was served in a fixed amount on days 1-4 and ad libitum on day 5. 'Expected satiation' was measured on days 1, 2 and 5. Expected satiation did not change after repeated consumption of the LED or HED soup. Ad libitum intake did not differ between the LED (461 (SD 213) g) and HED soup (391 (SD 164) g). Only on day 1, expected satiation was higher for the HED soup than for the LED soup (P = 0·03), suggesting a role for sensory attributes in expected satiation. In study 2, thirty participants (21 (SD 1·6) years, BMI 21·3 (SD 1·7) kg/m(2)) performed a single measurement of expected satiation of the LED and HED soup, and four commercially available types of soup. Ratings on sensory attributes were associated with expected satiation. Results on expected satiation coincided with those of study 1. Thickness and intensity of taste were independently associated with expected satiation. Expectations may initially rely on sensory attributes and previous experiences, and are not easily changed.
Repeat Customer Success in Extension
Bess, Melissa M.; Traub, Sarah M.
2013-01-01
Four multi-session research-based programs were offered by two Extension specialist in one rural Missouri county. Eleven participants who came to multiple Extension programs could be called "repeat customers." Based on the total number of participants for all four programs, 25% could be deemed as repeat customers. Repeat customers had…
Film repeats in radiology department
International Nuclear Information System (INIS)
Suwan, A. Z.; Al-Shakharah, A. I
1997-01-01
During a one year period, 4910 radiographs of 55780 films were repeated. The objective of our study was to analyse and to classify the causes in order to minimize the repeats, cut the expenses and to provide optimal radiographs for accurate diagnosis. Analysis of the different factors revealed that, 43.6% of film repeats in our service were due to faults in exposure factors, centering comprises 15.9% of the repeats, while too much collimation was responsible for 7.6% of these repeats. All of which can be decreased by awareness and programmed training of technicians. Film blurring caused by patient motion was also responsible for 4.9% for radiographs reexamination, which can be minimized by detailed explanation to the patient and providing the necessary privacy. Fogging of X-Ray films by improper storage or inadequate handling or processing faults were responsible for 14.5% in repeats in our study. Methods and criteria for proper storage and handling of films were discussed. Recommendation for using modern day-light and laser processor has been high lighted. Artefacts are noticeably high in our cases, due to spinal dresses and frequent usage of precious metals for c osmotic purposes in this part of the world. The repeated films comprise 8.8% of all films We conclude that, the main factor responsible for repeats of up to 81.6% of cases was the technologists, thus emphasizing the importance of adequate training of the technologists. (authors). 15 refs., 9 figs., 1 table
Repeat migration and disappointment.
Grant, E K; Vanderkamp, J
1986-01-01
This article investigates the determinants of repeat migration among the 44 regions of Canada, using information from a large micro-database which spans the period 1968 to 1971. The explanation of repeat migration probabilities is a difficult task, and this attempt is only partly successful. May of the explanatory variables are not significant, and the overall explanatory power of the equations is not high. In the area of personal characteristics, the variables related to age, sex, and marital status are generally significant and with expected signs. The distance variable has a strongly positive effect on onward move probabilities. Variables related to prior migration experience have an important impact that differs between return and onward probabilities. In particular, the occurrence of prior moves has a striking effect on the probability of onward migration. The variable representing disappointment, or relative success of the initial move, plays a significant role in explaining repeat migration probabilities. The disappointment variable represents the ratio of actural versus expected wage income in the year after the initial move, and its effect on both repeat migration probabilities is always negative and almost always highly significant. The repeat probabilities diminish after a year's stay in the destination region, but disappointment in the most recent year still has a bearing on the delayed repeat probabilities. While the quantitative impact of the disappointment variable is not large, it is difficult to draw comparisons since similar estimates are not available elsewhere.
Quantum repeated games revisited
International Nuclear Information System (INIS)
Frąckiewicz, Piotr
2012-01-01
We present a scheme for playing quantum repeated 2 × 2 games based on Marinatto and Weber’s approach to quantum games. As a potential application, we study the twice repeated Prisoner’s Dilemma game. We show that results not available in the classical game can be obtained when the game is played in the quantum way. Before we present our idea, we comment on the previous scheme of playing quantum repeated games proposed by Iqbal and Toor. We point out the drawbacks that make their results unacceptable. (paper)
Repeating pulsed magnet system for axion-like particle searches and vacuum birefringence experiments
Energy Technology Data Exchange (ETDEWEB)
Yamazaki, T., E-mail: yamazaki@icepp.s.u-tokyo.ac.jp [International Center for Elementary Particle Physics, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Inada, T.; Namba, T. [International Center for Elementary Particle Physics, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Asai, S. [Department of Physics, Graduate School of Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kobayashi, T. [International Center for Elementary Particle Physics, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Matsuo, A.; Kindo, K. [The Institute for Solid State Physics, The University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa-shi, Chiba 277-8581 (Japan); Nojiri, H. [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan)
2016-10-11
We have developed a repeating pulsed magnet system which generates magnetic fields of about 10 T in a direction transverse to an incident beam over a length of 0.8 m with a repetition rate of 0.2 Hz. Its repetition rate is by two orders of magnitude higher than usual pulsed magnets. It is composed of four low resistance racetrack coils and a 30 kJ transportable capacitor bank as a power supply. The system aims at axion-like particle searches with a pulsed light source and vacuum birefringence measurements. We report on the details of the system and its performances.
Complete structure of the polysaccharide from Streptococcus sanguis J22
International Nuclear Information System (INIS)
Abeygunawardana, C.; Bush, C.A.; Cisar, J.O.
1990-01-01
The cell wall polysaccharides of certain oral streptococci such as Streptococcus sanguis strains 34 and J22, although immunologically distinct, act as receptors for the fimbrial lectins of Actinomyces viscosus T14V. The authors report the complete covalent structure of the polysaccharide from S. sanguis J22 which is composed of a heptasaccharide subunit linked by phosphodiester bonds. The repeating subunit, which contains α-GalNAc, α-rhamnose, β-rhamnose, β-glucose, and β-galactose all in the pyranoside form and β-galactofuranose, is compared with the previously published structure of the polysaccharide from strain 34. The structure has been determined almost exclusively by high-resolution nuclear magnetic resonance methods. The 1 H and 13 C NMR spectra of the polysaccharides from both strains 34 and J22 have been completely assigned. The stereochemistry of pyranosides was assigned from J H-H values determined from phase-sensitive COSY spectra, and acetamido sugars were assigned by correlation of the resonances of the amide 1 H with the sugar ring protons. The 13 C spectra were assigned by 1 H-detected multiple-quantum correlation (HMQC) spectra, and the assignments were confirmed by 1 H-detected multiple-bond correlation (HMBC) spectra. The positions of the glycosidic linkages were assigned by detection of three-bond 1 H- 13 C correlation across the glycosidic linkage in the HMBC spectra. The positions of the phosphodiester linkages were determined by splittings observed in the 13 C resonances due to 31 P coupling and also by 1 H-detected 31 P correlation spectroscopy
Bouma, Harmen W.; Goldengorin, Boris; Lagakos, S; Perlovsky, L; Jha, M; Covaci, B; Zaharim, A; Mastorakis, N
2009-01-01
In this paper a Boolean Linear Programming (BLP) model is presented for the single machine scheduling problem 1 vertical bar pmtn; p(j) = 2;r(j)vertical bar Sigma w(j)C(j). The problem is a special case of the open problem 1 vertical bar pmtn; p(j) = p; r(j)vertical bar Sigma wj(g)C(j). We show that
Hu, Ai-Yuan; Wang, Huai-Yu
2017-09-05
The frustrated spin-1/2 J 1 -J 2 -J 3 antiferromagnet with exchange anisotropy on the two-dimensional square lattice is investigated. The exchange anisotropy is presented by η with 0 ≤ η J 1 , J 2 , J 3 and anisotropy on the possible phase transition of the Néel state and collinear state are studied comprehensively. Our results indicate that for J 3 > 0 there are upper limits [Formula: see text] and η c values. When 0 J 3 ≤ [Formula: see text] and 0 ≤ η ≤ η c , the Néel and collinear states have the same order-disorder transition point at J 2 = J 1 /2. Nevertheless, when the J 3 and η values beyond the upper limits, it is a paramagnetic phase at J 2 = J 1 /2. For J 3 J 2 = J 1 /2. Therefore, for J 2 = J 1 /2, under such parameters, a first-order phase transition between the two states for these two cases below the critical temperatures may occur. When J 2 ≠ J 1 /2, the Néel and collinear states may also exist, while they have different critical temperatures. When J 2 > J 1 /2, a first-order phase transition between the two states may also occur. However, for J 2 J 1 /2, the Néel state is always more stable than the collinear state.
Repeatability of visual acuity measurement.
Raasch, T W; Bailey, I L; Bullimore, M A
1998-05-01
This study investigates features of visual acuity chart design and acuity testing scoring methods which affect the validity and repeatability of visual acuity measurements. Visual acuity was measured using the Sloan and British Standard letter series, and Landolt rings. Identifiability of the different letters as a function of size was estimated, and expressed in the form of frequency-of-seeing curves. These functions were then used to simulate acuity measurements with a variety of chart designs and scoring criteria. Systematic relationships exist between chart design parameters and acuity score, and acuity score repeatability. In particular, an important feature of a chart, that largely determines the repeatability of visual acuity measurement, is the amount of size change attributed to each letter. The methods used to score visual acuity performance also affect repeatability. It is possible to evaluate acuity score validity and repeatability using the statistical principles discussed here.
Directory of Open Access Journals (Sweden)
Gotmi Sharwan
2016-09-01
Full Text Available Objectives: The goals of this research were to evaluate acute (single-dose and sub-acute (repeated-dose toxicity profiles of methanolic extract of Pistacia integerrima J. L. Stewart ex Brandis (PI for Wistar rats and to assess the safety profile of PI by observing physiological changes, mortality, changes in body weight
Scientific activity of the spanish liberal exiles in the United Kingdom, 1823-1833
Directory of Open Access Journals (Sweden)
Valera Candel, Manuel
2007-06-01
Full Text Available In 1823, after the squashing of Riego and the restoration of the absolutism of Fernando VII, most of the Spanish liberals went to England, where they carried out different scientific and technical activities. Among the émigrés there was reputed scientists, like Bauzá, Lagasca o Seoane, that in London were able to continue with their scientific activities. Other émigrés carried out an important activity of diffusion of scientific and technical advances through papers and notes that appeared in different magazines of general character published in the Spanish language; of special interest was El Museo Universal de Ciencias y Artes, directed and edited by J. J. Mora, and dedicated entirely to the scientific and technical divulgation. There was, likewise, another activity related to the scientific education, the «scientific catechisms», brief textbooks on mathematics, geography, chemistry, natural sciences, etc., directed towards elementary teaching and aimed to Latino American people, published by Ackermann. In the present work, we offer a comprehensive description of thes activities.
En 1823, tras el aplastamiento de Riego y la reinstauración del absolutismo fernandino, se produjo un exilio masivo de liberales hacia el Reino Unido, donde realizaron diversas actividades relacionadas con la ciencia y la técnica. Entre los liberales exiliados había reputados científicos, como Mariano Lagasca, Felipe Bauzá o Mateo Seoane, que en Londres pudieron proseguir con sus actividades científicas. Otros emigrados realizaron una importante labor de difusión de los adelantos científicos y técnicos a través de las diferentes revistas editadas en lengua española; entre ellas
destacó El Museo Universal de Ciencias y Artes, dirigida y redactada por J. J. de Mora, dedicada íntegramente a la divulgación científico-técnica. Hubo, finalmente, otra actividad relacionada con la educación científica, la elaboración de los
Eigenstates of complex linear combinations of J1, J2, J3 for any representation of SU(2)
International Nuclear Information System (INIS)
Bacry, H.; Technion-Israel Inst. of Tech., Haifa. Dept. of Physics)
1977-05-01
The states which minimalize the uncertainty relation ΔJ 1 ΔJ 2 >=1/2/ 3 >/ are eigenstates of complex linear combinations of J 1 and J 2 . This kind of states is shown to have a very simple geometrical interpretation in the constellation formalism. A detailed description is given in the present pap
Bonfand, M.; Belloche, A.; Menten, K. M.; Garrod, R. T.; Müller, H. S. P.
2017-08-01
Context. The Sagittarius B2 molecular cloud contains several sites forming high-mass stars. Sgr B2(N) is one of its main centers of activity. It hosts several compact and ultra-compact HII regions, as well as two known hot molecular cores (Sgr B2(N1) and Sgr B2(N2)) in the early stage of the high-mass star formation process, where complex organic molecules (COMs) are detected in the gas phase. Aims: Our goal is to use the high sensitivity of the Atacama Large Millimeter/submillimeter Array (ALMA) to characterize the hot core population in Sgr B2(N) and thereby shed new light on the star formation process in this star-forming region. Methods: We use a complete 3 mm spectral line survey conducted with ALMA to search for faint hot cores in the Sgr B2(N) region. The chemical composition of the detected sources and the column densities are derived by modeling the whole spectra under the assumption of local thermodynamic equilibrium. Population diagrams are constructed to fit rotational temperatures. Integrated intensity maps are produced to derive the peak position and fit the size of each molecule's emission distribution. The kinematic structure of the hot cores is investigated by analyzing the line wing emission of typical outflow tracers. The H2 column densities are computed from ALMA and SMA continuum emission maps. Results: We report the discovery of three new hot cores in Sgr B2(N) that we call Sgr B2(N3), Sgr B2(N4), and Sgr B2(N5). The three sources are associated with class II methanol masers, well known tracers of high-mass star formation, and Sgr B2(N5), also with a UCHII region. Their H2 column densities are found to be between approximately 16 and 36 times lower than the one of the main hot core Sgr B2(N1). The spectra of these new hot cores have spectral line densities of 11 up to 31 emission lines per GHz above the 7σ level, assigned to 22-25 molecules plus 13-20 less abundant isotopologs. We derive rotational temperatures of approximately 140-180 K for
THE {sup 7}Be ii RESONANCE LINES IN TWO CLASSICAL NOVAE V5668 SGR AND V2944 OPH
Energy Technology Data Exchange (ETDEWEB)
Tajitsu, Akito [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Sadakane, Kozo [Astronomical Institute, Osaka Kyoiku University, Asahigaoka, Kashiwara, Osaka 582-8582 (Japan); Naito, Hiroyuki [Nayoro Observatory, 157-1 Nisshin, Nayoro, Hokkaido 096-0066 (Japan); Arai, Akira; Kawakita, Hideyo [Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Aoki, Wako, E-mail: tajitsu@naoj.org [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)
2016-02-20
We report spectroscopic observations of the resonance lines of singly ionized {sup 7}Be in the blueshifted absorption line systems found in the post-outburst spectra of two classical novae—V5668 Sgr (Nova Sagittarii 2015 No. 2) and V2944 Oph (Nova Ophiuchi 2015). The unstable isotope {sup 7}Be should have been created during the thermonuclear runaway (TNR) of these novae and decayed to form {sup 7}Li within a short period (a half-life of 53.22 days). These confirmations of {sup 7}Be are the second and the third ones following the first case found in V339 Del by Tajitsu et al. The blueshifted absorption line systems in both novae are clearly divided into two velocity components, both of which contain {sup 7}Be. This means that the absorbing gases in both velocity components consist of products of TNR. We estimated the amounts of {sup 7}Be produced during the outbursts of both novae and concluded that significant {sup 7}Li should have been created. These findings strongly suggest that the explosive production of {sup 7}Li via the reaction {sup 3}He(α,γ){sup 7}Be and its subsequent decay to {sup 7}Li occurs frequently among classical novae and contributes to the process of Galactic Li enrichment.
Directory of Open Access Journals (Sweden)
Andi Sagita
2017-05-01
Full Text Available Kerang hijau merupakan komoditas budidaya laut yang sangat prospektif untuk dikembangkan pada suatu sistem budidaya, karena dapat dilakukan dengan biaya produksi yang rendah namun menghasilkan profitabilitas yang tinggi. Penelitian ini bertujuan untuk mengetahui metode dan kepadatan yang paling optimal untuk budidaya kerang hijau di perairan pesisir Kuala Langsa, Aceh. Metode penelitian menggunakan rancangan acak lengkap faktorial yang terdiri atas faktor metode (long line dan stick dan faktor kepadatan (20, 30, dan 40 individu/kantong 5,30 L, masing-masing diulang sebanyak empat kali. Berdasarkan sidik ragam data Specific Growth Rate (SGR dari panjang (SGL L dan bobot (SGR W menunjukkan semua perlakuan metode, kepadatan dan interaksi berbeda signifikan pada taraf uji 5% (P<0,05, di mana perlakuan yang paling optimal yaitu perlakuan metode long line dengan kepadatan 20 individu/kantong 5,30 L diperoleh rata-rata nilai SGR (L sebesar 0,86 ± 0,01%/hari dan SGR (W sebesar 1,18 ± 0,04%/hari dengan sintasan mencapai 92,50 ± 2,89%. Parameter kualitas perairan selama periode budidaya masih sesuai untuk mendukung kehidupan kerang hijau di mana suhu berkisar 27,5-34,0°C; salinitas 28,5-33,0 ppt; pH 7,8-8,6; dan oksigen terlarut 4,5-6,5 mg/L; serta kecepatan arus 0,1-0,3 m/s. Budidaya kerang hijau dengan metode long line pada kepadatan 20 individu/kantong 5,30 L merupakan pola budidaya yang paling optimal untuk diterapkan di perairan pesisir Kuala Langsa, Aceh. Green mussel is a very prospective marine aquaculture commodity due to its low cost production but with high profitability. This research aimed to determine the most optimal method and densities for green mussel culture in coastal waters of Kuala Langsa, Aceh. The research used a completely randomized factorial design consisting of methods factor (long line and stick and densities factor (20, 30, and 40 individuals/basket 5.30 L, each repeated four times. Based on the variance analysis of
Fostering repeat donations in Ghana.
Owusu-Ofori, S; Asenso-Mensah, K; Boateng, P; Sarkodie, F; Allain, J-P
2010-01-01
Most African countries are challenged in recruiting and retaining voluntary blood donors by cost and other complexities and in establishing and implementing national blood policies. The availability of replacement donors who are a cheaper source of blood has not enhanced repeat voluntary donor initiatives. An overview of activities for recruiting and retaining voluntary blood donors was carried out. Donor records from mobile sessions were reviewed from 2002 to 2008. A total of 71,701 blood donations; 45,515 (63.5%) being voluntary donations with 11,680 (25%) repeat donations were collected during the study period. Donations from schools and colleges contributed a steady 60% of total voluntary whilst radio station blood drives increased contribution from 10 to 27%. Though Muslim population is less than 20%, blood collection was above the 30-donation cost-effectiveness threshold with a repeat donation trend reaching 60%. In contrast Christian worshippers provided donations. Repeat donation trends amongst school donors and radio blood drives were 20% and 70% respectively. Repeat donations rates have been variable amongst different blood donor groups in Kumasi, Ghana. The impact of community leaders in propagating altruism cannot be overemphasized. Programs aiming at motivating replacement donors to be repeat donors should be developed and assessed. Copyright 2009 The International Association for Biologicals. All rights reserved.
J. L.
2005-01-01
Raadio 2aasta menukamate lugude edetabelis sai esikoha ansambel Nexus looga "Hingetuna", järgnesid Toe Tag "Legendaarne" ja Inese "15 magamata ööd"; parim lääne lugu Rammsteini "Ameerika". Raadio Uno edetabelis esikohal Inese "15 magamata ööd", järgnesid Nexuse "Hingetuna" ja moldaavlaste "Dragostea Din Tei"
International Nuclear Information System (INIS)
Teixeira, Valeria Wanderley
1998-01-01
The objective of this research was to evaluate the effects of different gamma doses of Cobalt-60 on arcelin protein in the manifestation of resistance to Zabrotes subfasciatus (Boh., 1833). Seeds of four lines of Phaseolus vulgaris carriers of arcelin protein (Arcelin-1, Arcelin-2, Arcelin-3 and Arcelin-4) and a cultivar without this protein were used as control (IAC-Carioca Akyta) obtained from the Instituto Agronomico do Estado de Sao Paulo - Nucleo Experimental de Campinas (IAC), were irradiated in a source of Cobalt-60, of the panoramic type, from the Instituto de Pesquisas Energeticas e Nucleares/CNEN/SP. The activity was approximately 2218.79 Ci, and the dose rate 0.678 kGy/h. The doses used were 0; 0.25; 0.5; 1.0 and 2.0 kGy. The results showed that the radiation doses did not influence the parameters evaluated in the resistance because a high degree of antibiose in the Arcelin-1 and Arcelin-2 lines was maintained. The Arcelin-3 and Arcelin-4 lines also maintained their behavior less expressive of resistance by antibiose only prolonging the period from egg to adult. The electrophoretic analysis of the lines and cultivar were not changed in relation to the radiation doses. But there was a decrease in relation to the intensity of color of the bands (absorbance) with the increase of the doses. (author)
Musiikkitapahtuman järjestäminen järjestäjän näkökulmasta
Koskelo, Jermo
2012-01-01
Tämä opinnäytetyö on puoliksi toiminnallinen tutkielma musiikkitapahtuman järjestämisestä ja se sisältää kaksi osiota. Ensimmäisessä osassa käsitellään musiikkitapahtuman järjestämistä yleisesti ja toinen osa antaa konkreettisen esimerkin jo järjestetystä musiikkitapahtumasta ja sen vaiheista. Tutkielman tarkoituksena on antaa perusteellinen käsitys musiikkitapahtuman järjestämisestä. Tapahtuman järjestämisen kannalta on erityisen tärkeää anoa kaikki tarvittavat luvat ennen kuin aloitetaan...
A Nonthermal Radio Filament Connected to the Galactic Black Hole?
Morris, Mark R.; Zhao, Jun-Hui; Goss, W. M.
2017-12-01
Using the Very Large Array, we have investigated a nonthermal radio filament (NTF) recently found very near the Galactic black hole and its radio counterpart, Sgr A*. While this NTF—the Sgr A West Filament (SgrAWF)—shares many characteristics with the population of NTFs occupying the central few hundred parsecs of the Galaxy, the SgrAWF has the distinction of having an orientation and sky location that suggest an intimate physical connection to Sgr A*. We present 3.3 and 5.5 cm images constructed using an innovative methodology that yields a very high dynamic range, providing an unprecedentedly clear picture of the SgrAWF. While the physical association of the SgrAWF with Sgr A* is not unambiguous, the images decidedly evoke this interesting possibility. Assuming that the SgrAWF bears a physical relationship to Sgr A*, we examine the potential implications. One is that Sgr A* is a source of relativistic particles constrained to diffuse along ordered local field lines. The relativistic particles could also be fed into the local field by a collimated outflow from Sgr A*, perhaps driven by the Poynting flux accompanying the black hole spin in the presence of a magnetic field threading the event horizon. Second, we consider the possibility that the SgrAWF is the manifestation of a low-mass-density cosmic string that has become anchored to the black hole. The simplest form of these hypotheses would predict that the filament be bi-directional, whereas the SgrAWF is only seen on one side of Sgr A*, perhaps because of the dynamics of the local medium.
Repeated DNA sequences in fungi
Energy Technology Data Exchange (ETDEWEB)
Dutta, S K
1974-11-01
Several fungal species, representatives of all broad groups like basidiomycetes, ascomycetes and phycomycetes, were examined for the nature of repeated DNA sequences by DNA:DNA reassociation studies using hydroxyapatite chromatography. All of the fungal species tested contained 10 to 20 percent repeated DNA sequences. There are approximately 100 to 110 copies of repeated DNA sequences of approximately 4 x 10/sup 7/ daltons piece size of each. Repeated DNA sequence homoduplexes showed on average 5/sup 0/C difference of T/sub e/50 (temperature at which 50 percent duplexes dissociate) values from the corresponding homoduplexes of unfractionated whole DNA. It is suggested that a part of repetitive sequences in fungi constitutes mitochondrial DNA and a part of it constitutes nuclear DNA. (auth)
Topological characteristics of helical repeat proteins
Groves, M R; Barford, D
The recent elucidation of protein structures based upon repeating amino acid motifs, including the armadillo motif, the HEAT motif and tetratricopeptide repeats, reveals that they belong to the class of helical repeat proteins. These proteins share the common property of being assembled from tandem
International Nuclear Information System (INIS)
Nomoto, Ryohei; Tezuka, Takeaki; Miyazono, Ken-ichi; Tanokura, Masaru; Horinouchi, Sueharu; Ohnishi, Yasuo
2012-01-01
A Streptomyces homologue of the mycobacterial integration host factor mIHF was heterologously produced, purified and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The best crystal diffracted X-rays to 2.22 Å resolution and belonged to space group C2. The mycobacterial integration host factor (mIHF) is a small nonspecific DNA-binding protein that is essential for the growth of Mycobacterium smegmatis. mIHF homologues are widely distributed among Actinobacteria, and a Streptomyces homologue of mIHF is involved in control of sporulation and antibiotic production in S. coelicolor A3(2). Despite their important biological functions, a structure of mIHF or its homologues has not been elucidated to date. Here, the S. griseus mIHF homologue (SGR6054) was expressed and purified from Escherichia coli and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The plate-shaped crystal belonged to space group C2, with unit-cell parameters a = 88.53, b = 69.35, c = 77.71 Å, β = 96.63°, and diffracted X-rays to 2.22 Å resolution
Energy Technology Data Exchange (ETDEWEB)
Nomoto, Ryohei; Tezuka, Takeaki; Miyazono, Ken-ichi; Tanokura, Masaru; Horinouchi, Sueharu; Ohnishi, Yasuo [Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657 (Japan)
2012-08-31
A Streptomyces homologue of the mycobacterial integration host factor mIHF was heterologously produced, purified and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The best crystal diffracted X-rays to 2.22 Å resolution and belonged to space group C2. The mycobacterial integration host factor (mIHF) is a small nonspecific DNA-binding protein that is essential for the growth of Mycobacterium smegmatis. mIHF homologues are widely distributed among Actinobacteria, and a Streptomyces homologue of mIHF is involved in control of sporulation and antibiotic production in S. coelicolor A3(2). Despite their important biological functions, a structure of mIHF or its homologues has not been elucidated to date. Here, the S. griseus mIHF homologue (SGR6054) was expressed and purified from Escherichia coli and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The plate-shaped crystal belonged to space group C2, with unit-cell parameters a = 88.53, b = 69.35, c = 77.71 Å, β = 96.63°, and diffracted X-rays to 2.22 Å resolution.
VizieR Online Data Catalog: Srg tidal tails red giants properties (Zhang+, 2017)
Zhang, X.; Shi, W. B.; Chen, Y. Q.; Zhao, G.; Carrell, K.; Zhao, J. K.; Ruan, G. P.; Liang, Y. C.; Zhou, L.; Ren, H. B.; Zhang, Y.; Hou, Y. H.; Wang, Y. F.
2016-10-01
The list of 1100 RGB stars in Sgr streams is selected from SDSS DR9 with Law & Majewski (2010ApJ...714..229L) model. For each star equatorial coordinates, [Fe/H], distance, Vgsr, Lambda, X, Y and Z are given. Each star is also marked with L1, L2, T1, T2 to show in which stream it locates. (1 data file).
Evaluation of tandem repeats for MLVA typing of Streptococcus uberis isolated from bovine mastitis
Directory of Open Access Journals (Sweden)
Lamoureux Jérémy
2006-11-01
Full Text Available Abstract Background Streptococcus uberis is a common cause of bovine mastitis and recommended control measures, based on improved milking practice, teat dipping and antibiotic treatment at drying-off, are poorly efficient against this environmental pathogen. A simple and efficient typing method would be helpful in identifying S.uberis sources, virulent strains and cow to cow transmission. The potential of MLVA (Multiple Loci VNTR Analysis; VNTR, Variable Number of Tandem Repeats for S. uberis mastitis isolates genotyping was investigated. Results The genomic sequence of Streptococcus uberis (strain 0104J was analyzed for potential variable number tandem repeats (VNTRs. Twenty-five tandem repeats were identified and amplified by PCR with DNA samples from 24 S. uberis strains. A set of seven TRs were found to be polymorphic and used for MLVA typing of 88 S. uberis isolates. A total of 82 MLVA types were obtained with 22 types among 26 strains isolated from the milk of mastitic cows belonging to our experimental herd, and 61 types for 62 epidemiologically unrelated strains, i.e. collected in different herds and areas. Conclusion The MLVA method can be applied to S. uberis genotyping and constitutes an interesting complement to existing typing methods. This method, which is easy to perform, low cost and can be used in routine, could facilitate investigations of the epidemiology of S. uberis mastitis in dairy cows.
UK 2009-2010 repeat station report
Directory of Open Access Journals (Sweden)
Thomas J.G. Shanahan
2013-03-01
Full Text Available The British Geological Survey is responsible for conducting the UK geomagnetic repeat station programme. Measurements made at the UK repeat station sites are used in conjunction with the three UK magnetic observatories: Hartland, Eskdalemuir and Lerwick, to produce a regional model of the local field each year. The UK network of repeat stations comprises 41 stations which are occupied at approximately 3-4 year intervals. Practices for conducting repeat station measurements continue to evolve as advances are made in survey instrumentation and as the usage of the data continues to change. Here, a summary of the 2009 and 2010 UK repeat station surveys is presented, highlighting the measurement process and techniques, density of network, reduction process and recent results.
Reject/repeat analysis and the effect prior film viewing has on a department's reject/repeat rate
International Nuclear Information System (INIS)
Clark, P.A.; Hogg, P.
2003-01-01
Purpose: Achieving cost-effectiveness within the NHS is an old initiative but one that has again been highlighted by recent government policies (The New NHS-Modern and Dependable, Stationary Office, London, 1997). It has been reiterated that it is the responsibility of individual Trusts to devise means to provide such a service. Reject/repeat analyses have long been the primary tool used to assess the cost-effectiveness of radiography departments (Quality Assurance in Diagnostic Radiology, WHO, Geneva, 1982). This research paper examines an in-house initiative (viewing patients' previous films) commonly employed in other Health Trusts in order to reduce departmental repeat/reject rates. Method: Three hundred orthopaedic patients with hip, knee and ankle prostheses were included in a reject/repeat analysis. The aim was to investigate whether or not viewing patient's previous relevant radiographs would be advantageous to the practicing radiographer. This was done through an audit cycle consisting of two audit periods each lasting for 3 months. The primary audit period recorded the baseline repeat/reject rate, with the secondary audit period recording the repeat/reject rate under an experimental condition of viewing the relevant radiographs. Results: The baseline audit revealed repeat rates of 33% in orthopaedic patients with hip, knee and ankle prostheses. The availability of prior film viewing to the radiographer reduced this repeat rate to 10.6%. Conclusion: Prior film viewing dramatically reduced the department's repeat/reject rate by 22.4%. This provides scope for significant patient dose reductions as well as reducing departmental film expenses. This is an underestimated initiative and should be used appropriately in routine clinical practice
Chlorophyll a is a favorable substrate for Chlamydomonas Mg-dechelatase encoded by STAY-GREEN.
Matsuda, Kaori; Shimoda, Yousuke; Tanaka, Ayumi; Ito, Hisashi
2016-12-01
Mg removal from chlorophyll by Mg-dechelatase is the first step of chlorophyll degradation. Recent studies showed that in Arabidopsis, Stay Green (SGR) encodes Mg-dechelatase. Though the Escherichia coli expression system is advantageous for investigating the properties of Mg-dechelatase, Arabidopsis Mg-dechelatase is not successfully expressed in E. coli. Chlamydomonas reinhardtii SGR (CrSGR) has a long, hydrophilic tail, suggesting that active CrSGR can be expressed in E. coli. After the incubation of chlorophyll a with CrSGR expressed in E. coli, pheophytin a accumulated, indicating that active CrSGR was expressed in E. coli. Substrate specificity of CrSGR against chlorophyll b and an intermediate molecule of the chlorophyll b degradation pathway was examined. CrSGR exhibited no activity against chlorophyll b and low activity against 7-hydroxymethyl chlorophyll a, consistent with the fact that chlorophyll b is degraded only after conversion to chlorophyll a. CrSGR exhibited low activity against divinyl chlorophyll a and chlorophyll a', and no activity against chlorophyllide a, protochlorophyll a, chlorophyll c 2 , and Zn-chlorophyll a. These observations indicate that chlorophyll a is the most favorable substrate for CrSGR. When CrSGR was expressed in Arabidopsis cells, the chlorophyll content decreased, further confirming that SGR has Mg-dechelating activity in chloroplasts. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Manco, Licínio; Albuquerque, Joana; Sousa, Maria Francisca; Martiniano, Rui; de Oliveira, Ricardo Costa; Marques, Sofia; Gomes, Verónica; Amorim, António; Alvarez, Luís; Prata, Maria João
2018-03-01
We examined internal lineages and haplotype diversity in Portuguese samples belonging to J-M304 to improve the spatial and temporal understanding of the introduction of this haplogroup in Iberia, using the available knowledge about the phylogeography of its main branches, J1-M267 and J2-M172. A total of 110 males of Portuguese descent were analyzed for 17 Y-chromosome bi-allelic markers and seven Y-chromosome short tandem repeats (Y-STR) loci. Among J1-M267 individuals (n = 36), five different sub-haplogroups were identified, with the most common being J1a2b2-L147.1 (∼72%), which encompassed the majority of representatives of the J1a2b-P58 subclade. One sample belonged to the rare J1a1-M365.1 lineage and presented a core Y-STR haplotype consistent with the Iberian settlement during the fifth century by the Alans, a people of Iranian heritage. The analysis of J2-M172 Portuguese males (n = 74) enabled the detection of the two main subclades at very dissimilar frequencies, J2a-M410 (∼80%) and J2b-M12 (∼20%), among which the most common branches were J2a1(xJ2a1b,h)-L26 (22.9%), J2a1b(xJ2a1b1)-M67 (20.3%), J2a1h-L24 (27%), and J2b2-M241 (20.3%). While previous inferences based on modern haplogroup J Y-chromosomes implicated a main Neolithic dissemination, here we propose a later arrival of J lineages into Iberia using a combination of novel Portuguese Y-chromosomal data and recent evidence from ancient DNA. Our analysis suggests that a substantial tranche of J1-M267 lineages was likely carried into the Iberian Peninsula as a consequence of the trans-Mediterranean contacts during the first millennium BC, while most of the J2-M172 lineages may be associated with post-Neolithic population movements within Europe. © 2017 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Daniel Brice Kenko Nkontcheu
2017-09-01
Full Text Available Agriculture is the main activity carried out in Cameroon and pesticide use is believed to be a common rule for its success. Most of the farms are situated close to water bodies, thus constituting a potential risk to non-target aquatic organisms. Declines of amphibian populations have been a worldwide issue of concern for the scientific community during the last several decades. The aim of this study was to assess the effects of an insecticide used by local farmers in Buea on amphibians. Parastar 40WP® which is constituted of imidacloprid + lambda-cyhalothrin a commonly used insecticide was applied on tadpoles of the African common toad Amietophrynus regularis (Reuss, 1833 in a static renewal experiment. The acute toxicity test was carried out after a range finding test from which seven test concentrations were selected. These concentrations were 0.0025mg/l, 0.005mg/l, 0.01mg/l, 0.05mg/l, 0.1mg/l, 0.5mg/l and 0.2mg/l. Signs of toxicity such as hyperactive symptoms, loss of balance, motionlessness and death were recorded. A varying degree of mortality (dose-dependent was noticed during the test. On the contrary, no such toxicity signs and mortality occurred in the control, indicating that they were caused by the test substance. The 24h LC50 was 3.66mg/l, which is less than the recommended application dose (125mg/l. Products constituted of imidacloprid and lambda-cyhalothrin should therefore be handled with care and far from water bodies because of their potential to cause harm to non-target aquatic biota.
DEFF Research Database (Denmark)
Fuchs, Christian; Monticelli, Lara
2018-01-01
This introduction sets out the context of the special issue “Karl Marx @ 200: Debating Capitalism & Perspectives for the Future of Radical Theory”, which was published on the occasion of Marx’s bicentenary on 5 May 2018. First, we give a brief overview of contemporary capitalism’s development...... and its crises. Second, we argue that it is important to repeat Marx today. Third, we reflect on lessons learned from 200 years of struggles for alternatives to capitalism. Fourth, we give an overview of the contributions in this special issue. Taken together, the contributions in this special issue show...... that Marx’s theory and politics remain key inspirations for understanding exploitation and domination in 21st-century society and for struggles that aim to overcome these phenomena and establishing a just and fair society. We need to repeat Marx today....
Energy Technology Data Exchange (ETDEWEB)
Chan, Chi-Kwan; Psaltis, Dimitrios; Özel, Feryal [Steward Observatory and Department of Astronomy, University of Arizona, 933 N. Cherry Ave., Tucson, AZ 85721 (United States); Narayan, Ramesh [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Sadowski, Aleksander, E-mail: chanc@email.arizona.edu [MIT Kavli Institute for Astrophysics and Space Research, 77 Massachusetts Ave., Cambridge, MA 02139 (United States)
2015-01-20
Recent advances in general relativistic magnetohydrodynamic simulations have expanded and improved our understanding of the dynamics of black-hole accretion disks. However, current simulations do not capture the thermodynamics of electrons in the low density accreting plasma. This poses a significant challenge in predicting accretion flow images and spectra from first principles. Because of this, simplified emission models have often been used, with widely different configurations (e.g., disk- versus jet-dominated emission), and were able to account for the observed spectral properties of accreting black holes. Exploring the large parameter space introduced by such models, however, requires significant computational power that exceeds conventional computational facilities. In this paper, we use GRay, a fast graphics processing unit (GPU) based ray-tracing algorithm, on the GPU cluster El Gato, to compute images and spectra for a set of six general relativistic magnetohydrodynamic simulations with different magnetic field configurations and black-hole spins. We also employ two different parametric models for the plasma thermodynamics in each of the simulations. We show that, if only the spectral properties of Sgr A* are used, all 12 models tested here can fit the spectra equally well. However, when combined with the measurement of the image size of the emission using the Event Horizon Telescope, current observations rule out all models with strong funnel emission, because the funnels are typically very extended. Our study shows that images of accretion flows with horizon-scale resolution offer a powerful tool in understanding accretion flows around black holes and their thermodynamic properties.
Analysis of repeated measures data
Islam, M Ataharul
2017-01-01
This book presents a broad range of statistical techniques to address emerging needs in the field of repeated measures. It also provides a comprehensive overview of extensions of generalized linear models for the bivariate exponential family of distributions, which represent a new development in analysing repeated measures data. The demand for statistical models for correlated outcomes has grown rapidly recently, mainly due to presence of two types of underlying associations: associations between outcomes, and associations between explanatory variables and outcomes. The book systematically addresses key problems arising in the modelling of repeated measures data, bearing in mind those factors that play a major role in estimating the underlying relationships between covariates and outcome variables for correlated outcome data. In addition, it presents new approaches to addressing current challenges in the field of repeated measures and models based on conditional and joint probabilities. Markov models of first...
Recognition of base J in duplex DNA by J-binding protein
Sabatini, Robert; Meeuwenoord, Nico; van Boom, Jacques H.; Borst, Piet
2002-01-01
beta-d-Glucosylhydroxymethyluracil, also called base J, is an unusual modified DNA base conserved among Kinetoplastida. Base J is found predominantly in repetitive DNA and correlates with epigenetic silencing of telomeric variant surface glycoprotein genes. We have previously found a J-binding
Rull, Anna; Martínez-Bujidos, Maria; Pérez-Cuellar, Montserrat; Pérez, Antonio; Ordóñez-Llanos, Jordi; Sánchez-Quesada, José Luis
2015-08-01
Clusterin/apolipoprotein J (apoJ) circulates in blood in part associated to lipoproteins or in unbound form. When bound to HDL, apoJ is antiatherogenic by inhibiting endothelial cell apoptosis; thus, any factor modifying apoJ association to HDL would decrease its antiatherogenic function. However, the exact distribution of apoJ in each lipoprotein fraction, or in lipoprotein-non bound form has not been specifically investigated either in normolipemia or in dyslipemia. Basic lipid profile and apoJ concentration were determined in sera from 70 subjects, including a wide range of cholesterol and triglyceride concentrations. Lipoproteins were isolated by ultracentrifugation and their lipid and apolipoprotein composition was assessed. In the overall population, serum apoJ positively associated with cholesterol, triglyceride and VLDL-C concentrations, and HDL-C and triglyceride were independent predictors of increased apoJ concentration. Approximately, 20.5% of circulating apoJ was associated with lipoproteins (18.5% HDL, 0.9% LDL and 1.1% VLDL) and 79.5% was not bound to lipoproteins. Serum apoJ concentration was higher in hypercholesterolemic (HC), hypertriglyceridemic (HTG) and combined hyperlipidemic (CHL) sera compared to normolipemic (NL) sera (HC, 98.15 ± 33.6 mg/L; HTG, 103.3 ± 36.8 mg/L; CHL, 131.7 ± 26.8 mg/L; NL, 66.7 ± 33.8 mg/L; P lipoproteins in the NL group whereas this proportion rounded 15% in hyperlipidemic subjects. Our findings indicate that hyperlipidemia increases the concentration of apoJ in serum but, in turn, the content of lipoprotein-associated apoJ decreases. The redistribution of apoJ in hyperlipidemia could compromise the antiatherogenic properties of HDL. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Number of states with given spin J of n fermions in a j orbit
International Nuclear Information System (INIS)
Talmi, Igal
2005-01-01
A recursion formula for the number of states with a given value of total spin J of n identical fermions in a j orbit, N(J,j,n), is derived. That number is expressed in terms of the number of states with some values of J, of n,n-1, and n-2 fermions in a (j-1) orbit. This formula may be used in calculating N(J,j,n). In this paper the formula is used to prove some interesting results that were found empirically by Zhao and Arima
Directory of Open Access Journals (Sweden)
Renata Wilgosiewicz-Skutecka
2011-01-01
Full Text Available W zbiorach rękopisów przechowywanych w Bibliotece Uniwersyteckiej w Poznaniu znajdują się trzy tomy wspomnień Claude’a Antoine’a Pocharda – francuskiego księdza, żyjącego w czasach rewolucji francuskiej, należącego do prêtres réfractaires i w roku 1792 zmuszonego do opuszczenia ojczyzny. W latach 1792–1796 pozostawał on na emigracji w Szwajcarii, później przyjął posadę guwernera synów Józefa Skórzewskiego, starosty gnieźnieńskiego, i Heleny z Lipskich Skórzewskiej. Zapiski księdza Pocharda prowadzone w latach 1792–1833 dotyczą obu tych okresów. Ich lektura daje możliwość śledzenia losów duchownego w trudnych czasach rewolucyjnych, a także zagłębienia się w relacje naocznego świadka wydarzeń z życia rodzinnego Skórzewskich, wydarzeń ukazanych w szerszym kontekście historycznym – polskim i europejskim. Artykuł jest wprowadzeniem do badania tych rękopisów jako wielowątkowego materiału mogącego zainteresować zarówno literaturoznawców, jak i historyków, pozwalającego weryfikować wiedzę i stawiać hipotezy dotyczące dziejów jednego z najznamienitszych rodów wielkopolskich.
Recreating the chemical evolution of the Sagittarius dwarf spheroidal from its tidal debris
Carlin, Jeffrey L.; Sheffield, Allyson; Cunha, Katia M. L.; Smith, Verne V.
2018-06-01
We present a detailed chemical analysis of the Sagittarius (Sgr) tidal stream based on high-resolution Gemini+GRACES spectra of 42 members of the highest surface brightness portions of both the trailing and leading arms of the Sgr stream. We select Sgr tidal stream candidates using a 2MASS+WISE color-color selection, combined with LAMOST radial velocities, allowing us to efficiently select Sgr stream members with little contamination from field stars. Sgr is a recently infallen, currently disrupting dwarf spheroidal galaxy, with roughly 70% of the luminosity of the Sgr system residing in the tidal streams. With this study, we provide a link between the (known) chemical properties in the intact Sgr core and the significant portion of the Sgr system's luminosity that is estimated to currently reside in the streams. In this talk, we focus on abundances of alpha-elements, but we will also analyze neutron-capture (both r- and s-process) and iron-peak species. We compare our chemical abundances to the few existing measurements in the stream as well as the numerous results in the Sgr core.
simple sequence repeats (EST-SSR)
African Journals Online (AJOL)
Yomi
2012-01-19
Jan 19, 2012 ... 212 primer pairs selected, based on repeat patterns of n≥8 for di-, tri-, tetra- and penta-nucleotide repeat ... Cluster analysis revealed a high genetic similarity among the sugarcane (Saccharum spp.) breeding lines which could reduce the genetic gain in ..... The multiple allele characteristic of SSR com-.
Nifty Nines and Repeating Decimals
Brown, Scott A.
2016-01-01
The traditional technique for converting repeating decimals to common fractions can be found in nearly every algebra textbook that has been published, as well as in many precalculus texts. However, students generally encounter repeating decimal numerals earlier than high school when they study rational numbers in prealgebra classes. Therefore, how…
Repeated Prescribed Burning in Aspen
Donald A. Perala
1974-01-01
Infrequent burning weather, low flammability of the aspen-hardwood association, and prolific sprouting and seeding of shrubs and hardwoods made repeated dormant season burning a poor tool to convert good site aspen to conifers. Repeat fall burns for wildlife habitat maintenance is workable if species composition changes are not important.
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. J Karuppiah. Articles written in Journal of Chemical Sciences. Volume 124 Issue 4 July 2012 pp 841-845. Nonthermal plasma assisted photocatalytic oxidation of dilute benzene · J Karuppiah E Linga Reddy L Sivachandiran R Karvembu Ch Subrahmanyam · More Details ...
The t-J model at small t/j: Numerical, perturbative, and supersymmetric results
International Nuclear Information System (INIS)
Barnes, T.; Tennessee Univ., Knoxville, TN
1991-02-01
We discuss some recent results for one- and two-hole states in the t-J model at small t/J. These include numerical results (bandwidth determinations and accurate t/J values for 4 x 4 lattice one-hole ground-state level crossings), hopping-parameter perturbation theory (which gives the small-t/J one-hole bandwidth in terms of the static-vacancy ground state), and results at the supersymmetric point t/J = 1/2 (exact results for energies and bandwidths.) The perturbative results leads us to a new conjecture regarding the staggered magnetization of higher-spin states in the two-dimensional Heisenberg model. We also discuss extrapolation of small-t/J results to high-T c parameter values; in the two-hole ground states we find (t/J) λ behavior in the rms hole-hole separation, and an extrapolation to t/J = 3 gives a bulk-limit rms hole-hole separation of ∼ 7 angstrom. 18 refs., 6 figs
Testing J/PSI production mechanisms in B -> J/PSI + X
Ko, P W; Song, H S
1999-01-01
Using the color evaporation model (CEM), we consider the decay rate of B -> J/PSI + X and the polarization of J/PSI therein, and we compare the results with the data and with the predictions by the nonrelativistic quantum chromodynamics (NRQCD) approach. In the CEM, we use the input parameter determined from photo/hadro productions of J/PSI, and we find that it is difficult to make the CEM predictions confront with the CLEO data on these observables.
Identification of ALV-J associated acutely transforming virus Fu-J carrying complete v-fps oncogene.
Wang, Yixin; Li, Jianliang; Li, Yang; Fang, Lichun; Sun, Xiaolong; Chang, Shuang; Zhao, Peng; Cui, Zhizhong
2016-06-01
Transduction of oncogenes by ALVs and generation of acute transforming viruses is common in natural viral infections. In order to understand the molecular basis for the rapid oncogenicity of Fu-J, an acutely transforming avian leukosis virus isolated from fibrosarcomas in crossbreed broilers infected with subgroup J avian leukosis virus (ALV-J) in China, complete genomic structure of Fu-J virus was determined by PCR amplification and compared with those of Fu-J1, Fu-J2, Fu-J3, Fu-J4, and Fu-J5 reported previously. The results showed that the genome of Fu-J was defective, with parts of gag gene replaced by the complete v-fps oncogene and encoded a 137 kDa Gag-fps fusion protein. Sequence analysis revealed that Fu-J and Fu-J1 to Fu-J5 were related quasi-species variants carrying different lengths of v-fps oncogenes generated from recombination between helper virus and c-fps gene. Comparison of virus carrying v-fps oncogene also gave us a glimpse of the molecular characterization and evolution process of the acutely transforming ALV.
The Pentapeptide Repeat Proteins
Vetting, Matthew W.; Hegde, Subray S.; Fajardo, J. Eduardo; Fiser, Andras; Roderick, Steven L.; Takiff, Howard E.; Blanchard, John S.
2006-01-01
The Pentapeptide Repeat Protein (PRP) family has over 500 members in the prokaryotic and eukaryotic kingdoms. These proteins are composed of, or contain domains composed of, tandemly repeated amino acid sequences with a consensus sequence of [S,T,A,V][D,N][L,F]-[S,T,R][G]. The biochemical function of the vast majority of PRP family members is unknown. The three-dimensional structure of the first member of the PRP family was determined for the fluoroquinolone resistance protein (MfpA) from Myc...
Pinch density measurements in compact plasma foci of 400J and 50J
International Nuclear Information System (INIS)
Tarifeño-Saldivia, Ariel; Pavez, Cristian; Soto, Leopoldo
2014-01-01
A Mach-Zehnder interferometer using a pulsed Nd-YAG laser (600 mJ, 532 nm, 8 ns) was implemented to measure the electron density and the dimensions of the pinch column in two sub-kJ compact plasma focus devices operating at hundred joules (PF-400J) and tens of joules (PF-50J).
Indian Academy of Sciences (India)
Journal of Genetics, Vol. 85, No. 2, August 2006. 101. Page 2. J. Genet. classic. 102. Journal of Genetics, Vol. 85, No. 2, August 2006. Page 3. J. Genet. classic. Journal of Genetics, Vol. 85, No. 2, August 2006. 103. Page 4. J. Genet. classic. 104. Journal of Genetics, Vol. 85, No. 2, August 2006. Page 5. J. Genet. classic.
Indian Academy of Sciences (India)
Unknown
Journal of Genetics, Vol. 84, No. 1, April 2005. 37. Page 2. J. Genet. classic. Journal of Genetics, Vol. 84, No. 1, April 2005. 38. Page 3. J. Genet. classic. Journal of Genetics, Vol. 84, No. 1, April 2005. 39. Page 4. J. Genet. classic. Journal of Genetics, Vol. 84, No. 1, April 2005. 40. Page 5. J. Genet. classic. Journal of ...
Griffen, Corbin; Rogerson, David; Ranchordas, Mayur; Ruddock, Alan
2015-06-01
This study investigated the effects of creatine and sodium bicarbonate coingestion on mechanical power during repeated sprints. Nine well-trained men (age = 21.6 ± 0.9 yr, stature = 1.82 ± 0.05 m, body mass = 80.1 ±12.8 kg) participated in a double-blind, placebo-controlled, counterbalanced, crossover study using six 10-s repeated Wingate tests. Participants ingested either a placebo (0.5 g·kg(-1) of maltodextrin), 20 g·d(-1) of creatine monohydrate + placebo, 0.3 g·kg(-1) of sodium bicarbonate + placebo, or coingestion + placebo for 7 days, with a 7-day washout between conditions. Participants were randomized into two groups with a differential counterbalanced order. Creatine conditions were ordered first and last. Indices of mechanical power output (W), total work (J) and fatigue index (W·s(-1)) were measured during each test and analyzed using the magnitude of differences between groups in relation to the smallest worthwhile change in performance. Compared with placebo, both creatine (effect size (ES) = 0.37-0.83) and sodium bicarbonate (ES = 0.22-0.46) reported meaningful improvements on indices of mechanical power output. Coingestion provided small meaningful improvements on indices of mechanical power output (W) compared with sodium bicarbonate (ES = 0.28-0.41), but not when compared with creatine (ES = -0.21-0.14). Coingestion provided a small meaningful improvement in total work (J; ES = 0.24) compared with creatine. Fatigue index (W·s(-1)) was impaired in all conditions compared with placebo. In conclusion, there was no meaningful additive effect of creatine and sodium bicarbonate coingestion on mechanical power during repeated sprints.
Verma, Ajay; Baishya, Bikash
2016-05-01
;Pure shift; NMR spectra display singlet peak per chemical site. Thus, high resolution is offered at the cost of valuable J-coupling information. In the present work, real-time BIRD (BIlinear Rotation Decoupling) is applied to the absorptive-mode 2D J-spectroscopy to provide pure shift spectrum in the direct dimension and J-coupling information in the indirect dimension. Quite often in metabolomics, proton NMR spectra from complex bio-fluids display tremendous signal overlap. Although conventional J-spectroscopy in principle overcomes this problem by separating the multiplet information from chemical shift information, however, only magnitude mode of the experiment is practical, sacrificing much of the potential high resolution that could be achieved. Few J-spectroscopy methods have been reported so far that produce high-resolution pure shift spectrum along with J-coupling information for crowded spectral regions. In the present work, high-quality J-resolved spectrum from important metabolomic mixture such as tissue extract from rat cortex is demonstrated. Many low-intensity metabolite peaks which are obscured by the broad dispersive tails from high-intensity metabolite peaks in regular magnitude mode J-spectrum can be clearly identified in real-time BIRD J-resolved spectrum. The general practice of removing such spectral overlap is tedious and time-consuming as it involves repeated sample preparation to change the pH of the tissue extract sample and subsequent spectra recording.
International Nuclear Information System (INIS)
Atavales, J. B. G.
1995-01-01
A preliminary measurement of the ratio of branching ratios BR(B + → J/ψK + )/BR(B 0 → J/ψK 0 ) and BR(B + → J/ψK + )/BR(B + → J/ψK *+ ) is made by fully reconstructing each mode, where J/ψ → μ + μ - , K *+ → K 0 s π + and K 0 s → π + π - . The data were taken with the CDF detector during the 1993 run. The total integrated luminosity is ∼ 20pb -1 resulting in a sample of about 170 J/ψK ± , 50 J/ψK 0 S and 25 J/ψK *± candidate events. The results will be reported
Science and Photography Linked in iPad and iPhone Apps About Climate Change and Repeat Photography
Braasch, G.; Hone, B.
2014-12-01
Red Hill Studio and World View of Global Warming co-developed apps for the iPad and iPhone which graphically show climate-driven changes in repeat photographs and maps. The climate app, with 17 interactive screens that show climate changes to glaciers, coasts, rivers and world temperature, reaches a new part of the public, was featured in USA Today and is used in schoolrooms and museums. It led a list of top ten climate apps for 2012. The low price for this app encourages more users and income is being shared with the Union of Concerned Scientists. Red Hill Studio is also developing an app which is an aid for making time series and repeat photography. The Now & Then Cam app will allow scientists and citizens to take closely aligned repeat photos by overlaying the iPad/iPhone's camera image on top of an archival photo. This guides the photographer back towards the original location of the archival shot - leading to a more carefully aligned repeat photograph. The developers hope this app will contribute to both scientific and artistic creation of time-series photographs, an important and persuasive visualization of change. The Painting with Time and Now & Then Cam apps build upon a traveling museum exhibition, Playing with Time, and an international documentary special, Exploring Time, that were developed by Red Hill Studios under grants from the National Science Foundation. The app programmers, Charlie Brown and J.A. Nelson, use Objective C to create fluid, responsive interfaces with no distracting latencies or delays. World View of Global Warming is an independent photojournalistic documentation of global warming and rapid climate change begun in 1999. Repeat and time-series photography is an integral part it its climate communication.
In situ detection of tandem DNA repeat length
Energy Technology Data Exchange (ETDEWEB)
Yaar, R.; Szafranski, P.; Cantor, C.R.; Smith, C.L. [Boston Univ., MA (United States)
1996-11-01
A simple method for scoring short tandem DNA repeats is presented. An oligonucleotide target, containing tandem repeats embedded in a unique sequence, was hybridized to a set of complementary probes, containing tandem repeats of known lengths. Single-stranded loop structures formed on duplexes containing a mismatched (different) number of tandem repeats. No loop structure formed on duplexes containing a matched (identical) number of tandem repeats. The matched and mismatched loop structures were enzymatically distinguished and differentially labeled by treatment with S1 nuclease and the Klenow fragment of DNA polymerase. 7 refs., 4 figs.
Automated genotyping of dinucleotide repeat markers
Energy Technology Data Exchange (ETDEWEB)
Perlin, M.W.; Hoffman, E.P. [Carnegie Mellon Univ., Pittsburgh, PA (United States)]|[Univ. of Pittsburgh, PA (United States)
1994-09-01
The dinucleotide repeats (i.e., microsatellites) such as CA-repeats are a highly polymorphic, highly abundant class of PCR-amplifiable markers that have greatly streamlined genetic mapping experimentation. It is expected that over 30,000 such markers (including tri- and tetranucleotide repeats) will be characterized for routine use in the next few years. Since only size determination, and not sequencing, is required to determine alleles, in principle, dinucleotide repeat genotyping is easily performed on electrophoretic gels, and can be automated using DNA sequencers. Unfortunately, PCR stuttering with these markers generates not one band for each allele, but a pattern of bands. Since closely spaced alleles must be disambiguated by human scoring, this poses a key obstacle to full automation. We have developed methods that overcome this obstacle. Our model is that the observed data is generated by arithmetic superposition (i.e., convolution) of multiple allele patterns. By quantitatively measuring the size of each component band, and exploiting the unique stutter pattern associated with each marker, closely spaced alleles can be deconvolved; this unambiguously reconstructs the {open_quotes}true{close_quotes} allele bands, with stutter artifact removed. We used this approach in a system for automated diagnosis of (X-linked) Duchenne muscular dystrophy; four multiplexed CA-repeats within the dystrophin gene were assayed on a DNA sequencer. Our method accurately detected small variations in gel migration that shifted the allele size estimate. In 167 nonmutated alleles, 89% (149/167) showed no size variation, 9% (15/167) showed 1 bp variation, and 2% (3/167) showed 2 bp variation. We are currently developing a library of dinucleotide repeat patterns; together with our deconvolution methods, this library will enable fully automated genotyping of dinucleotide repeats from sizing data.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. J Koshy. Articles written in Bulletin of Materials Science. Volume 25 Issue 2 April 2002 pp 95-99 Superconductors. Superconducting YBa2Cu3O7– thick film (c (0)$ = 92 K) on a newly developed perovskite ceramic substrate · S U K Nair P R S Warriar J Koshy · More Details ...
J J Thomson and the discovery of the electron
International Nuclear Information System (INIS)
Squires, Gordon
1997-01-01
This short biography describes the life of J.J. Thomson, head of the Cavendish Laboratory in Cambridge. His early life as well as his contributions to physics, including the discovery of the electron from his research on cathode rays in 1897 are included. The work of other contributors to the understanding of electron properties is also noted briefly. (UK)
Symmetries of some hypergeometric series: Implications for 3j- and 6j-coefficients
International Nuclear Information System (INIS)
Louck, J.D.; Beyer, W.A.; Biedenharn, L.C.; Stein, P.R.
1986-10-01
The occurrence of generalized hypergeometric series as factors, in the Wigner-Clebsch-Gordan (3j) and Racah (6j) coefficients is well known. The recently discovered S 5 symmetry of the Saalscheutzian 4 F 3 series may be used to extend the symmetries of the 6j-coefficients to the much larger group generated by S 5 and the group of Regge symmetries. (A similar extension may be carried out for the 3j-coefficients). The required extension of the domain of definition of the 6j-coefficients and the properties of its symmetry group is developed here. 7 refs
F. J. Wiedemanni keeleauhind on lakanud. Elagu F. J. Wiedemanni keeleauhind! / Eevi Ross
Ross, Eevi
2003-01-01
15-ndad ja viimased F. J. Wiedemanni Keeleauhinna Sihtasutuse laureaadid on Mati Hint ja Helju Vals, järgmisel aastal antakse välja esimene riiklik F. J. Wiedemanni keeleauhind Eesti Vabariigi peaministri poolt
Flanagan, David
2010-01-01
"As someone who uses jQuery on a regular basis, it was surprising to discover how much of the library I'm not using. This book is indispensable for anyone who is serious about using jQuery for non-trivial applications."-- Raffaele Cecco, longtime developer of video games, including Cybernoid, Exolon, and Stormlord jQuery is the "write less, do more" JavaScript library. Its powerful features and ease of use have made it the most popular client-side JavaScript framework for the Web. This book is jQuery's trusty companion: the definitive "read less, learn more" guide to the library. jQuery P
Boduch, Adam
2013-01-01
Filled with a practical collection of recipes, jQuery UI Cookbook is full of clear, step-by-step instructions that will help you harness the powerful UI framework in jQuery. Depending on your needs, you can dip in and out of the Cookbook and its recipes, or follow the book from start to finish.If you are a jQuery UI developer looking to improve your existing applications, extract ideas for your new application, or to better understand the overall widget architecture, then jQuery UI Cookbook is a must-have for you. The reader should at least have a rudimentary understanding of what jQuery UI is
De Rosa, Aurelio
2013-01-01
Filled with practical, step-by-step instructions and clear explanations for the most important and useful tasks. Instant jQuery Selectors follows a simple how-to format with recipes aimed at making you well versed with the wide range of selectors that jQuery has to offer through a myriad of examples.Instant jQuery Selectors is for web developers who want to delve into jQuery from its very starting point: selectors. Even if you're already familiar with the framework and its selectors, you could find several tips and tricks that you aren't aware of, especially about performance and how jQuery ac
Repeatedly pairing vagus nerve stimulation with a movement reorganizes primary motor cortex.
Porter, Benjamin A; Khodaparast, Navid; Fayyaz, Tabbassum; Cheung, Ryan J; Ahmed, Syed S; Vrana, William A; Rennaker, Robert L; Kilgard, Michael P
2012-10-01
Although sensory and motor systems support different functions, both systems exhibit experience-dependent cortical plasticity under similar conditions. If mechanisms regulating cortical plasticity are common to sensory and motor cortices, then methods generating plasticity in sensory cortex should be effective in motor cortex. Repeatedly pairing a tone with a brief period of vagus nerve stimulation (VNS) increases the proportion of primary auditory cortex responding to the paired tone (Engineer ND, Riley JR, Seale JD, Vrana WA, Shetake J, Sudanagunta SP, Borland MS, Kilgard MP. 2011. Reversing pathological neural activity using targeted plasticity. Nature. 470:101-104). In this study, we predicted that repeatedly pairing VNS with a specific movement would result in an increased representation of that movement in primary motor cortex. To test this hypothesis, we paired VNS with movements of the distal or proximal forelimb in 2 groups of rats. After 5 days of VNS movement pairing, intracranial microstimulation was used to quantify the organization of primary motor cortex. Larger cortical areas were associated with movements paired with VNS. Rats receiving identical motor training without VNS pairing did not exhibit motor cortex map plasticity. These results suggest that pairing VNS with specific events may act as a general method for increasing cortical representations of those events. VNS movement pairing could provide a new approach for treating disorders associated with abnormal movement representations.
Use of J-integral and modified J-integral as measures of elastic-plastic fracture toughness
International Nuclear Information System (INIS)
Davis, D.A.; Hays, R.A.; Hackett, E.M.; Joyce, J.A.
1988-01-01
J-R Curve tests were conducted on 12T, 1T and 2T compact specimens of materials having J/sub IC/ values ranging from 150 in-lbsq in to over 2600 in-lbsq in. These materials were chosen such that some would exceed the maximum crack length criterion of ASTM E1152-87 prior to reaching the maximum J criterion (3-Ni steel, 5000 series Al) and some would exceed the maximum J criterion first (A533B, A710). The elastic-plastic fracture behavior of these materials was examined using both the deformation theory J-integral (J/sub D/) and the modified J-integral (J/sub M/). The J-R curve testing was performed to very large values of crack opening displacement (COD) where the crack growth was typically 75% of the original remaining ligament. The results of this work suggest that the J/sub D/-R curves exhibit no specimen size dependence to crack extensions far in excess of the E1152 allowables. The J/sub M/-R curves calculated for the same specimens show a significant amount of specimen size dependence which becomes larger as the material toughness decreases. This work suggests that it is premature to utilize the modified J-integral in assessing the flaw tolerance of structures
SSSP-järjestelmän integrointi Digital Signage -järjestelmään
Elmroos, Tero
2014-01-01
Tässä opinnäytetyössä kuvattiin Samsung Smart Signage Platform -järjestelmässä toimivan sovelluksen yhdistäminen Qem Software Oy:n Digital Signage -järjestelmään. Työssä paneuduttiin sovelluksen ohjelmakoodiin, jolla yhdistettiin sovellus ja Digital Signage -järjestelmä. Sovellus toteutettiin JavaScript-ohjelmointikielellä hyödyntäen jQuery-kirjastoa ja sen ajax-pyyntöjä. XML-tiedostojen datan hakeminen toteutettiin ajax-pyynnöillä. Datan jäsentäminen suoritettiin jQuery-kirjaston metodeil...
Shift in detrital sedimentation in the eastern Bay of Bengal during the late Quaternary
Digital Repository Service at National Institute of Oceanography (India)
PrakashBabu, C.; Pattan, J.N.; Dutta, K.; Basavaiah, N.; Prasad, G.V.K.; Ray, D.K.; Govil, P.
Prasad G V, Dutta K and Ray D K 2008 Radiocar- bon AMS at IOP: System improvements and dating of groundwater from Bhadrak district, Orissa; Nucl. Instr. Meth. Phys. Res. (B) 266 1833–1836. Sahota J T S, Robinson S G and Oldfield F 1995 Mag- netic... of catalytically condensed carbon for use in accelerator mass spectrometry; Nucl. Instr. Meth. Phys. Res. (B) 5 289–293. Wedepohl K H 1991 The composition of the upper earth’s crust and the natural cycles of selected metals. Metals in natural raw materials. Natural...
Luana Ferreira de Freitas (UFC); Rafael Ferreira da Silva (UFC)
2016-01-01
RESUMO Neste artigo, revisitamos a questão do conto fantástico “The mortal immortal” (1833), de Mary Shelley, traduzido para o italiano pelo escritor scapigliato Ugo Tarchetti, porém assumido como obra sua nas publicações de 1865, intitulado “Il mortale immortale (dall’inglese)” e de 1868, já nomeado como “L’elixir dell’immortalità (imitazione dall’inglese)” nas revistas italianas Rivista Minima e Emporio Pittoresco. Buscamos refletir sobre o motivo pelo qual Tarchetti teve tal atitude e ...
Digital repeat analysis; setup and operation.
Nol, J; Isouard, G; Mirecki, J
2006-06-01
Since the emergence of digital imaging, there have been questions about the necessity of continuing reject analysis programs in imaging departments to evaluate performance and quality. As a marketing strategy, most suppliers of digital technology focus on the supremacy of the technology and its ability to reduce the number of repeats, resulting in less radiation doses given to patients and increased productivity in the department. On the other hand, quality assurance radiographers and radiologists believe that repeats are mainly related to positioning skills, and repeat analysis is the main tool to plan training needs to up-skill radiographers. A comparative study between conventional and digital imaging was undertaken to compare outcomes and evaluate the need for reject analysis. However, digital technology still being at its early development stages, setting a credible reject analysis program became the major task of the study. It took the department, with the help of the suppliers of the computed radiography reader and the picture archiving and communication system, over 2 years of software enhancement to build a reliable digital repeat analysis system. The results were supportive of both philosophies; the number of repeats as a result of exposure factors was reduced dramatically; however, the percentage of repeats as a result of positioning skills was slightly on the increase for the simple reason that some rejects in the conventional system qualifying for both exposure and positioning errors were classified as exposure error. The ability of digitally adjusting dark or light images reclassified some of those images as positioning errors.
Kaitsealuseid Kurtna järvi ähvardab veeta jäämine / Ulvar Käärt
Käärt, Ulvar, 1982-
2013-01-01
Tallinna Ülikooli ökoloogia instituudi järvede töörühma poolt mõõdeti seitsmes Kurtna järvestiku järves veetaset, ilmnes järsk veetaseme alanemine Kuradi-, Ahne- ja Martiska järves. Ökoloogia Instituudi järvede töörühm eesotsas Jaanus Terasmaaga seostab kolme järve veetaseme kiiret langust piirkonnas paiknevast Vasavere põhjaveehaardest joogivee väljapumpamisega
DEFF Research Database (Denmark)
Peng, Xu; Brügger, Kim; Shen, Biao
2003-01-01
terminally modified and corresponds to SSO454, an open reading frame of previously unassigned function. It binds specifically to DNA fragments carrying double and single repeat sequences, binding on one side of the repeat structure, and producing an opening of the opposite side of the DNA structure. It also...... recognizes both main families of repeat sequences in S. solfataricus. The recombinant protein, expressed in Escherichia coli, showed the same binding properties to the SRSR repeat as the native one. The SSO454 protein exhibits a tripartite internal repeat structure which yields a good sequence match...... with a helix-turn-helix DNA-binding motif. Although this putative motif is shared by other archaeal proteins, orthologs of SSO454 were only detected in species within the Sulfolobus genus and in the closely related Acidianus genus. We infer that the genus-specific protein induces an opening of the structure...
Obtención de la curva de luz en la ocultación de 35 Sgr por Júpiter el 6 de marzo de 1996
Paolantonio, S.; Duffard, R.; Carranza, G.
La ocultación de la estrella de quinta magnitud 35 Sgr por Júpiter, se produjo el 6 de Marzo de 1996 a las 13 hs. TU. El objetivo era medir el cambio del flujo de la estrella en el ingreso y egreso por el limbo del planeta. Con estos datos se pueden determinar parámetros físicos del planeta (radio, eccentricidad) y de su atmósfera (escala de altura, temperatura, densidad, presión) Para lograr ésto se programó la cámara CCD TH 7896 1024 x 1025 instalada en el telescopio de 1.54 m de Bosque Alegre con el objetivo de lograr 2 imágenes por segundo. De esta forma se obtuvieron 2100 imágenes de la inmersión y otras tantas de la emersión. Hubo que tener grandes precauciones para evitar la saturación del CCD ya que la observación se realizó de día. En este momento las imágenes se encuentran en el Department of Planetary Sciences, Lunar and Planetary Laboratory, University of Arizona, para su reducción.
Baer, R.; Boehm, T.; Yssel, H.; Spits, H.; Rabbitts, T. H.
1988-01-01
We have examined DNA rearrangements within a 120 kb cloned region of the human T cell receptor J delta-C delta/J alpha-C alpha locus. Three types of pattern emerge from an analysis of T cell lines and clones. Firstly, cells with two rearrangements within J delta-C delta; secondly, cells with one
Coexistence of 3G repeaters with LTE base stations.
Yeo, Woon-Young; Lee, Sang-Min; Hwang, Gyung-Ho; Kim, Jae-Hoon
2013-01-01
Repeaters have been an attractive solution for mobile operators to upgrade their wireless networks at low cost and to extend network coverage effectively. Since the first LTE commercial deployment in 2009, many mobile operators have launched LTE networks by upgrading their 3G and legacy networks. Because all 3G frequency bands are shared with the frequency bands for LTE deployment and 3G mobile operators have an enormous number of repeaters, reusing 3G repeaters in LTE networks is definitely a practical and cost-efficient solution. However, 3G repeaters usually do not support spatial multiplexing with multiple antennas, and thus it is difficult to reuse them directly in LTE networks. In order to support spatial multiplexing of LTE, the role of 3G repeaters should be replaced with small LTE base stations or MIMO-capable repeaters. In this paper, a repeater network is proposed to reuse 3G repeaters in LTE deployment while still supporting multilayer transmission of LTE. Interestingly, the proposed network has a higher cluster throughput than an LTE network with MIMO-capable repeaters.
Hadron and photon production of J particles and the origin of J particles
International Nuclear Information System (INIS)
Ting, S.C.C.
1975-01-01
Discovery of the J particles (psi-3105 and psi-3695) is detailed. A few experiments on the production of J particles are described, emphasizing photoproduction of J's by photons and hadrons. Finally, current theoretical attempts at explaining their origin are outlined. (29 figures) (U.S.)
Repeatability & Workability Evaluation of SIGMOD 2009
Manegold, Stefan
2010-12-15
SIGMOD 2008 was the first database conference that offered to test submitters\\' programs against their data to verify the repeatability of the experiments published [1]. Given the positive feedback concerning the SIGMOD 2008 repeatability initiative, SIGMOD 2009 modified and expanded the initiative with a workability assessment.
Repeatability & Workability Evaluation of SIGMOD 2009
Manegold, Stefan; Manolescu, Ioana; Afanasiev, Loredana; Feng, Jieling; Gou, G.; Hadjieleftheriou, Marios; Harizopoulos, Stavros; Kalnis, Panos; Karanasos, Konstantinos; Laurent, Dominique; Lupu, M.; Onose, N.; Ré , C.; Sans, Virginie; Senellart, Pierre; Wu, T.; Shasha, Dennis E.
2010-01-01
SIGMOD 2008 was the first database conference that offered to test submitters' programs against their data to verify the repeatability of the experiments published [1]. Given the positive feedback concerning the SIGMOD 2008 repeatability initiative, SIGMOD 2009 modified and expanded the initiative with a workability assessment.
FRB 121102: A Starquake-induced Repeater?
Wang, Weiyang; Luo, Rui; Yue, Han; Chen, Xuelei; Lee, Kejia; Xu, Renxin
2018-01-01
Since its initial discovery, the fast radio burst (FRB) FRB 121102 has been found to be repeating with millisecond-duration pulses. Very recently, 14 new bursts were detected by the Green Bank Telescope during its continuous monitoring observations. In this paper, we show that the burst energy distribution has a power-law form which is very similar to the Gutenberg–Richter law of earthquakes. In addition, the distribution of burst waiting time can be described as a Poissonian or Gaussian distribution, which is consistent with earthquakes, while the aftershock sequence exhibits some local correlations. These findings suggest that the repeating FRB pulses may originate from the starquakes of a pulsar. Noting that the soft gamma-ray repeaters (SGRs) also exhibit such distributions, the FRB could be powered by some starquake mechanisms associated with the SGRs, including the crustal activity of a magnetar or solidification-induced stress of a newborn strangeon star. These conjectures could be tested with more repeating samples.
2010-01-01
jQuery simplifies building rich, interactive web frontends. Getting started with this JavaScript library is easy, but it can take years to fully realize its breadth and depth; this cookbook shortens the learning curve considerably. With these recipes, you'll learn patterns and practices from 19 leading developers who use jQuery for everything from integrating simple components into websites and applications to developing complex, high-performance user interfaces. Ideal for newcomers and JavaScript veterans alike, jQuery Cookbook starts with the basics and then moves to practical use cases w
Lambert, Chip
2015-01-01
You've started down the path of jQuery Mobile, now begin mastering some of jQuery Mobile's higher level topics. Go beyond jQuery Mobile's documentation and master one of the hottest mobile technologies out there. Previous JavaScript and PHP experience can help you get the most out of this book.
Libby, Alex
2015-01-01
If you are a developer who is already familiar with using jQuery and wants to push your skill set further, then this book is for you. The book assumes an intermediate knowledge level of jQuery, JavaScript, HTML5, and CSS.
International Nuclear Information System (INIS)
Siwick, Bradley J.; Dwyer, Jason R.; Jordan, Robert E.; Miller, R. J. Dwayne
2003-01-01
In this reply, we address the main issues raised by Qian et al. regarding our recent article [J. Appl. Phys. 92, 1643 (2002)]. In particular, we reiterate the approximations used in the development of the mean-field model and demonstrate how the form used for the on-axis potential is applicable to the study of femtosecond electron packet propagation and is not in need of correction. We also repeat our assertion that the one-dimensional (1-D) fluid model developed by Qian et al. [J. Appl. Phys. 91, 462 (2002)] overestimates space-charge-induced pulse broadening and is in qualitative disagreement with femtosecond electron packet propagation dynamics. The key differences between the mean-field and 1-D fluid model are discussed and their range of applicability is clarified
Indian Academy of Sciences (India)
Unknown
Journal of Genetics, Vol. 83, No. 3, December 2004. 235. Page 2. J. Genet. classic. Journal of Genetics, Vol. 83, No. 3, December 2004. 236. Page 3. J. Genet. classic. Journal of Genetics, Vol. 83, No. 3, December 2004. 237. Page 4. J. Genet. classic. Journal of Genetics, Vol. 83, No. 3, December 2004. 238. Page 5 ...
Chemical Abundances of Hydrostatic and Explosive Alpha-elements in Sagittarius Stream Stars
Carlin, Jeffrey L.; Sheffield, Allyson A.; Cunha, Katia; Smith, Verne V.
2018-05-01
We analyze chemical abundances of stars in the Sagittarius (Sgr) tidal stream using high-resolution Gemini+GRACES spectra of 42 members of the highest surface-brightness portions of both the trailing and leading arms. Targets were chosen using a 2MASS+WISE color–color selection, combined with the Large Sky Area Multi-Object Fibre Spectroscopic Telescope (LAMOST) radial velocities. In this Letter, we analyze [Fe/H] and α-elements produced by both hydrostatic (O, Mg) and explosive (Si, Ca, Ti) nucleosynthetic processes. The average [Fe/H] for our Sgr stream stars is lower than that for stars in the Sgr core, and stars in the trailing and leading arms show systematic differences in [Fe/H]. Both hydrostatic and explosive elements are depleted relative to Milky Way (MW) disk and halo stars, with a larger gap between the MW trend and Sgr stars for the hydrostatic elements. Chemical abundances of Sgr stream stars show similar patterns to those measured in the core of the Sgr dSph. We explore the ratio of hydrostatic to explosive α-elements [α h/ex] (which we refer to as the “HEx ratio”). Our observed HEx ratio trends for Sgr debris are deficient relative to MW stars. Via simple chemical evolution modeling, we show that these HEx ratio patterns are consistent with a Sgr IMF that lacks the most massive stars. This study provides a link between the chemical properties in the intact Sgr core and the significant portion of the Sgr system’s luminosity that is estimated to currently reside in the streams.
Tallinnast kaugemale / Michael J.J. Stenner
Stenner, Michael J.J.
2012-01-01
Vihula mõisa tegevjuhi arvates peaksid maapiirkondade ettevõtjad üksteisega rohkem koostööd tegema, et Tallinna külastav turist sooviks ka pealinnast välja minna ja nii rohkem raha Eestisse jätaks
Novel expressed sequence tag- simple sequence repeats (EST ...
African Journals Online (AJOL)
Using different bioinformatic criteria, the SUCEST database was used to mine for simple sequence repeat (SSR) markers. Among 42,189 clusters, 1,425 expressed sequence tag- simple sequence repeats (EST-SSRs) were identified in silico. Trinucleotide repeats were the most abundant SSRs detected. Of 212 primer pairs ...
International Nuclear Information System (INIS)
Malyukin, Yu.V.; Sorokin, A.V.; Yefimova, S.L.; Lebedenko, A.N.
2005-01-01
Confocal luminescence microscopy has been used to excite and collect luminescence from single amphi-PIC J-aggregate. Two types of J-aggregates have been revealed in the luminescence image: bead-like J-aggregates, which diameter is less than 1 μm and rod-like ones, which length is about 3 μm and diameter is less than 1 μm. It has been found that single rod-like and bead-like J-aggregates exhibit different luminescence bands with different decay parameters. At the off-resonance blue tail excitation, the J-aggregate exciton luminescence disappeared within a certain time period and a new band appeared, which cannot be attributed to the monomer emission. The luminescence image shows that the J-aggregate is not destroyed. However, J-aggregate storage in darkness does not recover its exciton luminescence
Bai, J Z; Cai, X; Chen, H F; Chen, H S; Chen, H X; Chen, J C; Chen, Jin; Chen, Y B; Chu, Y P; Dai, Y S; Diao, L Y; Deng, Z Y; Dong, Q F; Du, S X; Fang, J; Fang, S S; Fu, C D; Gao, C S; Gao, Y N; Gu, S D; Gu, Y T; Guo, Y N; Guo, Z J; Harris, F A; He, K L; He, M; Heng, Y K; Hou, J; Hu, H M; Hu, J H; Hu, T; Huang, G S; Huang, X T; Ji, X B; Jiang, X S; Jiang, X Y; Jiao, J B; Jin, D P; Jin, S; Lai, Y F; Li, G; Li, H B; Li, J; Li, R Y; Li, S M; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Liang, Y F; Liao, H B; Liu, B J; Liu, C X; Liu, F; Liu, Fang; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, Jian; Liu, Q; Liu, R G; Liu, Z A; Lou, Y C; Lu, F; Lu, G R; Lu, J G; Luo, C L; Ma, F C; Ma, H L; Ma, L L; Ma, Q M; Mao, Z P; Mo, X H; Nie, J; Olsen, S L; Ping, R G; Qi, N D; Qin, H; Qiu, J F; Ren, Z Y; Rong, G; Ruan, X D; Shan, L Y; Shang, L; Shen, C P; Shen, D L; Shen, X Y; Sheng, H Y; Sun, H S; Sun, S S; Sun, Y Z; Sun, Z J; Tang, X; Tong, G L; Varner, G S; Wang, D Y; Wang, L; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, W F; Wang, Y F; Wang, Z; Wang, Z Y; Wang, Zheng; Wei, C L; Wei, D H; Weng, Y; Wu, N; Xia, X M; Xie, X X; Xu, G F; Xu, X P; Xu, Y; Yan, M L; Yang, H X; Yang, Y X; Ye, M H; Ye, Y X; Yu, G W; Yuan, C Z; Yuan, Y; Zang, S L; Zeng, Y; Zhang, B X; Zhang, B Y; Zhang, C C; Zhang, D H; Zhang, H Q; Zhang, H Y; Zhang, J W; Zhang, J Y; Zhang, S H; Zhang, X Y; Zhang, Yiyun; Zhang, Z X; Zhang, Z P; Zhao, D X; Zhao, J W; Zhao, M G; Zhao, P P; Zhao, W R; Zhao, Z G; Zheng, H Q; Zheng, J P; Zheng, Z P; Zhou, L; Zhu, K J; Zhu, Q M; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, B A; Zhuang, X A; Zou, B S
2007-01-01
Rare decay modes $J/\\psi \\to D_{S}^{-} \\pi^{+} + c.c.$, $J/\\psi \\to D^{-} \\pi^{+} + c.c.$, and $J/\\psi \\to \\bar D^{0} \\bar K^{0} + c.c.$ are searched for using 5.77$\\times 10^{7}$ $J/\\psi$ events collected with the BESII detector at the BEPC. No signal above background is observed. We present upper limits on the branching fractions $B(J/\\psi \\to D_{S}^{-} \\pi^{+})$ $<$ 1.4$\\times10^{-4}$, $B(J/\\psi \\to D^{-} \\pi^{+})$ $<7.5\\times10^{-5}$, and $B(J/\\psi \\to \\bar D^{0} \\bar K^{0})$ $<$ 1.7$\\times10^{-4}$ at the 90% confidence level.
Role of memory errors in quantum repeaters
International Nuclear Information System (INIS)
Hartmann, L.; Kraus, B.; Briegel, H.-J.; Duer, W.
2007-01-01
We investigate the influence of memory errors in the quantum repeater scheme for long-range quantum communication. We show that the communication distance is limited in standard operation mode due to memory errors resulting from unavoidable waiting times for classical signals. We show how to overcome these limitations by (i) improving local memory and (ii) introducing two operational modes of the quantum repeater. In both operational modes, the repeater is run blindly, i.e., without waiting for classical signals to arrive. In the first scheme, entanglement purification protocols based on one-way classical communication are used allowing to communicate over arbitrary distances. However, the error thresholds for noise in local control operations are very stringent. The second scheme makes use of entanglement purification protocols with two-way classical communication and inherits the favorable error thresholds of the repeater run in standard mode. One can increase the possible communication distance by an order of magnitude with reasonable overhead in physical resources. We outline the architecture of a quantum repeater that can possibly ensure intercontinental quantum communication
DEFF Research Database (Denmark)
Duedahl, Poul
I mange år var det en almindelig antagelse, at statsminister J.C. Christensens dagbøger var blevet brændt efter hans død. Nu er hans dagbøger fra årene 1900-09 imidlertid dukket op, og de giver et indblik i dansk politik i årene omkring Systemskiftet. Dagbøgerne dækker den periode, hvor J.C...... af justitsminister P.A. Albertis bedragerier og optakten til en rigsretssag. De tyve små dagbøger indeholder optegnelser om stort og småt fra perioden. De tjente som et sted, hvor den normalt tillukkede J.C. Christensen fik luft for private og ikke mindst politiske bekymringer, og mange af aktørerne...... i det politiske liv blev i dagbøgerne udsat for skarpe bemærkninger. J.C. Christensens dagbøger giver et enestående indblik i et stykke Danmarkshistorie set fra første række....
Ocular surface sensitivity repeatability with Cochet-Bonnet esthesiometer.
Chao, Cecilia; Stapleton, Fiona; Badarudin, Ezailina; Golebiowski, Blanka
2015-02-01
To determine the repeatability of ocular surface threshold measurements using the Cochet-Bonnet esthesiometer on the same day and 3 months apart. Two separate studies were conducted to determine the repeatability of ocular surface threshold measurements made on the same day (n = 20 subjects) and 3 months apart (n = 29 subjects). The Cochet-Bonnet esthesiometer was used to measure corneal and inferior conjunctival thresholds using the ascending method of limits. The pressure exerted by the Cochet-Bonnet esthesiometer was determined using an analytical balance, for both the 0.08- and 0.12-mm-diameter filaments. This calibration was then used to convert filament length measurements to pressure. Repeatability was determined using a Bland and Altman analysis. The pressure exerted at each filament length differed between the two filament diameters. The measured pressure also differed from values provided by the manufacturer. Repeatability of threshold measurements at the central cornea was shown to be good, with better repeatability for same-day measurements (coefficient of repeatability [CoR] = ±0.23 g/mm²) than for those 3 months apart (CoR = ±0.52 g/mm²). Threshold measurements at the inferior conjunctiva, in contrast, were poorly repeatable (CoR = ±12.78 g/mm²). Cochet-Bonnet esthesiometry is repeatable when performed on the central cornea on the same day and 3 months apart, but this instrument is not recommended for conjunctival threshold measurements.
Safety of Repeated Yttrium-90 Radioembolization
International Nuclear Information System (INIS)
Lam, Marnix G. E. H.; Louie, John D.; Iagaru, Andrei H.; Goris, Michael L.; Sze, Daniel Y.
2013-01-01
Purpose: Repeated radioembolization (RE) treatments carry theoretically higher risk of radiation-induced hepatic injury because of the liver’s cumulative memory of previous exposure. We performed a retrospective safety analysis on patients who underwent repeated RE. Methods: From 2004 to 2011, a total of 247 patients were treated by RE. Eight patients (5 men, 3 women, age range 51–71 years) underwent repeated treatment of a targeted territory, all with resin microspheres (SIR-Spheres; Sirtex, Lane Cove, Australia). Adverse events were graded during a standardized follow-up. In addition, the correlation between the occurrence of RE-induced liver disease (REILD) and multiple variables was investigated in univariate and multivariate analyses in all 247 patients who received RE. Results: Two patients died shortly after the second treatment (at 84 and 107 days) with signs and symptoms of REILD. Both patients underwent whole liver treatment twice (cumulative doses 3.08 and 2.66 GBq). The other 6 patients demonstrated only minor toxicities after receiving cumulative doses ranging from 2.41 to 3.88 GBq. All patients experienced objective tumor responses. In the whole population, multifactorial analysis identified three risk factors associated with REILD: repeated RE (p = 0.036), baseline serum total bilirubin (p = 0.048), and baseline serum aspartate aminotransferase (p = 0.043). Repeated RE proved to be the only independent risk factor for REILD in multivariate analysis (odds ratio 9.6; p = 0.002). Additionally, the administered activity per target volume (in GBq/L) was found to be an independent risk factor for REILD, but only in whole liver treatments (p = 0.033). Conclusion: The risk of REILD appears to be elevated for repeated RE. Objective tumor responses were observed, but establishment of safety limits will require improvement in dosimetric measurement and prediction
Safety of Repeated Yttrium-90 Radioembolization
Energy Technology Data Exchange (ETDEWEB)
Lam, Marnix G. E. H.; Louie, John D. [Stanford University School of Medicine, Division of Interventional Radiology (United States); Iagaru, Andrei H.; Goris, Michael L. [Stanford University School of Medicine, Division of Nuclear Medicine (United States); Sze, Daniel Y., E-mail: dansze@stanford.edu [Stanford University School of Medicine, Division of Interventional Radiology (United States)
2013-10-15
Purpose: Repeated radioembolization (RE) treatments carry theoretically higher risk of radiation-induced hepatic injury because of the liver's cumulative memory of previous exposure. We performed a retrospective safety analysis on patients who underwent repeated RE. Methods: From 2004 to 2011, a total of 247 patients were treated by RE. Eight patients (5 men, 3 women, age range 51-71 years) underwent repeated treatment of a targeted territory, all with resin microspheres (SIR-Spheres; Sirtex, Lane Cove, Australia). Adverse events were graded during a standardized follow-up. In addition, the correlation between the occurrence of RE-induced liver disease (REILD) and multiple variables was investigated in univariate and multivariate analyses in all 247 patients who received RE. Results: Two patients died shortly after the second treatment (at 84 and 107 days) with signs and symptoms of REILD. Both patients underwent whole liver treatment twice (cumulative doses 3.08 and 2.66 GBq). The other 6 patients demonstrated only minor toxicities after receiving cumulative doses ranging from 2.41 to 3.88 GBq. All patients experienced objective tumor responses. In the whole population, multifactorial analysis identified three risk factors associated with REILD: repeated RE (p = 0.036), baseline serum total bilirubin (p = 0.048), and baseline serum aspartate aminotransferase (p = 0.043). Repeated RE proved to be the only independent risk factor for REILD in multivariate analysis (odds ratio 9.6; p = 0.002). Additionally, the administered activity per target volume (in GBq/L) was found to be an independent risk factor for REILD, but only in whole liver treatments (p = 0.033). Conclusion: The risk of REILD appears to be elevated for repeated RE. Objective tumor responses were observed, but establishment of safety limits will require improvement in dosimetric measurement and prediction.
Repeated-Sprint Sequences During Female Soccer Matches Using Fixed and Individual Speed Thresholds.
Nakamura, Fábio Y; Pereira, Lucas A; Loturco, Irineu; Rosseti, Marcelo; Moura, Felipe A; Bradley, Paul S
2017-07-01
Nakamura, FY, Pereira, LA, Loturco, I, Rosseti, M, Moura, FA, and Bradley, PS. Repeated-sprint sequences during female soccer matches using fixed and individual speed thresholds. J Strength Cond Res 31(7): 1802-1810, 2017-The main objective of this study was to characterize the occurrence of single sprint and repeated-sprint sequences (RSS) during elite female soccer matches, using fixed (20 km·h) and individually based speed thresholds (>90% of the mean speed from a 20-m sprint test). Eleven elite female soccer players from the same team participated in the study. All players performed a 20-m linear sprint test, and were assessed in up to 10 official matches using Global Positioning System technology. Magnitude-based inferences were used to test for meaningful differences. Results revealed that irrespective of adopting fixed or individual speed thresholds, female players produced only a few RSS during matches (2.3 ± 2.4 sequences using the fixed threshold and 3.3 ± 3.0 sequences using the individually based threshold), with most sequences composing of just 2 sprints. Additionally, central defenders performed fewer sprints (10.2 ± 4.1) than other positions (fullbacks: 28.1 ± 5.5; midfielders: 21.9 ± 10.5; forwards: 31.9 ± 11.1; with the differences being likely to almost certainly associated with effect sizes ranging from 1.65 to 2.72), and sprinting ability declined in the second half. The data do not support the notion that RSS occurs frequently during soccer matches in female players, irrespective of using fixed or individual speed thresholds to define sprint occurrence. However, repeated-sprint ability development cannot be ruled out from soccer training programs because of its association with match-related performance.
Rohelised jõulud / Villem Loigom
Loigom, Villem
2007-01-01
Jõuluvana kujundist, mille Haddon Sundblom (1899-1976) lõi Coca-Cola tellimusel. Autori arvates tasub järele mõelda, kuidas jõule mööda saata tagasihoidlike ning vähe looduslikku ressurssi raiskavate sisustuselementidega. Savi, puu, klaas ja õled jõuluehetes. Massimo Giaconi disainitud portselanist kujukesest Christmas Cow Boy. Pipargoogid - parimad jõuluehted
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. J Raghava Rao. Articles written in Resonance – Journal of Science Education. Volume 19 Issue 10 October 2014 pp 887-899 General Article. Yelavarthy Nayudamma: Scientist, Leader, and Mentor Extraordinary · J Raghava Rao T Ramasami · More Details ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Harlan J Smith. Articles written in Resonance – Journal of Science Education. Volume 7 Issue 8 August 2002 pp 2-4 Article-in-a-Box. Tribute to Prof. M. K. V. Bappu · Harlan J Smith · More Details Fulltext PDF ...
Dental Fear in Children with Repeated Tooth Injuries.
Negovetić Vranić, Dubravka; Ivančić Jokić, Nataša; Bakarčić, Danko; Carek, Andreja; Rotim, Željko; Verzak, Željko
2016-06-01
Tooth injuries are serious clinical conditions. Some children experience dental trauma only once, while others are more prone to repeated tooth injuries. Repeated dental trauma occurs in 19.4% to 30% of patients. Pain and dental trauma are the most common reasons for fear and anxiety. The main objective of this study was to investigate how dental trauma, as well as repeated dental trauma affects the occurrence and development of dental fear in children. The study was conducted on a random sample of 147 subjects (88 boys and 59 girls) aged 5-8 and 9-12 years. Subjects in both age groups were divided into subroups without dental trauma, with one dental trauma and with repeated dental trauma. The validated Children’s Fear Survey Schedule – Dental Subscale was used on fear assessment. Results showed that only 12.2% of children without trauma, 33.3% with one trauma and 51.7% with repeated trauma were not afraid of injection. Older children had a significantly lower fear of injections, touch of an unknown person, choking, going to the hospital and people in white uniforms. Dentist was not the cause of fear in 65.5% of patients with repeated trauma. With each repeated injury of teeth, the degree of their fear of dental treatment was lower.
Erroneous Memories Arising from Repeated Attempts to Remember
Henkel, Linda A.
2004-01-01
The impact of repeated and prolonged attempts at remembering on false memory rates was assessed in three experiments. Participants saw and imagined pictures and then made repeated recall attempts before taking a source memory test. Although the number of items recalled increased with repeated tests, the net gains were associated with more source…
J-regular rings with injectivities
Shen, Liang
2010-01-01
A ring $R$ is called a J-regular ring if R/J(R) is von Neumann regular, where J(R) is the Jacobson radical of R. It is proved that if R is J-regular, then (i) R is right n-injective if and only if every homomorphism from an $n$-generated small right ideal of $R$ to $R_{R}$ can be extended to one from $R_{R}$ to $R_{R}$; (ii) R is right FP-injective if and only if R is right (J, R)-FP-injective. Some known results are improved.
Determination of J/ψ leptonic branching fraction via ψ(2S)→π+π-J/ψ
International Nuclear Information System (INIS)
Bai, J.Z.; Bian, J.G.; Chai, Z.W.; Chen, G.P.; Chen, J.C.; Chen, Y.; Chen, Y.B.; Chen, Y.Q.; Cheng, B.S.; Cui, X.Z.; Ding, H.L.; Ding, L.Y.; Dong, L.Y.; Du, Z.Z.; Feng, S.; Gao, C.S.; Gao, M.L.; Gao, S.Q.; Gu, J.H.; Gu, S.D.; Gu, W.X.; Gu, Y.F.; Guo, Y.N.; Han, S.W.; Han, Y.; He, J.; He, J.T.; Hu, G.Y.; Hu, H.M.; Hu, J.L.; Hu, Q.H.; Hu, T.; Hu, X.Q.; Huang, J.D.; Huang, Y.Z.; Jiang, C.H.; Jin, Y.; Ke, Z.J.; Lai, Y.F.; Lang, P.F.; Li, C.G.; Li, D.; Li, H.B.; Li, J.; Li, P.Q.; Li, R.B.; Li, W.; Li, W.D.; Li, W.G.; Li, X.H.; Li, X.N.; Liu, H.M.; Liu, J.; Liu, J.H.; Liu, R.G.; Liu, Y.; Lu, F.; Lu, J.G.; Lu, J.Y.; Lu, L.C.; Luo, C.H.; Ma, A.M.; Ma, E.C.; Ma, J.M.; Mao, H.S.; Mao, Z.P.; Meng, X.C.; Nie, J.; Qi, N.D.; Qi, X.R.; Qiu, J.F.; Qu, Y.H.; Que, Y.K.; Rong, G.; Shao, Y.Y.; Shen, B.W.; Shen, D.L.; Shen, H.; Shen, X.Y.; Sheng, H.Y.; Shi, H.Z.; Song, X.F.; Sun, F.; Sun, H.S.; Tang, S.Q.; Tong, G.L.; Wang, F.; Wang, L.S.; Wang, L.Z.; Wang, M.; Wang, M.; Wang, P.; Wang, P.L.; Wang, S.M.; Wang, T.J.; Wang, Y.Y.; Wei, C.L.; Wu, Y.G.; Xi, D.M.; Xia, X.M.; Xie, P.P.; Xie, Y.; Xie, Y.H.; Xiong, W.J.; Xu, C.C.; Xu, G.F.; Xue, S.T.; Yan, J.; Yan, W.G.; Yang, C.M.; Yang, C.Y.; Yang, J.; Yang, X.F.; Ye, M.H.; Yi, K.; Yu, C.S.; Yu, C.X.; Yu, Z.Q.; Yu, Z.T.; Yuan, C.Z.; Yuan, Y.; Zhang, B.Y.; Zhang, C.C.; Zhang, D.H.; Zhang, D.; Zhang, H.L.; Zhang, J.; Zhang, J.L.; Zhang, J.W.; Zhang, L.S.; Zhang, Q.J.; Zhang, S.Q.; Zhang, Y.; Zhang, Y.Y.; Zhao, D.X.; Zhao, H.W.; Zhao, J.W.; Zhao, M.; Zhao, W.R.; Zhao, Z.G.; Zheng, J.P.; Zheng, L.S.; Zheng, Z.P.; Zhou, G.P.; Zhou, H.S.; Zhou, L.; Zhu, Q.M.; Zhu, Y.C.; Zhu, Y.S.; Zhuang, B.A.; Hitlin, D.G.; Kelsey, M.H.; Oyang, J.; Panetta, J.; Porter, F.; Weaver, M.; Chen, J.; Malchow, R.; Toki, W.; Yang, W.
1998-01-01
A comparison of the rates for ψ(2S)→π + π - J/ψ, J/ψ→l + l - and J/ψ→ anything is used to determine the J/ψ leptonic branching fractions. The results are B(J/ψ→e + e - )=(5.90±0.05±0.10)% and B(J/ψ→μ + μ - )=(5.84±0.06±0.10)%, where the first error is statistical and the second is systematic. Assuming lepton universality, the leptonic branching fraction of the J/ψ is B(J/ψ→l + l - )=(5.87±0.04±0.09)% per species. This result is used to estimate the QCD scale factor Λ MS (4) and the strong coupling constant α s . copyright 1998 The American Physical Society
Beighley, Lynn
2010-01-01
Learn how jQuery can make your Web page or blog stand out from the crowd!. jQuery is free, open source software that allows you to extend and customize Joomla!, Drupal, AJAX, and WordPress via plug-ins. Assuming no previous programming experience, Lynn Beighley takes you through the basics of jQuery from the very start. You'll discover how the jQuery library separates itself from other JavaScript libraries through its ease of use, compactness, and friendliness if you're a beginner programmer. Written in the easy-to-understand style of the For Dummies brand, this book demonstrates how you can a
Reid, Jon
2011-01-01
Native apps have distinct advantages, but the future belongs to mobile web apps that function on a broad range of smartphones and tablets. Get started with jQuery Mobile, the touch-optimized framework for creating apps that look and behave consistently across many devices. This concise book provides HTML5, CSS3, and JavaScript code examples, screen shots, and step-by-step guidance to help you build a complete working app with jQuery Mobile. If you're already familiar with the jQuery JavaScript library, you can use your existing skills to build cross-platform mobile web apps right now. This b
Identification, variation and transcription of pneumococcal repeat sequences
2011-01-01
Background Small interspersed repeats are commonly found in many bacterial chromosomes. Two families of repeats (BOX and RUP) have previously been identified in the genome of Streptococcus pneumoniae, a nasopharyngeal commensal and respiratory pathogen of humans. However, little is known about the role they play in pneumococcal genetics. Results Analysis of the genome of S. pneumoniae ATCC 700669 revealed the presence of a third repeat family, which we have named SPRITE. All three repeats are present at a reduced density in the genome of the closely related species S. mitis. However, they are almost entirely absent from all other streptococci, although a set of elements related to the pneumococcal BOX repeat was identified in the zoonotic pathogen S. suis. In conjunction with information regarding their distribution within the pneumococcal chromosome, this suggests that it is unlikely that these repeats are specialised sequences performing a particular role for the host, but rather that they constitute parasitic elements. However, comparing insertion sites between pneumococcal sequences indicates that they appear to transpose at a much lower rate than IS elements. Some large BOX elements in S. pneumoniae were found to encode open reading frames on both strands of the genome, whilst another was found to form a composite RNA structure with two T box riboswitches. In multiple cases, such BOX elements were demonstrated as being expressed using directional RNA-seq and RT-PCR. Conclusions BOX, RUP and SPRITE repeats appear to have proliferated extensively throughout the pneumococcal chromosome during the species' past, but novel insertions are currently occurring at a relatively slow rate. Through their extensive secondary structures, they seem likely to affect the expression of genes with which they are co-transcribed. Software for annotation of these repeats is freely available from ftp://ftp.sanger.ac.uk/pub/pathogens/strep_repeats/. PMID:21333003
Brucker, Peter; Hurink, Johann L.; Knust, Sigrid
2001-01-01
A polynomial algorithm is proposed for two scheduling problems for which the complexity status was open. A set of jobs with unit processing times, release dates and outtree precedence relations has to be processed on parallel identical machines such that the total completion time $\\sum C_j$ is
Nonparametric additive regression for repeatedly measured data
Carroll, R. J.; Maity, A.; Mammen, E.; Yu, K.
2009-01-01
We develop an easily computed smooth backfitting algorithm for additive model fitting in repeated measures problems. Our methodology easily copes with various settings, such as when some covariates are the same over repeated response measurements
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. K J Rao. Articles written in Bulletin of Materials Science. Volume 23 Issue 6 December 2000 pp 461-466 Material Synthesis. Microwave synthesis of electrode materials for lithium batteries · M Harish Bhat B P Chakravarthy P A Ramakrishnan A Levasseur K J RAO.
Quantum key distribution with two-segment quantum repeaters
Energy Technology Data Exchange (ETDEWEB)
Kampermann, Hermann; Abruzzo, Silvestre; Bruss, Dagmar [Theoretische Physik III, Heinrich-Heine-Universitaet Duesseldorf (Germany)
2014-07-01
Quantum repeaters represent one possible way to achieve long-distance quantum key distribution. One way of improving the repeater rate and decreasing the memory coherence time is the usage of multiplexing. Motivated by the experimental fact that long-range connections are practically demanding, we extend the analysis of the quantum repeater multiplexing protocol to the case of short-range connections. We derive formulas for the repeater rate and we show that short-range connections lead to most of the benefits of a full-range multiplexing protocol. A less demanding QKD-protocol without quantum memories was recently introduced by Lo et al. We generalize this measurement-device-independent quantum key Distribution protocol to the scenario where the repeater Station contains also heralded quantum memories. We assume either single-photon sources or weak coherent pulse sources plus decay states. We show that it is possible to significantly outperform the original proposal, even in presence of decoherence of the quantum memory. We give formulas in terms of device imperfections i.e., the quantum bit error rate and the repeater rate.
Submillimeter wave spectroscopy of ethyl isocyanide and its searches in Orion
Margulès, L.; Tercero, B.; Guillemin, J. C.; Motiyenko, R. A.; Cernicharo, J.
2018-02-01
Context. About 40 cyanide compounds have been detected in the interstellar medium, but only 3 examples of organic isocyanide compounds were observed in this medium. Ethyl isocyanide is one of the best candidates for possible detection. Aim. To date, measurements of rotational spectra are limited to 40 GHz. The extrapolation of the prediction in the millimeter wave domain is inaccurate and does not permit an unambiguous detection. Methods: The rotational spectra were reinvestigated from 0.15 to 1 THz. Using the new prediction, we searched for the compound ethyl isocyanide in Orion KL and Sgr B2. Results: We newly assigned 2906 transitions and fitted these new data with those from previous studies, reaching quantum numbers up to J = 103 and Ka = 30. The asymmetric top Hamiltonian proposed by Watson in the Ir representation was used for the analysis, and both reductions A and S were tested. The search for CH3CH2NC in Sgr B2 (IRAM 30m) and Orion KL (IRAM 30m, ALMA Science Verification) result in a non-detection; upper limits to the column density were derived. Tables S1-S4 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/610/A44
Leibowitz, Elia
2017-01-01
In an intensive observational campaign in the nine month duration of Chandra X-ray Visionary Project that was conducted in the year 2012, 39 large X-ray flares of Sgr A* were recorded. An analysis of the times of the observed flares reveals that the 39 flares are separated in time by intervals that are grouped around integer numbers times 0.10333 days. This time interval is thus the period of a uniform grid of equally spaced points on the time axis. The grouping of the flares around tic marks of this grid is derived from the data with at least a 3.2 σ level of statistical significance. No signal of any period can be found among 22 flares recorded by Chandra in the years 2013-2014. If the 0.10333 day period is that of a nearly circular Keplerian orbit around the blackhole at the center of the Galaxy, its radius is at 7.6 Schwarzschild radii. Large flares were more likely to be triggered when the agent responsible for their outbursts was near the peri-center phase of its slightly eccentric orbit.
Assessment of genetic diversity in Chinese eared pheasant using fluorescent-AFLP markers
DEFF Research Database (Denmark)
Li, Xiujuan; Zhu, Yaohong; Liu, Panqi
2010-01-01
on the list of the world’s threatened species. In this paper, 74 individuals from the four eared pheasant species were assessed for population genetic diversity by means of fluorescent-AFLP markers. A total of 429 AFLP peaks were amplified by 11 pairs of fluorescent EcoRI/TaqI primer combinations. Out of all...... using Jaccard’s similarity coefficients (SC) and the corresponding dendrogram. It was found that there was a moderate genetic distance between the four species (SC = 0.674–0.832). Brown eared pheasant was genetically closely related to blue eared pheasant (SC = 0.832), while white eared pheasant...
DISSECTING THE REGION OF 3EG J1837-0423 AND HESS J1841-055 WITH INTEGRAL
International Nuclear Information System (INIS)
Sguera, V.; Masetti, N.; Bassani, L.; Romero, G. E.; Bazzano, A.; Bird, A. J.
2009-01-01
3EG J1837-0423 and HESS J1841-055 are two unidentified and peculiar high-energy sources located in the same region of the sky, separated by ∼1.4 deg. Specifically, 3EG J1837-0423 is a transient MeV object detected by EGRET only once during flaring activity that lasted a few days while HESS J1841-055 is a highly extended TeV source. We attempted to match the high-energy emission from the unidentified sources 3EG J1837-0423 and HESS J1841-055 with X-rays (4-20 keV) and soft γ-rays (20-100 keV) candidate counterparts detected through deep International Gamma-Ray Astrophysics Laboratory observations of the sky region. As a result we propose the Supergiant Fast X-ray Transient (SFXT) AX J1841.0-0536 as a possible candidate counterpart of 3EG J1837-0423, based on spatial proximity and transient behavior. Alternatively, AX J1841.0-0536 could be responsible for at least a fraction of the entire TeV emission from the extended source HESS J1841-055, based on a striking spatial correlation. In either case, the proposed association is also supported from an energetic standpoint by a theoretical scenario where AX J1841.0-0536 is a low magnetized pulsar which, due to accretion of massive clumps from the supergiant companion donor star, undergoes sporadic changes to transient Atoll-states where a magnetic tower can produce transient jets and as a consequence high-energy emission. In either case (by association with 3EG J1837-0423 or alternatively with HESS J1841-055), AX J1841.0-0536 might be the prototype of a new class of Galactic transient MeV/TeV emitters.
Sala, R.; Bawole, R.; Runtuboi, F.; Mudjirahayu; Wopi, I. A.; Budisetiawan, J.; Irwanto
2018-03-01
The Wondama Bay water is located within the Cendrawasih Bay National Park and is potential for fishery resources, including pelagic fish such as yellowstripe scad (Selaroides leptolepis Cuvier, 1833) and Indian mackerel (Rastrelliger kanagurta Cuvier, 1816). Yet, information about the population dynamics of these species in the region is unknown until today. Meanwhile, the fishing activities have been quite intensive and include the dominant catches over the last ten years by traditional fishermen fishing using liftnets. Therefore, this study aims to determine some of specific characteristics of the population dynamics and fish utilization status of scad and mackerel in the waters of the Wondama Bay. Data used in this study were taken from direct observation of catch of liftnet fishery. The data then were analysed by using FISAT II to estimate the growth parameters, mortality rates, and yield per recruitment. The results showed that yellowstripe scad has the positive allometric growth, while Indian mackerel followed isometric growth. Models of fish growth were L(t) = 22 (1-e-3.0(t-0.05)) for yellowstripe scad and L(t) = 27.8 (1-e-4.0(t-0.04)) for Indian mackerel. The natural mortality (M) of 4.19 year-1, fishing mortality (F) of 5.01 year-1, and total mortality (Z) of 9.20 year-1 were for yellowstripe scad, and M of 4.74 year-1, F of 2.52 year-1 and Z of 7.26 year-1 were for Indian mackerel. Based on the mortality rates, estimated exploitation rate for the yellowatripe scad was 54 % and the Indian mackerel was 35 %. To increase the production of catch without increasing fishing effort (fishing mortality) can be done by increasing the size of fish caught or the Lc/L∞ should be greater than 0.5.
CO and its Isotopomers Observation towards Sgr B2 L. L. Sun1, J. S. ...
Indian Academy of Sciences (India)
1991; Rodriguez-Fernandez & Combes 2008). Isotope ratios are considered to be a good tool to discriminate between gas flowing towards the disk and gas already residing in the disk of the central galactic plane. (Riquelme et al. 2010). A systematic study is performed on isotope abundance ratio of 18O to 17O of the ...
Li, Yang; Cui, Shuai; Li, Weihua; Wang, Yixin; Cui, Zhizhong; Zhao, Peng; Chang, Shuang
2017-06-29
Avian leukosis virus (ALV) is one of the main causes of tumour development within the poultry industry in China. The subgroup J avian leukosis viruses (ALV-J), which induce erythroblastosis and myelocytomatosis, have the greatest pathogenicity and transmission ability within this class of viruses. ALV can be transmitted both horizontally and vertically; however, the effects of ALV infection in chickens-especially roosters-during the propagation, on future generations is not clear. Knowing the role of the cock in the transmission of ALV from generation to generation might contribute to the eradication programs for ALV. The results showed that two hens inseminated with ALV-J-positive semen developed temporary antibody responses to ALV-J at 4-5 weeks post insemination. The p27 antigen was detected in cloacal swabs of six hens, and in 3 of 26 egg albumens at 1-6 weeks after insemination. Moreover, no viremia was detected at 6 weeks after insemination even when virus isolation had been conducted six times at weekly intervals for each of the 12 females. However, ALV-J was isolated from 1 of their 34 progeny chicks at 1 week of age, and its gp85 had 98.4%-99.2% sequence identity with the gp85 of ALV-J isolated from semen samples of the six cocks. Our findings indicated that females that were late horizontally infected with ALV-J by artificial insemination might transmit the virus to progeny through eggs, which amounts to vertical transmission.
2016-08-31
large cohort of trials to spot unusual cases. However, deployment repeatability is inherently a nonlinear phenomenon, which makes modeling difficult...and GEMS tip position were both tracked during ground testing by a laser target tracking system. Earlier SAILMAST testing in 2005 [8] used...recalls the strategy used by SRTM, where a constellation of lights was installed at the tip of the boom and a modified star tracker was used to track tip
Customer Orientation vs. Customer Orientation Perception : Case J & J Lakkapää Oy Tornio
Angeria, Heli
2011-01-01
Heli, Angeria 2011. Customer Orientation vs. Customer Orientation Perception. Case: J & J Lakkapää Oy Tornio. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 51. Appendices 5. The objective of this thesis is to study customer orientation with the help of a widely adapted Selling-Orientation-Customer Orientation (SOCO) scale, in order to find out what is the extent to which J & J Lakkapää Oy Tornio and its consumer customers agree or disagree about the company’s cus...
R-loops: targets for nuclease cleavage and repeat instability.
Freudenreich, Catherine H
2018-01-11
R-loops form when transcribed RNA remains bound to its DNA template to form a stable RNA:DNA hybrid. Stable R-loops form when the RNA is purine-rich, and are further stabilized by DNA secondary structures on the non-template strand. Interestingly, many expandable and disease-causing repeat sequences form stable R-loops, and R-loops can contribute to repeat instability. Repeat expansions are responsible for multiple neurodegenerative diseases, including Huntington's disease, myotonic dystrophy, and several types of ataxias. Recently, it was found that R-loops at an expanded CAG/CTG repeat tract cause DNA breaks as well as repeat instability (Su and Freudenreich, Proc Natl Acad Sci USA 114, E8392-E8401, 2017). Two factors were identified as causing R-loop-dependent breaks at CAG/CTG tracts: deamination of cytosines and the MutLγ (Mlh1-Mlh3) endonuclease, defining two new mechanisms for how R-loops can generate DNA breaks (Su and Freudenreich, Proc Natl Acad Sci USA 114, E8392-E8401, 2017). Following R-loop-dependent nicking, base excision repair resulted in repeat instability. These results have implications for human repeat expansion diseases and provide a paradigm for how RNA:DNA hybrids can cause genome instability at structure-forming DNA sequences. This perspective summarizes mechanisms of R-loop-induced fragility at G-rich repeats and new links between DNA breaks and repeat instability.
York, Richard
2015-01-01
Newly revised and updated resource on jQuery's many features and advantages Web Development with jQuery offers a major update to the popular Beginning JavaScript and CSS Development with jQuery from 2009. More than half of the content is new or updated, and reflects recent innovations with regard to mobile applications, jQuery mobile, and the spectrum of associated plugins. Readers can expect thorough revisions with expanded coverage of events, CSS, AJAX, animation, and drag and drop. New chapters bring developers up to date on popular features like jQuery UI, navigation, tables, interacti
Eesti jääb tugevaks, kui jätkab valitud teel / Irene Mia
Mia, Irene
2005-01-01
Maailma Majandusfoorumi analüütiku hinnangul jääb Eesti ka järgmistel aastatel maailma kõige konkurentsivõimelisemate riikide hulka, kui ta jätkab sama teed. Väla on toodud ka parandamist vajavad valdkonnad. Lisa: Eesti koht 2004. aastal majanduskasvu indeksis
Study of J/psi -> p(p)over-bar and J/psi -> n(n)over-bar
Ablikim, M.; Achasov, M. N.; Ambrose, D. J.; An, F. F.; An, Q.; An, Z. H.; Bai, J. Z.; Ban, Y.; Becker, J.; Berger, N.; Bertani, M.; Bian, J. M.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Bytev, V.; Cai, X.; Calcaterra, A.; Cao, G. F.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, Y.; Chen, Y. B.; Cheng, H. P.; Chu, Y. P.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; Ding, W. M.; Ding, Y.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Fang, J.; Fang, S. S.; Fava, L.; Feldbauer, F.; Feng, C. Q.; Ferroli, R. B.; Fu, C. D.; Fu, J. L.; Gao, Y.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y. P.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, M.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Huang, B.; Huang, G. M.; Huang, J. S.; Huang, X. T.; Huang, Y. P.; Hussain, T.; Ji, C. S.; Ji, Q.; Ji, X. B.; Ji, X. L.; Jia, L. K.; Jiang, L. L.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jing, F. F.; Kalantar-Nayestanaki, N.; Kavatsyuk, M.; Kuehn, W.; Lai, W.; Lange, J. S.; Leung, J. K. C.; Li, C. H.; Li, Cheng; Li, Cui; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, K.; Li, Lei; Li, N. B.; Li, Q. J.; Li, S. L.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, X. R.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, X. T.; Liu, B. J.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, C. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H.; Liu, H. B.; Liu, H. H.; Liu, H. M.; Liu, H. W.; Liu, J. P.; Liu, K. Y.; Liu, Kai; Liu, Kun; Liu, P. L.; Liu, S. B.; Liu, X.; Liu, X. H.; Liu, Y.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lu, G. R.; Lu, H. J.; Lu, J. G.; Lu, Q. W.; Lu, X. R.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Ma, C. L.; Ma, F. C.; Ma, H. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. Y.; Ma, Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, H.; Mao, Y. J.; Mao, Z. P.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Morales, C. Morales; Motzko, C.; Muchnoi, N. Yu.; Nefedov, Y.; Nicholson, C.; Nikolaev, I. B.; Ning, Z.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Park, J. W.; Pelizaeus, M.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Prencipe, E.; Pun, C. S. J.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Rong, G.; Ruan, X. D.; Sarantsev, A.; Schulze, J.; Shao, M.; Shen, C. P.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, X. Y.; Spataro, S.; Spruck, B.; Sun, D. H.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. D.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Thorndike, E. H.; Tian, H. L.; Toth, D.; Ullrich, M.; Varner, G. S.; Wang, B.; Wang, B. Q.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q.; Wang, Q. J.; Wang, S. G.; Wang, X. F.; Wang, X. L.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wei, D. H.; Weidenkaff, P.; Wen, Q. G.; Wen, S. P.; Werner, M.; Wiedner, U.; Wu, L. H.; Wu, N.; Wu, S. X.; Wu, W.; Wu, Z.; Xia, L. G.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, G. M.; Xu, H.; Xu, Q. J.; Xu, X. P.; Xu, Y.; Xu, Z. R.; Xue, F.; Xue, Z.; Yan, L.; Yan, W. B.; Yan, Y. H.; Yang, H. X.; Yang, T.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yu, S. P.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. G.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, L.; Zhang, S. H.; Zhang, T. R.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. S.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, K. X.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, X. H.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zheng, Z. P.; Zhong, B.; Zhong, J.; Zhou, L.; Zhou, X. K.; Zhou, X. R.; Zhu, C.; Zhu, K.; Zhu, K. J.; Zhu, S. H.; Zhu, X. L.; Zhu, X. W.; Zhu, Y. M.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Zuo, J. X.
2012-01-01
The decays J/psi -> p (p) over bar and J/psi -> n (n) over bar have been investigated with a sample of 225.2 x 10(6) J/psi events collected with the BESIII detector at the BEPCII e(+)e(-) collider. The branching fractions are determined to be B(J/psi -> p (p) over bar) = (2.112 +/- 0.004 +/- 0.031 x
Branching fraction measurement of J /ψ →KSKL and search for J /ψ →KSKS
Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Alekseev, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chen, Z. X.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garillon, B.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, S. H.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, K. J.; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J. B.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qi, T. Y.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, B. Q.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, X. H.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration
2017-12-01
Using a sample of 1.31 ×109 J /ψ events collected with the BESIII detector at the BEPCII collider, we study the decays of J /ψ →KSKL and KSKS . The branching fraction of J /ψ →KSKL is determined to be B (J /ψ →KSKL)=(1.93 ±0.01 (stat )±0.05 (syst ))×10-4 , which significantly improves on previous measurements. No clear signal is observed for the J /ψ →KSKS process, and the upper limit at the 95% confidence level for its branching fraction is determined to be B (J /ψ →KSKS)<1.4 ×10-8 , which improves on the previous searches by 2 orders in magnitude and reaches the order of the Einstein-Podolsky-Rosen expectation.
Repeat profile analysis in an x-ray department
International Nuclear Information System (INIS)
Bassey, C.E.; Ojo, O.O.; Akpabio, I.
1991-01-01
The repeat profile of an x-ray department in a developing country was analysed monthly between July 1989 and June 1990. Results showed an average repeat rate of 3.7% for the period of study. The main causes of film repetition were: equipment fault, 33.9%; radiographer's fault, 27.4%; film fault, 19.3%; processing fault, 10.8% and patient's fault, 8.6%. The average repeat rate in the first 6 months of study reduced by 50% in the last 6 months. This was due to the effectiveness of implementation of corrective actions. The overall repeat rate was found to correlate well with both the equipment fault and radiographer's fault with correlation coefficients, r, of 0.94 and 0.91, respectively. It is expected that a further reduction in the repeat rate will be obtained after the introduction of quality assurance programmes. (author)
The Bessel functions J0 and J1 of complex argument
International Nuclear Information System (INIS)
Ardill, R.W.B.; Moriarty, K.J.M.
1977-01-01
The Bessel function appears in a wide range of physical applications. The package Bessel contains complex function routines to calculate J 0 (z) and J 1 (z) for complex z. Bessel functions of higher order n 0 (z) and J 1 (z) for all values of mod(z) up to machine overflow. For mod(z) 10, the results diverge quite rapidly from their actual values. The accuracy for mod(z)<=10 is sufficient for most physical applications, and the polynomial approximations provide a quicker calculation of Bessel functions than the use of the ascending series formula used previously, particularly for values of mod(z) near 10. (Auth.)
Directory of Open Access Journals (Sweden)
Yukihiro Momota
2014-01-01
Full Text Available The purpose of this study was to apply high-wattage pulsed irradiation of linearly polarized near-infrared light to the stellate ganglion area for burning mouth syndrome (BMS and to assess the efficacy of the stellate ganglion area irradiation (SGR on BMS using differential time-/frequency-domain parameters (D parameters. Three patients with BMS received high-wattage pulsed SGR; the response to SGR was evaluated by visual analogue scale (VAS representing the intensity of glossalgia and D parameters used in heart rate variability analysis. High-wattage pulsed SGR significantly decreased the mean value of VAS in all cases without any adverse event such as thermal injury. D parameters mostly correlated with clinical condition of BMS. High-wattage pulsed SGR was safe and effective for the treatment of BMS; D parameters are useful for assessing efficacy of SGR on BMS.
Goel, Ankur
2015-01-01
If you are already using Neo4j in your application and want to learn more about data analysis or database graphs, this is the book for you. This book also caters for your needs if you are looking to migrate your existing application to Neo4j in the future. We assume that you are already familiar with any general purpose programming language and have some familiarity with Neo4j.
On the use of J-integral and modified J-integral as measures of elastic-plastic fracture toughness
International Nuclear Information System (INIS)
Davis, D.A.; Hays, R.A.; Hackett, E.M.; Joyce, J.A.
1988-01-01
J-R Curve tests were conducted on 1/2T, 1T and 2T compact specimens of materials having J IC values ranging from 150 in-1b/sq in to over 2600 in-lb/sq in. These materials were chosen such that some would exceed the maximum crack length criterion of ASTM E1152-87 prior to reaching the maximum J criterion (3-Ni steel, 5000 series A1) and some would exceed the maximum J criterion first (A533B, A710). The elastic-plastic fracture behavior of these materials was examined using both the deformation theory J-integral (J D ) and the modified J-integral (J M ). The J-R curve testing was performed to very large values of crack opening displacement (COD) where the crack growth was typically 75% of the original remaining ligament. The results of this work suggest that the J D -R curves exhibit no specimen size dependence to crack extensions far in excess of the E1152 allowables. The J M -R curves calculated for the same specimens show a significant amount of specimen size dependence which becomes larger as the material toughness decreases. This work suggests that it is premature to utilize the modified J-integral in assessing the flaw tolerance of structures. (author)
Directory of Open Access Journals (Sweden)
Adem Türk
2014-05-01
Full Text Available Objectives: To research the repeatability and intercompatibility of keratometry values measured with Potec PRK-6000 autorefractometer, IOL Master, and Pentacam. Materials and Methods: In this prospective study, consecutive measurements were performed in two different sessions with the mentioned three devices on 110 eyes of 55 subjects who had no additional ocular pathology except for refraction error. The consistency of flat and steep keratometry, average keratometry, and corneal astigmatism values obtained in both sessions was compared by using intraclass correlation coefficient (ICC. The measurement differences between the devices were statistically compared as well. Results: The mean age of the study subjects was 23.05±3.01 (18-30 years. ICC values of average keratometry measurements obtained in the sessions were 0.996 for Potec PRK-6000 autorefractometer, 0.997 for IOL Master, and 0.999 for Pentacam. There was high compatibility between the three devices in terms of average keratometry values in Bland-Altman analysis. However, there were statistically significant differences between the devices in terms of parameters other than corneal astigmatism. Conclusion: The repeatability of the three devices was found considerably high in keratometry measurements. However, it is not appropriate for these devices to be substituted for each other in keratometry measurements. (Turk J Ophthalmol 2014; 44: 179-83
International Nuclear Information System (INIS)
Chou, Mei-Yin; Majewski, Steven R.; Patterson, Richard J.; Cunha, Katia; Smith, Verne V.; Martinez-Delgado, David; Geisler, Doug
2010-01-01
We present high-resolution spectroscopic measurements of the abundances of the α element titanium (Ti) and s-process elements yttrium (Y) and lanthanum (La) for 59 candidate M giant members of the Sagittarius (Sgr) dwarf spheroidal (dSph) + tidal tail system pre-selected on the basis of position and radial velocity (RV). As expected, the majority of these stars show peculiar abundance patterns compared to those of nominal Milky Way (MW) stars, but as a group, the stars form a coherent picture of chemical enrichment of the Sgr dSph from [Fe/H] = -1.4 to solar abundance. This sample of spectra provides the largest number of Ti, La, and Y abundances yet measured for a dSph, and spans metallicities not typically probed by studies of the other, generally more metal-poor MW satellites. On the other hand, the overall [Ti/Fe], [Y/Fe], [La/Fe], and [La/Y] patterns with [Fe/H] of the Sgr stream plus Sgr core do, for the most part, resemble those seen in the Large Magellanic Cloud (LMC) and other dSphs, only shifted by Δ[Fe/H] ∼ +0.4 from the LMC and by ∼+1 dex from the other dSphs; these relative shifts reflect the faster and/or more efficient chemical evolution of Sgr compared to the other satellites, and show that Sgr has had an enrichment history more like the LMC than the other dSphs. By tracking the evolution of the abundance patterns along the Sgr stream we can follow the time variation of the chemical make-up of dSph stars donated to the Galactic halo by Sgr. This evolution demonstrates that while the bulk of the stars currently in the Sgr dSph is quite unlike those of the Galactic halo, an increasing number of stars farther along the Sgr stream have abundances like MW halo stars, a trend that shows clearly how the Galactic halo could have been contributed by present-day satellite galaxies even if the present chemistry of those satellites is now different from typical halo field stars. Finally, we analyze the chemical abundances of a moving group of M giants
Kameda, Hiroyuki; Kudo, Kohsuke; Matsuda, Tsuyoshi; Harada, Taisuke; Iwadate, Yuji; Uwano, Ikuko; Yamashita, Fumio; Yoshioka, Kunihiro; Sasaki, Makoto; Shirato, Hiroki
2017-12-04
Respiration-induced phase shift affects B 0 /B 1 + mapping repeatability in parallel transmission (pTx) calibration for 7T brain MRI, but is improved by breath-holding (BH). However, BH cannot be applied during long scans. To examine whether interleaved acquisition during calibration scanning could improve pTx repeatability and image homogeneity. Prospective. Nine healthy subjects. 7T MRI with a two-channel RF transmission system was used. Calibration scanning for B 0 /B 1 + mapping was performed under sequential acquisition/free-breathing (Seq-FB), Seq-BH, and interleaved acquisition/FB (Int-FB) conditions. The B 0 map was calculated with two echo times, and the B 1 + map was obtained using the Bloch-Siegert method. Actual flip-angle imaging (AFI) and gradient echo (GRE) imaging were performed using pTx and quadrature-Tx (qTx). All scans were acquired in five sessions. Repeatability was evaluated using intersession standard deviation (SD) or coefficient of variance (CV), and in-plane homogeneity was evaluated using in-plane CV. A paired t-test with Bonferroni correction for multiple comparisons was used. The intersession CV/SDs for the B 0 /B 1 + maps were significantly smaller in Int-FB than in Seq-FB (Bonferroni-corrected P FB, Seq-BH, and qTx than in Seq-FB (Bonferroni-corrected P FB, Int-FB, and Seq-BH were significantly smaller than in qTx (Bonferroni-corrected P < 0.01 for all). Using interleaved acquisition during calibration scans of pTx for 7T brain MRI improved the repeatability of B 0 /B 1 + mapping, AFI, and GRE images, without BH. 1 Technical Efficacy Stage 1 J. Magn. Reson. Imaging 2017. © 2017 International Society for Magnetic Resonance in Medicine.
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...
African Journals Online (AJOL)
Hp 630 Dual Core
29. Hesdorffer DC,Ghajar J, Iacono L. Predictors of compliance with the evidence based guidelines for traumatic brain injury care: a survey of United States trauma centers. J. Trauma 2002;52:1202 09. 30. Chafi S, Barnes SA, Millar D, Sobrino J, Kudyakov R, Berryman BS et al. Suboptimal compliance with evidence based ...
DEFF Research Database (Denmark)
Clausen, Susanne Knoth; Bergqvist, Mette; Poulsen, Lars K.
2003-01-01
Anthropogenically induced exposures may, due to their adjuvant effect, promote development of sensitisation to commonly occurring aeroallergens. No generally accepted model exists for determination of adjuvant effect of airborne substances. Therefore, BALB/cJ mice were exposed for 10 consecutive...
Perry, Steven
2009-01-01
Log4j has been around for a while now, and it seems like so many applications use it. I've used it in my applications for years now, and I'll bet you have too. But every time I need to do something with log4j I've never done before I find myself searching for examples of how to do whatever that is, and I don't usually have much luck. I believe the reason for this is that there is a not a great deal of useful information about log4j, either in print or on the Internet. The information is too simple to be of real-world use, too complicated to be distilled quickly (which is what most developers
Development of analog watch with minute repeater
Okigami, Tomio; Aoyama, Shigeru; Osa, Takashi; Igarashi, Kiyotaka; Ikegami, Tomomi
A complementary metal oxide semiconductor with large scale integration was developed for an electronic minute repeater. It is equipped with the synthetic struck sound circuit to generate natural struck sound necessary for the minute repeater. This circuit consists of an envelope curve drawing circuit, frequency mixer, polyphonic mixer, and booster circuit made by using analog circuit technology. This large scale integration is a single chip microcomputer with motor drivers and input ports in addition to the synthetic struck sound circuit, and it is possible to make an electronic system of minute repeater at a very low cost in comparison with the conventional type.
International Nuclear Information System (INIS)
Handl, J.; Kuehn, W.
1980-01-01
A brief survey on the few known data on the radioecological behaviour of 129 J is given. Numerous investigations as to the 129 J-uptake in the thyroid of cattle were carried out in the USA. In Western Europe, practically only in the near surroundings of nuclear-technical plants measurements of 129 J were carried out. In the author's opinion, to clarify the ecological behaviour of 129 J, human thyroids should be examined as well, in special regions the share of 129 J in milk, grass, food, and ground-near air should be determined and tests with especially important iodine compounds from various soils and plants should be carried out concerning this re-emissions. (MG) [de
Energy Technology Data Exchange (ETDEWEB)
Haberle, Rosemarie C.; Fourcade, Matthew L.; Boore, Jeffrey L.; Jansen, Robert K.
2006-01-09
Chloroplast genome structure, gene order and content arehighly conserved in land plants. We sequenced the complete chloroplastgenome sequence of Trachelium caeruleum (Campanulaceae) a member of anangiosperm family known for highly rearranged chloroplast genomes. Thetotal genome size is 162,321 bp with an IR of 27,273 bp, LSC of 100,113bp and SSC of 7,661 bp. The genome encodes 115 unique genes, with 19duplicated in the IR, a tRNA (trnI-CAU) duplicated once in the LSC and aprotein coding gene (psbJ) duplicated twice, for a total of 137 genes.Four genes (ycf15, rpl23, infA and accD) are truncated and likelynonfunctional; three others (clpP, ycf1 and ycf2) are so highly divergedthat they may now be pseudogenes. The most conspicuous feature of theTrachelium genome is the presence of eighteen internally unrearrangedblocks of genes that have been inverted or relocated within the genome,relative to the typical gene order of most angiosperm chloroplastgenomes. Recombination between repeats or tRNAs has been suggested as twomeans of chloroplast genome rearrangements. We compared the relativenumber of repeats in Trachelium to eight other angiosperm chloroplastgenomes, and evaluated the location of repeats and tRNAs in relation torearrangements. Trachelium has the highest number and largest repeats,which are concentrated near inversion endpoints or other rearrangements.tRNAs occur at many but not all inversion endpoints. There is likely nosingle mechanism responsible for the remarkable number of alterations inthis genome, but both repeats and tRNAs are clearly associated with theserearrangements. Land plant chloroplast genomes are highly conserved instructure, gene order and content. The chloroplast genomes of ferns, thegymnosperm Ginkgo, and most angiosperms are nearly collinear, reflectingthe gene order in lineages that diverged from lycopsids and the ancestralchloroplast gene order over 350 million years ago (Raubeson and Jansen,1992). Although earlier mapping studies
Zheng, Zhao-Guang; Duan, Ting-Ting; He, Bao; Tang, Dan; Jia, Xiao-Bin; Wang, Ru-Shang; Zhu, Jia-Xiao; Xu, You-Hua; Zhu, Quan; Feng, Liang
2013-04-15
A cell-permeable membrane, as typified by Transwell insert Permeable Supports, permit accurate repeatable invasion assays, has been developed as a tool for screening immunological active components in Smilacis Glabrae Rhizoma (SGR). In this research, components in the water extract of SGR (ESGR) might conjugate with the receptors or other targets on macrophages which invaded Transwell inserts, and then the eluate which contained components biospecific binding to macrophages was identified by HPLC-ESI-MS(n) analysis. Six compounds, which could interact with macrophages, were detected and identified. Among these compounds, taxifolin (2) and astilbin (4) were identified by comparing with the chromatography of standards, while the four others including 5-O-caffeoylshikimic acid (1), neoastilbin (3), neoisoastilbin (5) and isoastilbin (6), were elucidated by their structure clearage characterizations of tandem mass spectrometry. Then compound 1 was isolated and purified from SGR, along with 2 and 4, was applied to the macrophage migration and adhesion assay in HUVEC (Human Umbilical Vein Endothelial Cells) -macrophages co-incultured Transwell system for immunological activity assessment. The results showed that compounds 1, 2 and 4 with concentration of 5μM (H), 500nM (M) and 50nM (L) could remarkably inhibit the macrophage migration and adhesion (Vs AGEs (Advanced Glycation End Produces) group, 1-L, 2-H and 4-L groups: pgroups: pESI-MS(n) analysis is a rapid, simple and reliable method for screening immunological active components from Traditional Chinese Medicine. Copyright © 2013 Elsevier B.V. All rights reserved.
1985-01-01
The 51-J mission insignia, designed by Atlantis's first crew, pays tribute to the Statue of Liberty and the ideas it symbolizes. The historical gateway figure bears additional significance for Astronauts Karol J. Bobko, mission commander; and Ronald J. Grabe, pilot, both New Your Natives.
RTEL1 Inhibits Trinucleotide Repeat Expansions and Fragility
Directory of Open Access Journals (Sweden)
Aisling Frizzell
2014-03-01
Full Text Available Human RTEL1 is an essential, multifunctional helicase that maintains telomeres, regulates homologous recombination, and helps prevent bone marrow failure. Here, we show that RTEL1 also blocks trinucleotide repeat expansions, the causal mutation for 17 neurological diseases. Increased expansion frequencies of (CTG⋅CAG repeats occurred in human cells following knockdown of RTEL1, but not the alternative helicase Fbh1, and purified RTEL1 efficiently unwound triplet repeat hairpins in vitro. The expansion-blocking activity of RTEL1 also required Rad18 and HLTF, homologs of yeast Rad18 and Rad5. These findings are reminiscent of budding yeast Srs2, which inhibits expansions, unwinds hairpins, and prevents triplet-repeat-induced chromosome fragility. Accordingly, we found expansions and fragility were suppressed in yeast srs2 mutants expressing RTEL1, but not Fbh1. We propose that RTEL1 serves as a human analog of Srs2 to inhibit (CTG⋅CAG repeat expansions and fragility, likely by unwinding problematic hairpins.
Isolation of human simple repeat loci by hybridization selection.
Armour, J A; Neumann, R; Gobert, S; Jeffreys, A J
1994-04-01
We have isolated short tandem repeat arrays from the human genome, using a rapid method involving filter hybridization to enrich for tri- or tetranucleotide tandem repeats. About 30% of clones from the enriched library cross-hybridize with probes containing trimeric or tetrameric tandem arrays, facilitating the rapid isolation of large numbers of clones. In an initial analysis of 54 clones, 46 different tandem arrays were identified. Analysis of these tandem repeat loci by PCR showed that 24 were polymorphic in length; substantially higher levels of polymorphism were displayed by the tetrameric repeat loci isolated than by the trimeric repeats. Primary mapping of these loci by linkage analysis showed that they derive from 17 chromosomes, including the X chromosome. We anticipate the use of this strategy for the efficient isolation of tandem repeats from other sources of genomic DNA, including DNA from flow-sorted chromosomes, and from other species.
CAST/EiJ and C57BL/6J Mice Differ in Their Oral and Postoral Attraction to Glucose and Fructose.
Sclafani, Anthony; Vural, Austin S; Ackroff, Karen
2017-03-01
A recent study indicated that CAST/EiJ and C57BL/6J mice differ in their taste preferences for maltodextrin but display similar sucrose preferences. The present study revealed strain differences in preferences for the constituent sugars of sucrose. Whereas B6 mice preferred 8% glucose to 8% fructose in 2-day tests, the CAST mice preferred fructose to glucose. These preferences emerged with repeated testing which suggested post-oral influences. In a second experiment, 2-day choice tests were conducted with the sugars versus a sucralose + saccharin (SS) mixture which is highly preferred in brief access tests. B6 mice strongly preferred glucose but not fructose to the non-nutritive SS whereas CAST mice preferred SS to both glucose and fructose even when food restricted. This implied that CAST mice are insensitive to the postoral appetite stimulating actions of the 2 sugars. A third experiment revealed, however, that intragastric glucose and fructose infusions conditioned significant but mild flavor preferences in CAST mice, whereas in B6 mice glucose conditioned a robust preference but fructose was ineffective. Thus, unlike other mouse strains and rats, glucose is not more reinforcing than fructose in CAST mice. Their oral preference for fructose over glucose may be related to a subsensitive maltodextrin receptor or glucose-specific receptor which is stimulated by glucose but not fructose. The failure of CAST mice to prefer glucose to a non-nutritive sweetener distinguishes this strain from other mouse strains and rats. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Manisha Pandey
Full Text Available Vaccination with J8-DT, a leading GAS vaccine candidate, results in protective immunity in mice. Analysis of immunologic correlates of protection indicated a role of J8-specific antibodies that were induced post-immunization. In the present study, several independent experimental approaches were employed to investigate the protective immunological mechanisms involved in J8-DT-mediated immunity. These approaches included the passive transfer of mouse or rabbit immune serum/antibodies in addition to selective depletion of T-cell subsets prior to bacterial challenge. Passive transfer of J8-DT antiserum/antibodies from mice and rabbits conferred significant resistance against challenge to mice. To exclude the possibility of involvement of other host immune factors, the studies were repeated in SCID mice, which highlighted the need for an ongoing immune response for long-lived protection. Depletion of CD4(+ and CD8(+ T-cell subsets confirmed that an active de novo immune response, involving CD4(+ T-helper cells, is required for continued synthesis of antibodies resulting in protection against GAS infection. Taken together these results indicate an involvement of CD4(+ T-cells in J8-DT-mediated protection possibly via an ability to maintain antibody levels. These results have considerable relevance to the development of a broad spectrum passive immunotherapy for GAS disease.
Using Social Media to Increase Accessibility to Online Teaching Resources.
O'Kelly, B; McHugh, S; McHugh, T; Fady, N; Boyle, E; Hill, A D K
2015-09-01
The key learning points of Surgical Grand Rounds (SGR) are often not accessible at times of exam revision for students. We sought to use Twitter as an online teaching repository. A SGR Twitter profile was created. 23 SGR presentations were made accessible on Twitter over a 3 month period. 93 students were invited to complete a questionnaire assessing usage of the repository. 84 (90%) in total responded, of these, 25 (80.6%) felt that the online provision of SGR through twitter was "useful". The majority (71%) felt that the online content was easily accessible. The novel use of social media is a useful adjunctive educational tool in accessing an online repository of SGR presentations.
International Nuclear Information System (INIS)
Chanowitz, M.S.
1984-06-01
J/psi physics is discussed which will be of interest at T > 1988, the period of operation of the Beijing Electron Positron Collider. Emphasis is placed on the gluonic states which are best studied in radiative J/psi decay. The difficulties of these studies are discussed and the need for very high statistics is stressed. In particular it is essential to partial-wave-analyze the hadronic final states produced in J/psi → γX. An estimate using fixed target data suggests that 0(10 8 ) J/psi decays are needed to do an unambiguous partial wave analysis for hadron masses up to about 2 GeV. This requirement is an excellent match to the BEPC design parameters, which imply production of 0(10 8 ) J/psi's per year. With a J/psi production rate an order of magnitude greater than other electron-positron storage rings, BEPC will be a unique world facility for these studies. 58 references
(j,0)circle-plus(0,j) representation space: Dirac-like construct
International Nuclear Information System (INIS)
Ahluwalia, D.V.; Johnson, M.B.; Goldman, T.
1993-01-01
This is first of the two invited lectures presented at the ''XVII International School of Theoretical Physics: Standard Model and Beyond 1993.'' The text is essentially based on a recent publication by the present authors. Here we show that the Dirac-like construct in the (j,0)circle-plus(0,j) representation space support a Bargmann-Wightman-Wigner type quantum field theory
(j,0){circle_plus}(0,j) representation space: Dirac-like construct
Energy Technology Data Exchange (ETDEWEB)
Ahluwalia, D.V.; Johnson, M.B.; Goldman, T.
1993-12-31
This is first of the two invited lectures presented at the ``XVII International School of Theoretical Physics: Standard Model and Beyond 1993.`` The text is essentially based on a recent publication by the present authors. Here we show that the Dirac-like construct in the (j,0){circle_plus}(0,j) representation space support a Bargmann-Wightman-Wigner type quantum field theory.
On balanced minimal repeated measurements designs
Directory of Open Access Journals (Sweden)
Shakeel Ahmad Mir
2014-10-01
Full Text Available Repeated Measurements designs are concerned with scientific experiments in which each experimental unit is assigned more than once to a treatment either different or identical. This class of designs has the property that the unbiased estimators for elementary contrasts among direct and residual effects are obtainable. Afsarinejad (1983 provided a method of constructing balanced Minimal Repeated Measurements designs p < t , when t is an odd or prime power, one or more than one treatment may occur more than once in some sequences and designs so constructed no longer remain uniform in periods. In this paper an attempt has been made to provide a new method to overcome this drawback. Specifically, two cases have been considered RM[t,n=t(t-t/(p-1,p], λ2=1 for balanced minimal repeated measurements designs and RM[t,n=2t(t-t/(p-1,p], λ2=2 for balanced repeated measurements designs. In addition , a method has been provided for constructing extra-balanced minimal designs for special case RM[t,n=t2/(p-1,p], λ2=1.
ATXN2 trinucleotide repeat length correlates with risk of ALS.
Sproviero, William; Shatunov, Aleksey; Stahl, Daniel; Shoai, Maryam; van Rheenen, Wouter; Jones, Ashley R; Al-Sarraj, Safa; Andersen, Peter M; Bonini, Nancy M; Conforti, Francesca L; Van Damme, Philip; Daoud, Hussein; Del Mar Amador, Maria; Fogh, Isabella; Forzan, Monica; Gaastra, Ben; Gellera, Cinzia; Gitler, Aaron D; Hardy, John; Fratta, Pietro; La Bella, Vincenzo; Le Ber, Isabelle; Van Langenhove, Tim; Lattante, Serena; Lee, Yi-Chung; Malaspina, Andrea; Meininger, Vincent; Millecamps, Stéphanie; Orrell, Richard; Rademakers, Rosa; Robberecht, Wim; Rouleau, Guy; Ross, Owen A; Salachas, Francois; Sidle, Katie; Smith, Bradley N; Soong, Bing-Wen; Sorarù, Gianni; Stevanin, Giovanni; Kabashi, Edor; Troakes, Claire; van Broeckhoven, Christine; Veldink, Jan H; van den Berg, Leonard H; Shaw, Christopher E; Powell, John F; Al-Chalabi, Ammar
2017-03-01
We investigated a CAG trinucleotide repeat expansion in the ATXN2 gene in amyotrophic lateral sclerosis (ALS). Two new case-control studies, a British dataset of 1474 ALS cases and 567 controls, and a Dutch dataset of 1328 ALS cases and 691 controls were analyzed. In addition, to increase power, we systematically searched PubMed for case-control studies published after 1 August 2010 that investigated the association between ATXN2 intermediate repeats and ALS. We conducted a meta-analysis of the new and existing studies for the relative risks of ATXN2 intermediate repeat alleles of between 24 and 34 CAG trinucleotide repeats and ALS. There was an overall increased risk of ALS for those carrying intermediate sized trinucleotide repeat alleles (odds ratio 3.06 [95% confidence interval 2.37-3.94]; p = 6 × 10 -18 ), with an exponential relationship between repeat length and ALS risk for alleles of 29-32 repeats (R 2 = 0.91, p = 0.0002). No relationship was seen for repeat length and age of onset or survival. In contrast to trinucleotide repeat diseases, intermediate ATXN2 trinucleotide repeat expansion in ALS does not predict age of onset but does predict disease risk. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.
Sennhenn-Kirchner, S; Goerlich, Y; Kirchner, B; Notbohm, M; Schiekirka, S; Simmenroth, A; Raupach, T
2018-02-01
Recent studies in undergraduate medical education have demonstrated the advantage of repeated testing over repeated practice with regard to knowledge and skills retention. The aim of this study was to investigate whether this "testing effect" also applies to skills retention in undergraduate dental education. In this prospective, randomised controlled trial, fourth-year dental students at Göttingen University Medical Centre participated in a training session on surgical suturing in winter term 2014/2015. Following this, they were either assigned to two sessions of additional skills training (group A) or two sessions of skills assessment with feedback (group B). These sessions were spaced over a period of 4 weeks. Skills retention was assessed in a summative objective structured clinical examination (OSCE) at the end of term, that is 6 months after the initial teaching session. A total of 32 students completed the study. With regard to suturing, OSCE performance was significantly better in group B than group A (81.9±13.1% vs 63.0±15.4%; P=0.001; Cohen's d=1.33). There was no significant OSCE performance difference in the two groups with regard to other learning objectives that were addressed in the end-of-term examination. Thus, the group difference was specific to suturing skills. This is the first study to demonstrate that in dental education, repeated testing produces more favourable skills retention than repeated practice. Test-enhanced learning might be a viable concept for skills retention in undergraduate dentistry education. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
RTEL1 Inhibits Trinucleotide Repeat Expansions and Fragility
Aisling Frizzell; Jennifer H.G. Nguyen; Mark I.R. Petalcorin; Katherine D. Turner; Simon J. Boulton; Catherine H. Freudenreich; Robert S. Lahue
2014-01-01
SUMMARY Human RTEL1 is an essential, multifunctional helicase that maintains telomeres, regulates homologous recombination, and helps prevent bone marrow failure. Here, we show that RTEL1 also blocks trinucleotide repeat expansions, the causal mutation for 17 neurological diseases. Increased expansion frequencies of (CTG·CAG) repeats occurred in human cells following knockdown of RTEL1, but not the alternative helicase Fbh1, and purified RTEL1 efficiently unwound triplet repeat hairpins in vi...
DEFF Research Database (Denmark)
Vinther-Jensen, Tua; Ek, Jakob; Duno, Morten
2013-01-01
The spinocerebellar ataxias (SCA) are a genetically and clinically heterogeneous group of diseases, characterized by dominant inheritance, progressive cerebellar ataxia and diverse extracerebellar symptoms. A subgroup of the ataxias is caused by unstable CAG-repeat expansions in their respective ...... of paternal germ-line repeat sequence instability of the expanded SCA2 locus.European Journal of Human Genetics advance online publication, 10 October 2012; doi:10.1038/ejhg.2012.231....
Autopesuloiden jätevesien biologinen puhdistaminen
Valtonen, Sanni
2011-01-01
Tämän opinnäytetyön tarkoituksena oli selvittää autopesuloiden jätevesien kuormittavuutta ja biologisen jätevesipuhdistusprosessin toimivuutta. Jätevedenpuhdistus perustuu kantoaineprosessiin, jossa kantoaineeseen tarttuva biofilmi eli mikrobikasvusto puhdistaa jäteveden pesuaine- ja öljyjäämistä. Tutkimus on osa Vesiturva-hanketta, ja jätevedenpuhdistusprosessi autopesuloissa on yksi osa sitä. Kohteena oli viisi autopesulaa, joista kolmessa jätevettä puhdistettiin biologisesti bioreaktor...
Directory of Open Access Journals (Sweden)
Ahmed Abdulkadhim Hamad
2017-08-01
Full Text Available In this paper, different techniques are used to improve the turbo decoding of regular repeat accumulate (RA and irregular repeat accumulate (IRA codes. The adaptive scaling of a-posteriori information produced by Soft-output Viterbi decoder (SOVA is proposed. The encoded pilots are another scheme that applied for short length RA codes. This work also suggests a simple and a fast method to generate a random interleaver having a free 4 cycle Tanner graph. Progressive edge growth algorithm (PEG is also studied and simulated to create the Tanner graphs which have a great girth.
Analysis of CR1 Repeats in the Zebra Finch Genome
Directory of Open Access Journals (Sweden)
George E. Liu
2013-06-01
Full Text Available Most bird species have smaller genomes and fewer repeats than mammals. Chicken Repeat 1 (CR1 repeat is one of the most abundant families of repeats, ranging from ~133,000 to ~187,000 copies accounting for ~50 to ~80% of the interspersed repeats in the zebra finch and chicken genomes, respectively. CR1 repeats are believed to have arisen from the retrotransposition of a small number of master elements, which gave rise to multiple CR1 subfamilies in the chicken. In this study, we performed a global assessment of the divergence distributions, phylogenies, and consensus sequences of CR1 repeats in the zebra finch genome. We identified and validated 34 CR1 subfamilies and further analyzed the correlation between these subfamilies. We also discovered 4 novel lineage-specific CR1 subfamilies in the zebra finch when compared to the chicken genome. We built various evolutionary trees of these subfamilies and concluded that CR1 repeats may play an important role in reshaping the structure of bird genomes.
Measurement of repeat effects in Chicago’s criminal social network
Directory of Open Access Journals (Sweden)
Paul Kump
2016-07-01
Full Text Available The “near-repeat” effect is a well-known criminological phenomenon in which the occurrence of a crime incident gives rise to a temporary elevation of crime risk within close physical proximity to an initial incident. Adopting a social network perspective, we instead define a near repeat in terms of geodesic distance within a criminal social network, rather than spatial distance. Specifically, we report a statistical analysis of repeat effects in arrest data for Chicago during the years 2003–2012. We divide the arrest data into two sets (violent crimes and other crimes and, for each set, we compare the distributions of time intervals between repeat incidents to theoretical distributions in which repeat incidents occur only by chance. We first consider the case of the same arrestee participating in repeat incidents (“exact repeats” and then extend the analysis to evaluate repeat risks of those arrestees near one another in the social network. We observe repeat effects that diminish as a function of geodesic distance and time interval, and we estimate typical time scales for repeat crimes in Chicago.
Large Polyglutamine Repeats Cause Muscle Degeneration in SCA17 Mice
Directory of Open Access Journals (Sweden)
Shanshan Huang
2015-10-01
Full Text Available In polyglutamine (polyQ diseases, large polyQ repeats cause juvenile cases with different symptoms than those of adult-onset patients, who carry smaller expanded polyQ repeats. The mechanisms behind the differential pathology mediated by different polyQ repeat lengths remain unknown. By studying knockin mouse models of spinal cerebellar ataxia-17 (SCA17, we found that a large polyQ (105 glutamines in the TATA-box-binding protein (TBP preferentially causes muscle degeneration and reduces the expression of muscle-specific genes. Direct expression of TBP with different polyQ repeats in mouse muscle revealed that muscle degeneration is mediated only by the large polyQ repeats. Different polyQ repeats differentially alter TBP’s interaction with neuronal and muscle-specific transcription factors. As a result, the large polyQ repeat decreases the association of MyoD with TBP and DNA promoters. Our findings suggest that specific alterations in protein interactions by large polyQ repeats may account for the unique pathology in juvenile polyQ diseases.
Large Polyglutamine Repeats Cause Muscle Degeneration in SCA17 Mice
Huang, Shanshan; Yang, Su; Guo, Jifeng; Yan, Sen; Gaertig, Marta A.; Li, Shihua; Li, Xiao-Jiang
2015-01-01
SUMMARY In polyglutamine (polyQ) diseases, large polyQ repeats cause juvenile cases with different symptoms than adult-onset patients, who carry smaller expanded polyQ repeats. The mechanisms behind the differential pathology mediated by different polyQ repeat lengths remain unknown. By studying knock-in mouse models of spinal cerebellar ataxia-17 (SCA17), we found that a large polyQ (105 glutamines) in the TATA box-binding protein (TBP) preferentially causes muscle degeneration and reduces the expression of muscle-specific genes. Direct expression of TBP with different polyQ repeats in mouse muscle revealed that muscle degeneration is mediated only by the large polyQ repeats. Different polyQ repeats differentially alter TBP’s interaction with neuronal and muscle-specific transcription factors. As a result, the large polyQ repeat decreases the association of MyoD with TBP and DNA promoters. Our findings suggest that specific alterations in protein interactions by large polyQ repeats may account for the unique pathology in juvenile polyQ diseases. PMID:26387956
The impact of steam generator replacement on PWR primary system contamination
International Nuclear Information System (INIS)
Dacquait, F.; Marteau, H.; Guinard, L.; Ranchoux, G.; Taunier, S.; Wintergerst, M.; Bretelle, J.L.; Rocher, A.
2010-01-01
This paper analyses the impact of Steam Generator Replacement (SGR) on PWR primary circuit contamination. It presents a comparison of the activities deposited inside the primary system and released during refuelling outages after SGR with three different SG tube alloys (600, 690 and 800) and different SG tube manufacturing processes. A SGR has a great impact on the primary system contamination. After SGR, whatever the SG tube material is, the typical variations are the following: The 58 Co contamination increases for 1 to 3 cycles, and then decreases to very low levels in some cases, mainly depending on the manufacturing process of the replacement SG tubes; The 60 Co Co contamination tends to decrease on the primary coolant pipes and increases by a lower rate on the new SG tubes. This analysis highlights the importance on contamination levels after SGR of both the corrosion product deposits on the primary surfaces before SGR and the surface finish of the SG tubes related to their manufacturing process. (author)
Spitler, L G; Scholz, P; Hessels, J W T; Bogdanov, S; Brazier, A; Camilo, F; Chatterjee, S; Cordes, J M; Crawford, F; Deneva, J; Ferdman, R D; Freire, P C C; Kaspi, V M; Lazarus, P; Lynch, R; Madsen, E C; McLaughlin, M A; Patel, C; Ransom, S M; Seymour, A; Stairs, I H; Stappers, B W; van Leeuwen, J; Zhu, W W
2016-03-10
Fast radio bursts are millisecond-duration astronomical radio pulses of unknown physical origin that appear to come from extragalactic distances. Previous follow-up observations have failed to find additional bursts at the same dispersion measure (that is, the integrated column density of free electrons between source and telescope) and sky position as the original detections. The apparent non-repeating nature of these bursts has led to the suggestion that they originate in cataclysmic events. Here we report observations of ten additional bursts from the direction of the fast radio burst FRB 121102. These bursts have dispersion measures and sky positions consistent with the original burst. This unambiguously identifies FRB 121102 as repeating and demonstrates that its source survives the energetic events that cause the bursts. Additionally, the bursts from FRB 121102 show a wide range of spectral shapes that appear to be predominantly intrinsic to the source and which vary on timescales of minutes or less. Although there may be multiple physical origins for the population of fast radio bursts, these repeat bursts with high dispersion measure and variable spectra specifically seen from the direction of FRB 121102 support an origin in a young, highly magnetized, extragalactic neutron star.
RTEL1 inhibits trinucleotide repeat expansions and fragility.
Frizzell, Aisling; Nguyen, Jennifer H G; Petalcorin, Mark I R; Turner, Katherine D; Boulton, Simon J; Freudenreich, Catherine H; Lahue, Robert S
2014-03-13
Human RTEL1 is an essential, multifunctional helicase that maintains telomeres, regulates homologous recombination, and helps prevent bone marrow failure. Here, we show that RTEL1 also blocks trinucleotide repeat expansions, the causal mutation for 17 neurological diseases. Increased expansion frequencies of (CTG⋅CAG) repeats occurred in human cells following knockdown of RTEL1, but not the alternative helicase Fbh1, and purified RTEL1 efficiently unwound triplet repeat hairpins in vitro. The expansion-blocking activity of RTEL1 also required Rad18 and HLTF, homologs of yeast Rad18 and Rad5. These findings are reminiscent of budding yeast Srs2, which inhibits expansions, unwinds hairpins, and prevents triplet-repeat-induced chromosome fragility. Accordingly, we found expansions and fragility were suppressed in yeast srs2 mutants expressing RTEL1, but not Fbh1. We propose that RTEL1 serves as a human analog of Srs2 to inhibit (CTG⋅CAG) repeat expansions and fragility, likely by unwinding problematic hairpins. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.
Contraceptive Use among Women Seeking Repeat Abortion in ...
African Journals Online (AJOL)
AJRH Managing Editor
Compared with women seeking their first abortion, significantly more repeat abortion clients had ever used contraceptives ... findings, the level of repeat abortions in Europe, .... and contraceptive history, and post-abortion ..... working women.
2009-01-01
J-PARC, Japan’s new Proton Accelerator Research Complex, is being inaugurated on 6 July. An official inauguration is always a very special day in the life of any new facility, and J-PARC is no exception. It has been fascinating to watch J-PARC coming to life over recent months, with neutron and muon beams reaching the material and life sciences facility last year, followed by proton beams in the hadron experimental hall early this year, and most recently the first neutrinos to Super-Kamiokande. J-PARC is a superb example not only of collaboration between labs and agencies, run as it is as a joint project between KEK and JAEA, but also of interdisciplinarity. Bringing life sciences, material sciences, nuclear and particle physics together on the same campus makes J-PARC unique and visionary. By innovating in the production of high-intensity secondary beams, while at the same time providing a new lease of life to existing facilities, J-PARC is also a model of forward think...
Environmental stress induces trinucleotide repeat mutagenesis in human cells.
Chatterjee, Nimrat; Lin, Yunfu; Santillan, Beatriz A; Yotnda, Patricia; Wilson, John H
2015-03-24
The dynamic mutability of microsatellite repeats is implicated in the modification of gene function and disease phenotype. Studies of the enhanced instability of long trinucleotide repeats (TNRs)-the cause of multiple human diseases-have revealed a remarkable complexity of mutagenic mechanisms. Here, we show that cold, heat, hypoxic, and oxidative stresses induce mutagenesis of a long CAG repeat tract in human cells. We show that stress-response factors mediate the stress-induced mutagenesis (SIM) of CAG repeats. We show further that SIM of CAG repeats does not involve mismatch repair, nucleotide excision repair, or transcription, processes that are known to promote TNR mutagenesis in other pathways of instability. Instead, we find that these stresses stimulate DNA rereplication, increasing the proportion of cells with >4 C-value (C) DNA content. Knockdown of the replication origin-licensing factor CDT1 eliminates both stress-induced rereplication and CAG repeat mutagenesis. In addition, direct induction of rereplication in the absence of stress also increases the proportion of cells with >4C DNA content and promotes repeat mutagenesis. Thus, environmental stress triggers a unique pathway for TNR mutagenesis that likely is mediated by DNA rereplication. This pathway may impact normal cells as they encounter stresses in their environment or during development or abnormal cells as they evolve metastatic potential.
Oxidative stress adaptation with acute, chronic, and repeated stress.
Pickering, Andrew M; Vojtovich, Lesya; Tower, John; A Davies, Kelvin J
2013-02-01
Oxidative stress adaptation, or hormesis, is an important mechanism by which cells and organisms respond to, and cope with, environmental and physiological shifts in the level of oxidative stress. Most studies of oxidative stress adaption have been limited to adaptation induced by acute stress. In contrast, many if not most environmental and physiological stresses are either repeated or chronic. In this study we find that both cultured mammalian cells and the fruit fly Drosophila melanogaster are capable of adapting to chronic or repeated stress by upregulating protective systems, such as their proteasomal proteolytic capacity to remove oxidized proteins. Repeated stress adaptation resulted in significant extension of adaptive responses. Repeated stresses must occur at sufficiently long intervals, however (12-h or more for MEF cells and 7 days or more for flies), for adaptation to be successful, and the levels of both repeated and chronic stress must be lower than is optimal for adaptation to acute stress. Regrettably, regimens of adaptation to both repeated and chronic stress that were successful for short-term survival in Drosophila nevertheless also caused significant reductions in life span for the flies. Thus, although both repeated and chronic stress can be tolerated, they may result in a shorter life. Copyright © 2012 Elsevier Inc. All rights reserved.
Brooks, William; The ATLAS collaboration; Hu, Qipeng
2015-01-01
The production rates of heavy quarkonia states in A-A collisions provide sensitive probes to the hot and dense QGP. However, a reference for understanding the dissociation in the hot medium is necessary; p-A collisions open the possibility to study heavy quarkonia states in a smaller system. This is an important step in forming a baseline for understanding A-A collisions, as well as an investigation into the nature of modifications of the parton distributions in the nucleus. Using data collected at the LHC in 2013, the ATLAS experiment will show results on the prompt J/psi and psi(2S) nuclear modification factors and the double ratio, psi(2S) divided by J/Psi in p-Pb divided by the same in p-p, in p-Pb collisions at 5.02 TeV. The charmonia states were reconstructed via the dimuon decay channel and the yield will be differentially presented in bins of transverse momentum, rapidity, and event activity.
Repeat Gamma Knife Radiosurgery for Trigeminal Neuralgia
International Nuclear Information System (INIS)
Aubuchon, Adam C.; Chan, Michael D.; Lovato, James F.; Balamucki, Christopher J.; Ellis, Thomas L.; Tatter, Stephen B.; McMullen, Kevin P.; Munley, Michael T.; Deguzman, Allan F.; Ekstrand, Kenneth E.; Bourland, J. Daniel; Shaw, Edward G.
2011-01-01
Purpose: Repeat gamma knife stereotactic radiosurgery (GKRS) for recurrent or persistent trigeminal neuralgia induces an additional response but at the expense of an increased incidence of facial numbness. The present series summarized the results of a repeat treatment series at Wake Forest University Baptist Medical Center, including a multivariate analysis of the data to identify the prognostic factors for treatment success and toxicity. Methods and Materials: Between January 1999 and December 2007, 37 patients underwent a second GKRS application because of treatment failure after a first GKRS treatment. The mean initial dose in the series was 87.3 Gy (range, 80–90). The mean retreatment dose was 84.4 Gy (range, 60–90). The dosimetric variables recorded included the dorsal root entry zone dose, pons surface dose, and dose to the distal nerve. Results: Of the 37 patients, 81% achieved a >50% pain relief response to repeat GKRS, and 57% experienced some form of trigeminal dysfunction after repeat GKRS. Two patients (5%) experienced clinically significant toxicity: one with bothersome numbness and one with corneal dryness requiring tarsorraphy. A dorsal root entry zone dose at repeat treatment of >26.6 Gy predicted for treatment success (61% vs. 32%, p = .0716). A cumulative dorsal root entry zone dose of >84.3 Gy (72% vs. 44%, p = .091) and a cumulative pons surface dose of >108.5 Gy (78% vs. 44%, p = .018) predicted for post-GKRS numbness. The presence of any post-GKRS numbness predicted for a >50% decrease in pain intensity (100% vs. 60%, p = .0015). Conclusion: Repeat GKRS is a viable treatment option for recurrent trigeminal neuralgia, although the patient assumes a greater risk of nerve dysfunction to achieve maximal pain relief.
Repeat Gamma Knife Radiosurgery for Trigeminal Neuralgia
Energy Technology Data Exchange (ETDEWEB)
Aubuchon, Adam C., E-mail: acaubuchon@gmail.com [Department of Radiation Oncology, Wake Forest University School of Medicine, Winston-Salem, NC (United States); Chan, Michael D. [Department of Radiation Oncology, Wake Forest University School of Medicine, Winston-Salem, NC (United States); Lovato, James F. [Department of Public Health Sciences, Wake Forest University School of Medicine, Winston-Salem, NC (United States); Balamucki, Christopher J. [Department of Radiation Oncology, University of Florida, Gainesville, FL (United States); Ellis, Thomas L.; Tatter, Stephen B. [Department of Neurosurgery, Wake Forest University School of Medicine, Winston-Salem, NC (United States); McMullen, Kevin P.; Munley, Michael T.; Deguzman, Allan F.; Ekstrand, Kenneth E.; Bourland, J. Daniel; Shaw, Edward G. [Department of Radiation Oncology, Wake Forest University School of Medicine, Winston-Salem, NC (United States)
2011-11-15
Purpose: Repeat gamma knife stereotactic radiosurgery (GKRS) for recurrent or persistent trigeminal neuralgia induces an additional response but at the expense of an increased incidence of facial numbness. The present series summarized the results of a repeat treatment series at Wake Forest University Baptist Medical Center, including a multivariate analysis of the data to identify the prognostic factors for treatment success and toxicity. Methods and Materials: Between January 1999 and December 2007, 37 patients underwent a second GKRS application because of treatment failure after a first GKRS treatment. The mean initial dose in the series was 87.3 Gy (range, 80-90). The mean retreatment dose was 84.4 Gy (range, 60-90). The dosimetric variables recorded included the dorsal root entry zone dose, pons surface dose, and dose to the distal nerve. Results: Of the 37 patients, 81% achieved a >50% pain relief response to repeat GKRS, and 57% experienced some form of trigeminal dysfunction after repeat GKRS. Two patients (5%) experienced clinically significant toxicity: one with bothersome numbness and one with corneal dryness requiring tarsorraphy. A dorsal root entry zone dose at repeat treatment of >26.6 Gy predicted for treatment success (61% vs. 32%, p = .0716). A cumulative dorsal root entry zone dose of >84.3 Gy (72% vs. 44%, p = .091) and a cumulative pons surface dose of >108.5 Gy (78% vs. 44%, p = .018) predicted for post-GKRS numbness. The presence of any post-GKRS numbness predicted for a >50% decrease in pain intensity (100% vs. 60%, p = .0015). Conclusion: Repeat GKRS is a viable treatment option for recurrent trigeminal neuralgia, although the patient assumes a greater risk of nerve dysfunction to achieve maximal pain relief.
Lamoureux, Nicholas R; Tomkinson, Grant R; Peterson, Benjamin J; Fitzgerald, John S
2018-04-01
Lamoureux, NR, Tomkinson, GR, Peterson, BJ, and Fitzgerald, JS. Relationship between skating economy and performance during a repeated-shift test in elite and subelite ice hockey players. J Strength Cond Res 32(4): 1109-1113, 2018-The purpose of this study was to determine the importance of skating economy to fatigue during repeated high-intensity efforts of a simulated ice hockey shift. Forty-five collegiate and Junior A male ice hockey players (aged 18-24 years) performed a continuous graded exercise test using a skate treadmill. Breath-by-breath data for oxygen consumption (V[Combining Dot Above]O2) and respiratory exchange ratio were collected and used to derive energy expenditure (EE) averaged over the final 10 seconds of each stage. Economy was determined as the slope of the regression line relating V[Combining Dot Above]O2 and EE against skating speed separately. Participants also completed 8 bouts of maximal ice skating through a course designed to simulate typical shift, with timing gates determining first half, second half, and total fatigue decrement, calculated by a percent decrement score. Partial correlation was used to determine the association between economy measures and decrement during the repeated-shift test. Twenty-six participants met inclusion criteria and were included in data analysis. Skating economy measures (both relative V[Combining Dot Above]O2 and EE) were very likely moderate positive correlates of total fatigue decrement (r [95% confidence interval]: V[Combining Dot Above]O2, 0.46 [0.09, 0.72] and EE, 0.44, [0.06, 0.71]) but not with first or second gate decrement. Our results indicate that skating economy plays an important role in fatigue resistance over repeated on-ice sprints designed to simulate a typical shift. This supports the use of technical skating coaching and training techniques to enhance skating economy as a means of improving ice hockey performance.
Repeat Assessed Values Model for Housing Price Index
Directory of Open Access Journals (Sweden)
Carini Manuela
2017-12-01
Full Text Available This study proposes an innovative methodology, named Repeat Appraised Price Model (RAV, useful for determining the price index numbers for real estate markets and the corresponding index numbers of hedonic prices of main real estate characteristics in the case of a lack of data. The methodological approach proposed in this paper aims to appraise the time series of price index numbers. It integrates the principles of the method of repeat sales with the peculiarities of the Hedonic Price Method, overcoming the problem of an almost total absence of repeat sales for the same property in a given time range; on the other hand, the technique aims to overcome the limitation of the repeat sales technique concerning the inability to take into account the characteristics of individual properties.
Strain-specific outcomes of repeated social defeat and chronic fluoxetine treatment in the mouse.
Razzoli, Maria; Carboni, Lucia; Andreoli, Michela; Michielin, Francesca; Ballottari, Alice; Arban, Roberto
2011-01-01
Social stress is a risk factor for affective disorders in vulnerable individuals. Although the biological nature of stress susceptibility/resilience remains to be elucidated, genetic variation is considered amongst the principal contributors to brain disorders. Furthermore, genetic predisposition may be determinant for the therapeutic outcome, as proposed for antidepressant treatments. In the present studies we compared the inherently diverse genetic backgrounds of 2 mouse strains by assessing the efficacy of a chronic antidepressant treatment in a repeated social stress procedure. C57BL/6J and BalbC mice underwent 10-day social defeats followed by 28-day fluoxetine treatment (10 mg/kg/mL, p.o.). In C57BL/6J, most of the social defeat-induced changes were of metabolic nature including persistently altered feed efficiency and decreased abdominal fat stores that were ameliorated by fluoxetine. BalbC mouse behavior was persistently affected by social defeat both in the social avoidance and the forced swim tests, and in either procedure it was restored by chronic fluoxetine, whereas their endocrine parameters were mostly unaffected. The highlighted strain-specific responsivity to the metabolic and behavioral consequences of social defeat and to the chronic antidepressant treatment offers a promising research tool to further explore the underlying neural mechanisms and genetic basis of stress susceptibility and treatment response. Copyright © 2010 Elsevier Inc. All rights reserved.
Repeatability and reproducibility of decisions by latent fingerprint examiners.
Directory of Open Access Journals (Sweden)
Bradford T Ulery
Full Text Available The interpretation of forensic fingerprint evidence relies on the expertise of latent print examiners. We tested latent print examiners on the extent to which they reached consistent decisions. This study assessed intra-examiner repeatability by retesting 72 examiners on comparisons of latent and exemplar fingerprints, after an interval of approximately seven months; each examiner was reassigned 25 image pairs for comparison, out of total pool of 744 image pairs. We compare these repeatability results with reproducibility (inter-examiner results derived from our previous study. Examiners repeated 89.1% of their individualization decisions, and 90.1% of their exclusion decisions; most of the changed decisions resulted in inconclusive decisions. Repeatability of comparison decisions (individualization, exclusion, inconclusive was 90.0% for mated pairs, and 85.9% for nonmated pairs. Repeatability and reproducibility were notably lower for comparisons assessed by the examiners as "difficult" than for "easy" or "moderate" comparisons, indicating that examiners' assessments of difficulty may be useful for quality assurance. No false positive errors were repeated (n = 4; 30% of false negative errors were repeated. One percent of latent value decisions were completely reversed (no value even for exclusion vs. of value for individualization. Most of the inter- and intra-examiner variability concerned whether the examiners considered the information available to be sufficient to reach a conclusion; this variability was concentrated on specific image pairs such that repeatability and reproducibility were very high on some comparisons and very low on others. Much of the variability appears to be due to making categorical decisions in borderline cases.
Soil wetting patterns of vegetation and inter-patches following single and repeated wildfires
González, Óscar; Malvar, Maruxa; van den Elsen, Erik; Hosseini, mohammadreza; Coelho, Celeste; Ritsema, Coen; Bautista, Susana; Keizer, Jan Jacob; Cerdà, Artemi
2015-04-01
Although wildfires spread in Mediterranean areas are considered a natural processes, the expected increase in fire frequency has raised concerns about the systems' future resilience (Pausas, 2004). Besides more frequent, future wildfires can become more severe and produce more pronounced changes in topsoil properties, vegetation and litter (Cerdá and Mataix-Solera, 2009). To deal with challenges, the EU funded CASCADE and RECARE projects, which are currently assessing soil threats and tipping-points for land degradation in a climatic gradient across Europe. The present research was developed in Portugal and aims to find relationships between fire frequency and soil wetting patterns following single versus repeated wildfires. In September 2012, a wildfire burnt 3000 ha. of Pine stands and shrub vegetation in the vicinity of Viseu district, North-Central Portugal. Analyses according to the available burnt-area maps (1975-2012), discriminated areas that has been burned 1x (called SD) and 4x (called D) times. In order to evaluate the post-fire soil surface moisture patterns, 6 slopes (3 in SD and 3 in D) were selected and a balanced experimental design with 72 soil moisture sensors (EC5 and GS3, from Decagon devices) was implemented under shrubs (n=18) and on bare (n=18) soil environments, at 2.5 cm and 7.5 cm soil depth each. The spatio-temporal occurrence of soil water repellence (SWR) (Keizer et al., 2008; Prats et al., 2013; Santos et al., 2014) was monthly assessed through the MED test at 2.5 cm and 7.5 cm soil depth into 5 sampling points located at regular distances along a transect running from the top to bottom of a selected slope in SD and D. Automatic and totalize rainfall gauges were also installed across the study area. Preliminary results showed that soil wetting patterns and SWR occurrence differs between SD, D sites and, between soil environment (under shrubs and on bare soil areas). SWR were more pronounced on the SD than in D, affecting soil wetting
Directory of Open Access Journals (Sweden)
Ingolf Waßmann
2017-06-01
Full Text Available Instructional videos enjoy great popularity in knowledge transfer due to recent developments in the field of online teaching (video platforms, MOOCs on the one hand and a huge selection as well as an easy production and distribution on the other hand. Nevertheless, videos lead to crucial disadvantages, which are in the nature of the data format. Thus, the search for specific contents in a video as well as the semantic processing for automated linkage with other related materials are associated with high expenditure. Consequently, the learning success-oriented selection of appropriate video segments and their arrangement to control individual learning processes are inhibited. While watching a video, already known facts may be repeated or can only be skipped by manually moving within the video. The same problem occurs when attempting to specifically repeat certain video sections. To solve this problem, a web application is introduced, which allows the semantic processing of videos towards adaptive learning contents: by integrating self-test tasks with defined follow-up activities, video segments can automatically be skipped or repeated and external contents are linked, based on the current user knowledge. The presented approach is based on an extension of the behaviorist learning theory of Branched Teaching Programs by Crowder, which includes learning progress-adapted sequences of learning units. At the same time, learner’s motivation and attention are promoted according to rules of Skinner’s Programmed Instruction and the reinforcement theory by regularly included self-test tasks. Additionally, by explicit distinction of related sections in the video, information are available in machine-readable form, so that further possibilities for finding and linking learning contents are established.
Reproducibility and Reliability of Repeated Quantitative Fluorescence Angiography
DEFF Research Database (Denmark)
Nerup, Nikolaj; Knudsen, Kristine Bach Korsholm; Ambrus, Rikard
2017-01-01
INTRODUCTION: When using fluorescence angiography (FA) in perioperative perfusion assessment, repeated measures with re-injections of fluorescent dye (ICG) may be required. However, repeated injections may cause saturation of dye in the tissue, exceeding the limit of fluorescence intensity...... that the camera can detect. As the emission of fluorescence is dependent of the excitatory light intensity, reduction of this may solve the problem. The aim of the present study was to investigate the reproducibility and reliability of repeated quantitative FA during a reduction of excitatory light....
Clinical oversight and the avoidance of repeat induced abortion.
Jacovetty, Erica L; Clare, Camille A; Squire, Mary-Beatrice; Kubal, Keshar P; Liou, Sherry; Inchiosa, Mario A
2018-06-03
To evaluate the impact of patient counseling, demographics, and contraceptive methods on repeat induced abortion in women attending family planning clinics. A retrospective chart review of repeat induced abortions was performed. The analysis included patients with an initial induced abortion obtained between January 1, 2001, and March 31, 2014, at New York City Health + Hospitals/Metropolitan. The duration of involvement in the family planning program, the use of contraceptive interventions, and 18 patient factors were analyzed for their correlation with the incidence of repeat induced abortions per year of follow-up. A decreased rate of repeat induced abortions was associated with a longer duration of clinical oversight (r 2 =0.449, Pabortions. By determining the patient characteristics that most influence repeat induced abortion rates, providers can best choose the most efficacious method of contraception available. © 2018 International Federation of Gynecology and Obstetrics.
SlideJ: An ImageJ plugin for automated processing of whole slide images.
Della Mea, Vincenzo; Baroni, Giulia L; Pilutti, David; Di Loreto, Carla
2017-01-01
The digital slide, or Whole Slide Image, is a digital image, acquired with specific scanners, that represents a complete tissue sample or cytological specimen at microscopic level. While Whole Slide image analysis is recognized among the most interesting opportunities, the typical size of such images-up to Gpixels- can be very demanding in terms of memory requirements. Thus, while algorithms and tools for processing and analysis of single microscopic field images are available, Whole Slide images size makes the direct use of such tools prohibitive or impossible. In this work a plugin for ImageJ, named SlideJ, is proposed with the objective to seamlessly extend the application of image analysis algorithms implemented in ImageJ for single microscopic field images to a whole digital slide analysis. The plugin has been complemented by examples of macro in the ImageJ scripting language to demonstrate its use in concrete situations.
D0 Silicon Upgrade: CTF Front End Crate J2/J3 Backplane Specification
International Nuclear Information System (INIS)
Baert, Mark
1995-01-01
GENERAL PHYSICAL LAYOUT: (1) The backplane is comprised of 2 identical sections, the upper half designated J1, and the lower half designated j3; (2) For each section, there are a total of 16 slots, designated 1 through 16, from left to right; (3) Odd numbered slots are left handed (Connectors to the left of the card), these slots utilize inverse DIN connectors; (4) Even numbered slots are right handed (Connectors to the right of the card), these slots utilize standard DIN connectors; (5) There are 2 60 pin daisy-chain headers associated with each section, 3M part number 3597-6003; (6) The headers associated with the J2 (upper) section are designated J2CHAINR and J2CHAINL; (7) The headers associated with the J3 (lower) section are designated J3CHAINL and J3CHAINR; and (8) Mechanical layout presented in drawing number 3823.113-MD-330045. TRIGGER SIGNALS: (1) There are 21 trigger signal which originate from a given slot and are routed to the slot immediately to the left and 21 trigger signals which originate from a given slot and are routed to the slot immediately to the right; (2) There are 21 trigger signals which originate from the slot immediately to the left of a given slot and 21 trigger signals which originate from the slot immediately to the right a given slot; (3) The signal are designated TRIGjk-n, when j is the source slot, k is the destination slot, and n is the signal number; (4) These signals shall be implemented as 100 ohm microstip above ground plane; and (5) No terminations. DC POWER: (1) Each slot is supplied with DC power on the connector pins designated as VCC and GND; (2) VCC and GND originates at rear of the backplane via press-in power terminals, their locations are shown in drawing number 3823.113-MD-330045; (3) Power shall be bypassed at 2 locations with a 10uF tantalum capacitor in parallel with a .01uF 100V ceramic capacitor; and (4) The total ampacity supplied by each DIN connector is 3.6 amps.
Lengstorf, Jason
2010-01-01
This book is for intermediate programmers interested in building AJAX web applications using jQuery and PHP. Along with teaching some advanced PHP techniques, it will teach you how to take your dynamic applications to the next level by adding a JavaScript layer with jQuery. * Learn to utilize built-in PHP functions to build calendar tools.* Learn how jQuery can be used for AJAX, animation, client-side validation, and more.What you'll learn* Use PHP to build a calendar application that allows users to post, view, edit, and delete events.* Use jQuery to allow the calendar app to be viewed and ed
The algorithmic performance of J-Tpeak for drug safety clinical trial.
Chien, Simon C; Gregg, Richard E
The interval from J-point to T-wave peak (JTp) in ECG is a new biomarker able to identify drugs that prolong the QT interval but have different ion channel effects. If JTp is not prolonged, the prolonged QT may be associated with multi ion channel block that may have low torsade de pointes risk. From the automatic ECG measurement perspective, accurate and repeatable measurement of JTp involves different challenges than QT. We evaluated algorithm performance and JTp challenges using the Philips DXL diagnostic 12/16/18-lead algorithm. Measurement of JTp represents a different use model. Standard use of corrected QT interval is clinical risk assessment on patients with cardiac disease or suspicion of heart disease. Drug safety trials involve a very different population - young healthy subjects - who commonly have J-waves, notches and slurs. Drug effects include difficult and unusual morphology such as flat T-waves, gentle notches, and multiple T-wave peaks. The JTp initiative study provided ECGs collected from 22 young subjects (11 males and females) in randomized testing of dofetilide, quinidine, ranolazine, verapamil and placebo. We compare the JTp intervals between DXL algorithm and the FDA published measurements. The lead wise, vector-magnitude (VM), root-mean-square (RMS) and principal-component-analysis (PCA) representative beats were used to measure JTp and QT intervals. We also implemented four different methods for T peak detection for comparison. We found that JTp measurements were closer to the reference for combined leads RMS and PCA than individual leads. Differences in J-point location led to part of the JTp measurement difference because of the high prevalence of J-waves, notches and slurs. Larger differences were noted for drug effect causing multiple distinct T-wave peaks (Tp). The automated algorithm chooses the later peak while the reference was the earlier peak. Choosing among different algorithmic strategies in T peak measurement results in the
Indian Academy of Sciences (India)
Home; Journals; Sadhana. J Jeslin Drusila Nesamalar. Articles written in Sadhana. Volume 39 Issue 2 April 2014 pp 377-390. Transaction charges allocation using sensitivity factor methodology · S Charles Raja J Jeslin Drusila Nesamalar P Venkatesh · More Details Abstract Fulltext PDF. Deregulation of the electricity ...
Methods for analysing cardiovascular studies with repeated measures
Cleophas, T. J.; Zwinderman, A. H.; van Ouwerkerk, B. M.
2009-01-01
Background. Repeated measurements in a single subject are generally more similar than unrepeated measurements in different subjects. Unrepeated analyses of repeated data cause underestimation of the treatment effects. Objective. To review methods adequate for the analysis of cardiovascular studies
TALEN-Induced Double-Strand Break Repair of CTG Trinucleotide Repeats
Directory of Open Access Journals (Sweden)
Valentine Mosbach
2018-02-01
Full Text Available Trinucleotide repeat expansions involving CTG/CAG triplets are responsible for several neurodegenerative disorders, including myotonic dystrophy and Huntington’s disease. Because expansions trigger the disease, contracting repeat length could be a possible approach to gene therapy for these disorders. Here, we show that a TALEN-induced double-strand break was very efficient at contracting expanded CTG repeats in yeast. We show that RAD51, POL32, and DNL4 are dispensable for double-strand break repair within CTG repeats, the only required genes being RAD50, SAE2, and RAD52. Resection was totally abolished in the absence of RAD50 on both sides of the break, whereas it was reduced in a sae2Δ mutant on the side of the break containing the longest repeat tract, suggesting that secondary structures at double-strand break ends must be removed by the Mre11-Rad50 complex and Sae2. Following the TALEN double-strand break, single-strand annealing occurred between both sides of the repeat tract, leading to repeat contraction.
Pirkanmaan alueen jätelajittelututkimus 2011
Jonsson, Tiina
2012-01-01
Tämän opinnäytetyön tarkoituksena oli selostaa kesällä 2011 Pirkanmaan Jätehuolto Oy:n Tarastenjärven jätteenkäsittelykeskuksessa tehdyn jätteiden lajittelututkimuksen kulkua, analysoida saatuja tuloksia ja esittää johtopäätöksiä materiaalikoostumuksesta niin jätehuoltoon vaikuttavien säädöksien kuin rakenteilla olevan uuden jätteenpolttolai-toksen näkökulmasta. Kesän 2011 lajittelututkimus perustui aiemmin Tarastenjärven jätteenkäsittelykeskuk-sessa tehtyihin tutkimuksiin. Työn tavoitte...
Directory of Open Access Journals (Sweden)
Hane James K
2010-11-01
Full Text Available Abstract Background Repeat-induced point mutation (RIP is a fungal genome defence mechanism guarding against transposon invasion. RIP mutates the sequence of repeated DNA and over time renders the affected regions unrecognisable by similarity search tools such as BLAST. Results DeRIP is a new software tool developed to predict the original sequence of a RIP-mutated region prior to the occurrence of RIP. In this study, we apply deRIP to the genome of the wheat pathogen Stagonospora nodorum SN15 and predict the origin of several previously uncharacterised classes of repetitive DNA. Conclusions Five new classes of transposon repeats and four classes of endogenous gene repeats were identified after deRIP. The deRIP process is a new tool for fungal genomics that facilitates the identification and understanding of the role and origin of fungal repetitive DNA. DeRIP is open-source and is available as part of the RIPCAL suite at http://www.sourceforge.net/projects/ripcal.
J-SEx : The Jollie Snow Experiment, New Zealand
Kerr, T.; Singh, S.; Kees, L.; Webster, C.; Clark, M.; Hendrikx, J.; Woods, R.
2012-04-01
Intensive snow observations have been collected in a steep alpine catchment (the Jollie Valley) in the Southern Alps of New Zealand for four years at the time of maximum snow storage. The campaign, called the Jollie Snow Experiment (J-SEx), was undertaken to improve understanding of snow variability in a steep alpine landscape. Observation methods included manual depth-probing at hundreds of locations with associated snowpit-digging, and surface and air-borne ground penetrating radar. In addition, repeat (daily) oblique photography was carried out on a subcatchment for two of the years. Analysis of the observations, in conjunction with similar observations from around the world has enabled direction to be given for selecting optimal modelling scales, and an indication of what processes need to be resolved at the different scales. For instance, if models are to operate at sub-100 m horizontal scales, they need to resolve drifting, sloughing and avalanching processes. Binary regression tree methods have been applied to identify terrain variables which explain the observed snow mass variability. This has enabled an assessment of total catchment snow storage to be established for each year. This assessment showed that the controlling variables change from year to year, so that no single terrain-based interpolation method may be generally applied. The change in the terrain relationships each year has been taken as an indication that the different frequencies of snowfall-related climate types from one year to the next affects which terrain characteristics have the greatest impact on snow variability. Assessment of terrain effects at the slope scale indicates that slope angle has the potential to be a strong influence on snow variability in that steep slopes do not build up large accumulations, and that low-angled regions below steep areas become areas of large snow build-up. This "slope" effect is clearly evident from the repeat photography, with the last areas to melt
SlideJ: An ImageJ plugin for automated processing of whole slide images.
Directory of Open Access Journals (Sweden)
Vincenzo Della Mea
Full Text Available The digital slide, or Whole Slide Image, is a digital image, acquired with specific scanners, that represents a complete tissue sample or cytological specimen at microscopic level. While Whole Slide image analysis is recognized among the most interesting opportunities, the typical size of such images-up to Gpixels- can be very demanding in terms of memory requirements. Thus, while algorithms and tools for processing and analysis of single microscopic field images are available, Whole Slide images size makes the direct use of such tools prohibitive or impossible. In this work a plugin for ImageJ, named SlideJ, is proposed with the objective to seamlessly extend the application of image analysis algorithms implemented in ImageJ for single microscopic field images to a whole digital slide analysis. The plugin has been complemented by examples of macro in the ImageJ scripting language to demonstrate its use in concrete situations.
Pascau, Javier
2013-01-01
The book will help readers discover the various facilities of ImageJ through a tutorial-based approach.This book is targeted at scientists, engineers, technicians, and managers, and anyone who wishes to master ImageJ for image viewing, processing, and analysis. If you are a developer, you will be able to code your own routines after you have finished reading this book. No prior knowledge of ImageJ is expected.
Libby, Alex
2012-01-01
A practical tutorial with powerful yet simple projects that are quick to implement. This book is aimed at developers who have prior jQuery knowledge, but may not have any prior experience with jQuery Tools. It is possible that they may have started with the basics of jQuery Tools, but want to learn more about how it can be used, as well as get ideas for future projects.
African Journals Online (AJOL)
In the present study, 78 mapped simple sequence repeat (SSR) markers representing 11 linkage groups of adzuki bean were evaluated for transferability to mungbean and related Vigna spp. 41 markers amplified characteristic bands in at least one Vigna species. The transferability percentage across the genotypes ranged ...
Gupta, Arvind F.; Beaton, Rachael L.; Majewski, Steven R.; SMHASH Team
2018-01-01
CDM cosmological models predict that dark matter halo density profiles will have central cusps. Yet for many dwarf spheroidal galaxies (dSphs), this expectation is in contrast with observations of cored, rather than cusped, halos. This 'cusp-core problem' is apparent in the Sagittarius Dwarf Galaxy (Sgr), one of the largest satellites of the Milky Way. The globular cluster M54, one of several clusters associated with Sgr, coincides in on-sky position with the center of the main body of Sgr. While several studies find that M54 lies within the center of Sgr, other findings show that M54 is offset from the center by several kiloparsecs along our line of sight. The latter requires Sgr to have a cored dark matter distribution. In the presence of a cuspy halo, the orbit of M54 would have decayed via dynamical friction and the cluster would have fallen to the center of Sgr. A clear determination of the relation of the two bodies may help us better understand the distribution of dark matter in Sgr and other dSphs. Here we present a measurement of the distance modulus to M54 using a set of RR Lyrae variable stars in near-infrared Magellan data mid-infrared Spitzer data. The magnitudes of individual stars are measured using multi-epoch PSF photometry and light curve fitting. From precise RR Lyrae period-luminosity relations at these wavelengths, we then find the mean M54 distance modulus to be 17.126 ± 0.023 (ran) ± 0.080 (sys). Our result is consistent with a distance measurement to Sgr derived via nearly identical methods and thus also consistent with the expectation of a central cusp in the dark matter density profile of Sgr.
THE CHEMISTRY OF THE TRAILING ARM OF THE SAGITTARIUS DWARF GALAXY
International Nuclear Information System (INIS)
Keller, Stefan C.; Yong, David; Da Costa, Gary S.
2010-01-01
We present abundances of C, O, Ti, and Fe for 11 M-giant stars in the trailing tidal arm of the Sagittarius dwarf (Sgr). The abundances were derived by comparing synthetic spectra with high-resolution infrared spectra obtained with the Phoenix spectrograph on the Gemini South telescope. The targeted stars are drawn from two regions of the Sgr trailing arm separated by 66 0 (five stars) and 132 0 (six stars) from the main body of Sgr. The trailing arm provides a more direct diagnostic of the chemical evolution of Sgr compared to the extensively phase-mixed leading arm. Within our restricted sample of ∼2-3 Gyr old stars, we find that the stream material exhibits a significant metallicity gradient of -(2.4 ± 0.3) x 10 -3 dex/degree (-(9.4 ± 1.1) x 10 -4 dex/kpc) away from the main body of Sgr. The tidal disruption of Sgr is a relatively recent event. We therefore interpret the presence of a metallicity gradient in the debris as indicative of a similar gradient in the progenitor. The fact that such a metallicity gradient survived for almost a Hubble time indicates that the efficiency of radial mixing was very low in the Sgr progenitor. No significant gradient is seen to exist in the [α/Fe] abundance ratio along the trailing arm. Our results may be accounted for by a radial decrease in star formation efficiency and/or radial increase in the efficiency of galactic wind-driven metal loss in the chemical evolution of the Sgr progenitor. The [Ti/Fe] and [O/Fe] abundance ratios observed within the stream are distinct from those of the Galactic halo. We conclude that the fraction of the intermediate to metal-rich halo population contributed by the recent dissolution (<3 Gyr) of Sgr-like dwarf galaxies cannot be substantial.
Repeatability study of replicate crash tests: A signal analysis approach.
Seppi, Jeremy; Toczyski, Jacek; Crandall, Jeff R; Kerrigan, Jason
2017-10-03
To provide an objective basis on which to evaluate the repeatability of vehicle crash test methods, a recently developed signal analysis method was used to evaluate correlation of sensor time history data between replicate vehicle crash tests. The goal of this study was to evaluate the repeatability of rollover crash tests performed with the Dynamic Rollover Test System (DRoTS) relative to other vehicle crash test methods. Test data from DRoTS tests, deceleration rollover sled (DRS) tests, frontal crash tests, frontal offset crash tests, small overlap crash tests, small overlap impact (SOI) crash tests, and oblique crash tests were obtained from the literature and publicly available databases (the NHTSA vehicle database and the Insurance Institute for Highway Safety TechData) to examine crash test repeatability. Signal analysis of the DRoTS tests showed that force and deformation time histories had good to excellent repeatability, whereas vehicle kinematics showed only fair repeatability due to the vehicle mounting method for one pair of tests and slightly dissimilar mass properties (2.2%) in a second pair of tests. Relative to the DRS, the DRoTS tests showed very similar or higher levels of repeatability in nearly all vehicle kinematic data signals with the exception of global X' (road direction of travel) velocity and displacement due to the functionality of the DRoTS fixture. Based on the average overall scoring metric of the dominant acceleration, DRoTS was found to be as repeatable as all other crash tests analyzed. Vertical force measures showed good repeatability and were on par with frontal crash barrier forces. Dynamic deformation measures showed good to excellent repeatability as opposed to poor repeatability seen in SOI and oblique deformation measures. Using the signal analysis method as outlined in this article, the DRoTS was shown to have the same or better repeatability of crash test methods used in government regulatory and consumer evaluation test
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. A J K Prasad. Articles written in Bulletin of Materials Science. Volume 34 Issue 7 December 2011 pp 1339-1344. Synthesis and characterization of mixture of nanozirconia and nanosilica obtained from commercially available zircon flour by sol–gel method · A J K Prasad S M ...
2010-07-01
... Publicly Owned Treatment Works (§ 122.21(j)) J Appendix J to Part 122 Protection of Environment... POLLUTANT DISCHARGE ELIMINATION SYSTEM Pt. 122, App. J Appendix J to Part 122—NPDES Permit Testing Requirements for Publicly Owned Treatment Works (§ 122.21(j)) Table 1A—Effluent Parameters for All POTWS...
2011-07-05
... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35364] R. J. Corman Railroad Company/Bardstown Line--Lease and Operation Exemption--R. J. Corman Railroad Property, LLC R. J... notice of exemption under 49 CFR 1150.41 to lease from R. J. Corman Railroad Property, LLC (RJC Railroad...
Repeating pneumatic pellet injector in JAERI
Energy Technology Data Exchange (ETDEWEB)
Kasai, Satoshi; Hasegawa, Kouichi; Suzuki, Sadaaki; Miura, Yukitoshi (Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment); Oda, Yasushi; Onozuka, Masanori; Tsujimura, Seiichi.
1992-09-01
A repeating pneumatic pellet injector has been developed and constructed at Japan Atomic Energy Research Institute. This injector can provide repetitive pellet injection to fuel tokamak plasmas for an extended period of time, aiming at the improvement of plasma performance. The pellets with nearly identical speed and mass can be repeatedly injected with a repetition rate of 2-3.3 Hz and a speed of up to 1.7 km/s by controlling the temperature of the cryogenic system, the piston speed and the pressure of the propellant gas. (author).
Repeating pneumatic pellet injector in JAERI
International Nuclear Information System (INIS)
Kasai, Satoshi; Hasegawa, Kouichi; Suzuki, Sadaaki; Miura, Yukitoshi; Oda, Yasushi; Onozuka, Masanori; Tsujimura, Seiichi.
1992-09-01
A repeating pneumatic pellet injector has been developed and constructed at Japan Atomic Energy Research Institute. This injector can provide repetitive pellet injection to fuel tokamak plasmas for an extended period of time, aiming at the improvement of plasma performance. The pellets with nearly identical speed and mass can be repeatedly injected with a repetition rate of 2-3.3 Hz and a speed of up to 1.7 km/s by controlling the temperature of the cryogenic system, the piston speed and the pressure of the propellant gas. (author)
Macho project photometry of RR Lyrae stars in the Sagittarius dwarf galaxy
Energy Technology Data Exchange (ETDEWEB)
Alcock, C. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)]|[Center for Particle Astrophysics, University of California, Berkeley, California 94720 (United States); Allsman, R.A. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)]|[Mount Stromlo and Siding Spring Observatories, Australian National University, Weston, ACT 2611 (Australia); Alves, D.R. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)]|[Department of Physics, University of California, Davis, California 95616 (United States); Axelrod, T.S. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)]|[Mount Stromlo and Siding Spring Observatories, Australian National University, Weston, ACT 2611 (Australia); Becker, A.C. [Center for Particle Astrophysics, University of California, Berkeley, California 94720 (United States)]|[Department of Astronomy, University of Washington, Seattle, Washington 98195 (United States); Bennett, D.P.; Cook, K.H. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)]|[Center for Particle Astrophysics, University of California, Berkeley, California 94720 (United States); Freeman, K.C. [Mount Stromlo and Siding Spring Observatories, Australian National University, Weston, ACT 2611 (Australia); Griest, K. [Center for Particle Astrophysics, University of California, Berkeley, California 94720 (United States)]|[Department of Physics, University of California, San Diego, California 92093 (United States); Guern, J.A.; Lehner, M.J. [Department of Physics, University of California, San Diego, California 92093 (United States); Marshall, S.L.; Minniti, D. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States); Peterson, B.A. [Mount Stromlo and Siding Spring Observatories, Australian National University, Weston, ACT 2611 (Australia); Pratt, M.R.
1997-01-01
We report the discovery of 30 type a, b RR Lyrae (RRab) stars that are likely members of the Sagittarius dwarf galaxy (Sgr). Accurate positions, periods, amplitudes, and magnitudes are presented. Their distances are determined with respect to RRab stars in the Galactic bulge found also in the MACHO 1993 data. For R{sub {circle_dot}}=8kpc, the mean distance to these stars is D=22{plus_minus}1kpc, smaller than previous determinations for this galaxy. This indicates that Sgr has an elongated main body extending for more than 10 kpc, which is inclined along the line of sight, with its northern part (in Galactic coordinates) closer to us. The size and shape of Sgr give clues about the past history of this galaxy. If the shape of Sgr follows the direction of its orbit, the observed spatial orientation suggests that Sgr is moving away from the Galactic plane. Also, Sgr stars may be the sources of some of the microlensing events seen toward the bulge. {copyright} {ital 1997} {ital The American Astronomical Society}
ACCA phosphopeptide recognition by the BRCT repeats of BRCA1.
Ray, Hind; Moreau, Karen; Dizin, Eva; Callebaut, Isabelle; Venezia, Nicole Dalla
2006-06-16
The tumour suppressor gene BRCA1 encodes a 220 kDa protein that participates in multiple cellular processes. The BRCA1 protein contains a tandem of two BRCT repeats at its carboxy-terminal region. The majority of disease-associated BRCA1 mutations affect this region and provide to the BRCT repeats a central role in the BRCA1 tumour suppressor function. The BRCT repeats have been shown to mediate phospho-dependant protein-protein interactions. They recognize phosphorylated peptides using a recognition groove that spans both BRCT repeats. We previously identified an interaction between the tandem of BRCA1 BRCT repeats and ACCA, which was disrupted by germ line BRCA1 mutations that affect the BRCT repeats. We recently showed that BRCA1 modulates ACCA activity through its phospho-dependent binding to ACCA. To delineate the region of ACCA that is crucial for the regulation of its activity by BRCA1, we searched for potential phosphorylation sites in the ACCA sequence that might be recognized by the BRCA1 BRCT repeats. Using sequence analysis and structure modelling, we proposed the Ser1263 residue as the most favourable candidate among six residues, for recognition by the BRCA1 BRCT repeats. Using experimental approaches, such as GST pull-down assay with Bosc cells, we clearly showed that phosphorylation of only Ser1263 was essential for the interaction of ACCA with the BRCT repeats. We finally demonstrated by immunoprecipitation of ACCA in cells, that the whole BRCA1 protein interacts with ACCA when phosphorylated on Ser1263.
Study of J/ψ Production in Jets.
Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Baszczyk, M; Batozskaya, V; Batsukh, B; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Bird, T; Birnkraut, A; Bitadze, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bonivento, W; Bordyuzhin, I; Borgheresi, A; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britsch, M; Britton, T; Brodzicka, J; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S-F; Chobanova, V; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Deckenhoff, M; Del Buono, L; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Dungs, K; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Déléage, N; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fay, R; Fazzini, D; Ferguson, D; Fernandez, G; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hatch, M; He, J; Head, T; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, H; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kecke, M; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Komarov, I; Koppenburg, P; Kosmyntseva, A; Kozachuk, A; Kozeiha, M; Kravchuk, L; Kreplin, K; Kreps, M; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, T; Li, Y; Likhomanenko, T; Lindner, R; Linn, C; Lionetto, F; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Manning, P; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Mussini, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, C J G; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Popovici, B; Poslavskii, S; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Gonzalo, D; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubert, K; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stevens, H; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Toriello, F; Tournefier, E; Tourneur, S; Trabelsi, K; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zucchelli, S
2017-05-12
The production of J/ψ mesons in jets is studied in the forward region of proton-proton collisions using data collected with the LHCb detector at a center-of-mass energy of 13 TeV. The fraction of the jet transverse momentum carried by the J/ψ meson, z(J/ψ)≡p_{T}(J/ψ)/p_{T}(jet), is measured using jets with p_{T}(jet)>20 GeV in the pseudorapidity range 2.5<η(jet)<4.0. The observed z(J/ψ) distribution for J/ψ mesons produced in b-hadron decays is consistent with expectations. However, the results for prompt J/ψ production do not agree with predictions based on fixed-order nonrelativistic QCD. This is the first measurement of the p_{T} fraction carried by prompt J/ψ mesons in jets at any experiment.
Exact computation of the 9-j symbols
International Nuclear Information System (INIS)
Lai Shantao; Chiu Jingnan
1992-01-01
A useful algebraic formula for the 9-j symbol has been rewritten for convenient use on a computer. A simple FORTRAN program for the exact computation of 9-j symbols has been written for the VAX with VMS version V5,4-1 according to this formula. The results agree with the approximate values in existing literature. Some specific values of 9-j symbols needed for the intensity and alignments of three-photon nonresonant transitions are tabulated. Approximate 9-j symbol values beyond the limitation of the computer can also be computed by this program. The computer code of the exact computation of 3-j, 6-j and 9-j symbols are available through electronic mail upon request. (orig.)
Electromyographic analysis of repeated bouts of eccentric exercise.
McHugh, M P; Connolly, D A; Eston, R G; Gartman, E J; Gleim, G W
2001-03-01
The repeated bout effect refers to the protective effect provided by a single bout of eccentric exercise against muscle damage from a similar subsequent bout. The aim of this study was to determine if the repeated bout was associated with an increase in motor unit activation relative to force production, an increased recruitment of slow-twitch motor units or increased motor unit synchronization. Surface electromyographic (EMG) signals were recorded from the hamstring muscles during two bouts of submaximal isokinetic (2.6 rad x s(-1)) eccentric (11 men, 9 women) or concentric (6 men, 4 women) contractions separated by 2 weeks. The EMG per unit torque and median frequency were analysed. The initial bout of eccentric exercise resulted in strength loss, pain and muscle tenderness, while the repeated eccentric bout resulted in a slight increase in strength, no pain and no muscle tenderness (bout x time effects, P exercise. The EMG per unit torque and median frequency were not different between the initial and repeated bouts of eccentric exercise. The EMG per unit torque and median frequency increased during both bouts of eccentric exercise (P < 0.01) but did not change during either concentric bout. In conclusion, there was no evidence that the repeated bout effect was due to a neural adaptation.
40 CFR 1065.305 - Verifications for accuracy, repeatability, and noise.
2010-07-01
..., repeatability, and noise. 1065.305 Section 1065.305 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Verifications for accuracy, repeatability, and noise. (a) This section describes how to determine the accuracy, repeatability, and noise of an instrument. Table 1 of § 1065.205 specifies recommended values for individual...
Two tandemly repeated telomere-associated sequences in Nicotiana plumbaginifolia.
Chen, C M; Wang, C T; Wang, C J; Ho, C H; Kao, Y Y; Chen, C C
1997-12-01
Two tandemly repeated telomere-associated sequences, NP3R and NP4R, have been isolated from Nicotiana plumbaginifolia. The length of a repeating unit for NP3R and NP4R is 165 and 180 nucleotides respectively. The abundance of NP3R, NP4R and telomeric repeats is, respectively, 8.4 x 10(4), 6 x 10(3) and 1.5 x 10(6) copies per haploid genome of N. plumbaginifolia. Fluorescence in situ hybridization revealed that NP3R is located at the ends and/or in interstitial regions of all 10 chromosomes and NP4R on the terminal regions of three chromosomes in the haploid genome of N. plumbaginifolia. Sequence homology search revealed that not only are NP3R and NP4R homologous to HRS60 and GRS, respectively, two tandem repeats isolated from N. tabacum, but that NP3R and NP4R are also related to each other, suggesting that they originated from a common ancestral sequence. The role of these repeated sequences in chromosome healing is discussed based on the observation that two to three copies of a telomere-similar sequence were present in each repeating unit of NP3R and NP4R.
Zagatto, Alessandro M; Ardigò, Luca P; Barbieri, Fabio A; Milioni, Fabio; Dello Iacono, Antonio; Camargo, Bruno H F; Padulo, Johnny
2017-09-01
Zagatto, AM, Ardigò, LP, Barbieri, FA, Milioni, F, Dello Iacono, A, Camargo, BHF, and Padulo, J. Performance and metabolic demand of a new repeated-sprint ability test in basketball players: does the number of changes of direction matter? J Strength Cond Res 31(9): 2438-2446, 2017-This study compared 2 repeated-sprint ability (RSA) tests in basketball players. Both tests included 10 × 30-m sprints, with the difference that the previously validated test (RSA2COD) featured 2 changes of direction (COD) per sprint, whereas the experimental test (RSA5COD) featured 5 CODs per sprint. Test performances and metabolic demands were specifically assessed in 20 basketball players. First, RSA5COD test-retest reliability was investigated. Then, RSA2COD, RSA5COD sprint times, peak speeds, oxygen uptake (V[Combining Dot Above]O2) and posttest blood lactate concentration [La] were measured. The RSA5COD results showed to be reliable. RSA2COD performance resulted better than the RSA5COD version (p 0.05). Over whole bout, the RSA2COD was more demanding than the RSA5COD, considering overall metabolic power requirement (i.e., VO2-driven + [La]-driven components). Given that RSA5COD (a) mimics real game-play as sprint distance and action change frequency/direction and (b) has the same metabolic expenditure per task completion as metabolic cost, RSA5COD is a valuable option for players and coaches for training basketball-specific agility and assessing bioenergetic demands.
Indian Academy of Sciences (India)
Volume 13 Issue 7 July 2008 pp 648-654 General Article. Oysters in a New Classification of Keystone Species · P J Sanjeeva Raj · More Details Fulltext PDF. Volume 18 Issue 2 February 2013 pp 156-162 General Article. Keystone Functions of Hydrilla verticilata · Stephen Sumithran P J Sanjeeva Raj · More Details Fulltext ...
International Nuclear Information System (INIS)
Abdo, A. A.; Ajello, M.; Bechtol, K.; Berenji, B.; Borgland, A. W.; Bouvier, A.; Buehler, R.; Antolini, E.; Bonamente, E.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Baring, M. G.; Bastieri, D.; Brigida, M.; Bruel, P.; Burnett, T. H.
2010-01-01
The Fermi Large Area Telescope (LAT) data have confirmed the pulsed emission from all six high-confidence gamma-ray pulsars previously known from the EGRET observations. We report results obtained from the analysis of 13 months of LAT data for three of these pulsars (PSR J1057-5226, PSR J1709-4429, and PSR J1952+3252) each of which had some unique feature among the EGRET pulsars. The excellent sensitivity of LAT allows more detailed analysis of the evolution of the pulse profile with energy and also of the variation of the spectral shape with phase. We measure the cutoff energy of the pulsed emission from these pulsars for the first time and provide a more complete picture of the emission mechanism. The results confirm some, but not all, of the features seen in the EGRET data.
International Nuclear Information System (INIS)
Lu, W.-B.; Shi, J.-J.; Wang, C.-H.; Chang, J.-S.
2006-01-01
This study was undertaken to investigate biosorption kinetics and equilibria of lead (Pb), copper (Cu) and cadmium (Cd) ions using the biomass of Enterobacter sp. J1 isolated from a local industry wastewater treatment plant. Efficiency of metal ion recovery from metal-loaded biomass to regenerate the biosorbent was also determined. The results show that Enterobacter sp. J1 was able to uptake over 50 mg of Pb per gram of dry cell, while having equilibrium adsorption capacities of 32.5 and 46.2 mg/g dry cell for Cu and Cd, respectively. In general, Langmuir and Freundlich models were able to describe biosorption isotherm fairly well, except that prediction of Pb adsorption was relatively poor with Langmuir model, suggesting a different mechanism for Pb biosorption. Adjusting the pH value to 3.0 led to nearly complete desorption of Cd from metal-loaded biomass, while over 90% recovery of Pb and Cu ions was obtained at pH ≤ 2. After four repeated adsorption/desorption cycles, biomass of Enterobacter sp. J1 retained 75, 79 and 90% of original capacity for adsorption of Pb, Cu and Cd, respectively, suggesting good reusability of the biosorbent. A combinative model was proposed to describe the kinetics of heavy-metal adsorption by Enterobacter sp. J1 and the model appeared to have an excellent prediction of the experimental data. The model simulation results also seemed to suggest that intracellular accumulation may occur during the uptake of Pb
Energy Technology Data Exchange (ETDEWEB)
Lu, W.-B. [Department of Cosmetic Science, Chung Hwa College of Medical Technology, Tainan, Taiwan (China); Shi, J.-J. [Department of Chemical Engineering, National Cheng Kung University, Tainan, Taiwan (China); Wang, C.-H. [Department of Biological Engineering, Yung Ta Institute of Technology and Commerce, Pingtung, Taiwan (China); Chang, J.-S. [Department of Chemical Engineering, National Cheng Kung University, Tainan, Taiwan (China)]. E-mail: changjs@mail.ncku.edu.tw
2006-06-30
This study was undertaken to investigate biosorption kinetics and equilibria of lead (Pb), copper (Cu) and cadmium (Cd) ions using the biomass of Enterobacter sp. J1 isolated from a local industry wastewater treatment plant. Efficiency of metal ion recovery from metal-loaded biomass to regenerate the biosorbent was also determined. The results show that Enterobacter sp. J1 was able to uptake over 50 mg of Pb per gram of dry cell, while having equilibrium adsorption capacities of 32.5 and 46.2 mg/g dry cell for Cu and Cd, respectively. In general, Langmuir and Freundlich models were able to describe biosorption isotherm fairly well, except that prediction of Pb adsorption was relatively poor with Langmuir model, suggesting a different mechanism for Pb biosorption. Adjusting the pH value to 3.0 led to nearly complete desorption of Cd from metal-loaded biomass, while over 90% recovery of Pb and Cu ions was obtained at pH {<=} 2. After four repeated adsorption/desorption cycles, biomass of Enterobacter sp. J1 retained 75, 79 and 90% of original capacity for adsorption of Pb, Cu and Cd, respectively, suggesting good reusability of the biosorbent. A combinative model was proposed to describe the kinetics of heavy-metal adsorption by Enterobacter sp. J1 and the model appeared to have an excellent prediction of the experimental data. The model simulation results also seemed to suggest that intracellular accumulation may occur during the uptake of Pb.
47 CFR 80.469 - Maritime mobile repeater stations in Alaska.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Maritime mobile repeater stations in Alaska. 80... RADIO SERVICES STATIONS IN THE MARITIME SERVICES Public Coast Stations Use of Telephony § 80.469 Maritime mobile repeater stations in Alaska. (a) Maritime mobile repeater stations are authorized to extend...
RNA FISH for detecting expanded repeats in human diseases.
Urbanek, Martyna O; Krzyzosiak, Wlodzimierz J
2016-04-01
RNA fluorescence in situ hybridization (FISH) is a widely used technique for detecting transcripts in fixed cells and tissues. Many variants of RNA FISH have been proposed to increase signal strength, resolution and target specificity. The current variants of this technique facilitate the detection of the subcellular localization of transcripts at a single molecule level. Among the applications of RNA FISH are studies on nuclear RNA foci in diseases resulting from the expansion of tri-, tetra-, penta- and hexanucleotide repeats present in different single genes. The partial or complete retention of mutant transcripts forming RNA aggregates within the nucleoplasm has been shown in multiple cellular disease models and in the tissues of patients affected with these atypical mutations. Relevant diseases include, among others, myotonic dystrophy type 1 (DM1) with CUG repeats, Huntington's disease (HD) and spinocerebellar ataxia type 3 (SCA3) with CAG repeats, fragile X-associated tremor/ataxia syndrome (FXTAS) with CGG repeats, myotonic dystrophy type 2 (DM2) with CCUG repeats, amyotrophic lateral sclerosis/frontotemporal dementia (ALS/FTD) with GGGGCC repeats and spinocerebellar ataxia type 32 (SCA32) with GGCCUG. In this article, we summarize the results obtained with FISH to examine RNA nuclear inclusions. We provide a detailed protocol for detecting RNAs containing expanded CAG and CUG repeats in different cellular models, including fibroblasts, lymphoblasts, induced pluripotent stem cells and murine and human neuronal progenitors. We also present the results of the first single-molecule FISH application in a cellular model of polyglutamine disease. Copyright © 2015 Elsevier Inc. All rights reserved.
StaRProtein, A Web Server for Prediction of the Stability of Repeat Proteins
Xu, Yongtao; Zhou, Xu; Huang, Meilan
2015-01-01
Repeat proteins have become increasingly important due to their capability to bind to almost any proteins and the potential as alternative therapy to monoclonal antibodies. In the past decade repeat proteins have been designed to mediate specific protein-protein interactions. The tetratricopeptide and ankyrin repeat proteins are two classes of helical repeat proteins that form different binding pockets to accommodate various partners. It is important to understand the factors that define folding and stability of repeat proteins in order to prioritize the most stable designed repeat proteins to further explore their potential binding affinities. Here we developed distance-dependant statistical potentials using two classes of alpha-helical repeat proteins, tetratricopeptide and ankyrin repeat proteins respectively, and evaluated their efficiency in predicting the stability of repeat proteins. We demonstrated that the repeat-specific statistical potentials based on these two classes of repeat proteins showed paramount accuracy compared with non-specific statistical potentials in: 1) discriminate correct vs. incorrect models 2) rank the stability of designed repeat proteins. In particular, the statistical scores correlate closely with the equilibrium unfolding free energies of repeat proteins and therefore would serve as a novel tool in quickly prioritizing the designed repeat proteins with high stability. StaRProtein web server was developed for predicting the stability of repeat proteins. PMID:25807112
Corby, J. F.; McGuire, B. A.; Herbst, E.; Remijan, A. J.
2018-02-01
The 1-50 GHz PRebiotic Interstellar MOlecular Survey (PRIMOS) contains 50 molecular absorption lines observed in clouds located in the line-of-sight to Sgr B2(N). The line-of-sight material is associated with diffuse and translucent clouds located in the Galactic center, bar, and spiral arms in the disk. We measured the column densities and estimate abundances, relative to H2, of 11 molecules and additional isotopologues observed in this material. We used absorption by optically thin transitions of c-C3H2 to estimate the molecular hydrogen columns, and argue that this method is preferable to more commonly used methods. We discuss the kinematic structure and abundance patterns of small molecules including the sulfur-bearing species CS, SO, CCS, H2CS, and HCS+; oxygen-bearing molecules OH, SiO, and H2CO; and simple hydrocarbon molecules c-C3H2, l-C3H, and l-C3H+. Finally, we discuss the implications of the observed chemistry for the structure of the gas and dust in the ISM. Highlighted results include the following. First, whereas gas in the disk has a molecular hydrogen fraction of 0.65, clouds on the outer edge of the Galactic bar and in or near the Galactic center have molecular fractions of 0.85 and >0.9, respectively. Second, we observe trends in isotope ratios with Galactocentric distance; while carbon and silicon show enhancement of the rare isotopes at low Galactocentric distances, sulfur exhibits no trend with Galactocentric distance. We also determine that the ratio of c-C3H2/c-H13CCCH provides a good estimate of the 12C/13C ratio, whereas H2CO/H213CO exhibits fractionation. Third, we report the presence of l-C3H+ in diffuse clouds for the first time. Finally, we suggest that CS has an enhanced abundance within higher density clumps of material in the disk, and therefore may be diagnostic of cloud conditions. If this holds, the diffuse clouds in the Galactic disk contain multiple embedded hyperdensities in a clumpy structure, and the density profile is not
Directory of Open Access Journals (Sweden)
2005-12-01
Full Text Available Centromeres interact with the spindle apparatus to enable chromosome disjunction and typically contain thousands of tandemly arranged satellite repeats interspersed with retrotransposons. While their role has been obscure, centromeric repeats are epigenetically modified and centromere specification has a strong epigenetic component. In the yeast Schizosaccharomyces pombe, long heterochromatic repeats are transcribed and contribute to centromere function via RNA interference (RNAi. In the higher plant Arabidopsis thaliana, as in mammalian cells, centromeric satellite repeats are short (180 base pairs, are found in thousands of tandem copies, and are methylated. We have found transcripts from both strands of canonical, bulk Arabidopsis repeats. At least one subfamily of 180-base pair repeats is transcribed from only one strand and regulated by RNAi and histone modification. A second subfamily of repeats is also silenced, but silencing is lost on both strands in mutants in the CpG DNA methyltransferase MET1, the histone deacetylase HDA6/SIL1, or the chromatin remodeling ATPase DDM1. This regulation is due to transcription from Athila2 retrotransposons, which integrate in both orientations relative to the repeats, and differs between strains of Arabidopsis. Silencing lost in met1 or hda6 is reestablished in backcrosses to wild-type, but silencing lost in RNAi mutants and ddm1 is not. Twenty-four-nucleotide small interfering RNAs from centromeric repeats are retained in met1 and hda6, but not in ddm1, and may have a role in this epigenetic inheritance. Histone H3 lysine-9 dimethylation is associated with both classes of repeats. We propose roles for transcribed repeats in the epigenetic inheritance and evolution of centromeres.
Nakamura, Moritaka; Toyota, Masatsugu; Tasaka, Masao; Morita, Miyo Terao
2011-01-01
Higher plants use the sedimentation of amyloplasts in statocytes as statolith to sense the direction of gravity during gravitropism. In Arabidopsis thaliana inflorescence stem statocyte, amyloplasts are in complex movement; some show jumping-like saltatory movement and some tend to sediment toward the gravity direction. Here, we report that a RING-type E3 ligase SHOOT GRAVITROPISM9 (SGR9) localized to amyloplasts modulates amyloplast dynamics. In the sgr9 mutant, which exhibits reduced gravitropism, amyloplasts did not sediment but exhibited increased saltatory movement. Amyloplasts sometimes formed a cluster that is abnormally entangled with actin filaments (AFs) in sgr9. By contrast, in the fiz1 mutant, an ACT8 semidominant mutant that induces fragmentation of AFs, amyloplasts, lost saltatory movement and sedimented with nearly statically. Both treatment with Latrunculin B, an inhibitor of AF polymerization, and the fiz1 mutation rescued the gravitropic defect of sgr9. In addition, fiz1 decreased saltatory movement and induced amyloplast sedimentation even in sgr9. Our results suggest that amyloplasts are in equilibrium between sedimentation and saltatory movement in wild-type endodermal cells. Furthermore, this equilibrium is the result of the interaction between amyloplasts and AFs modulated by the SGR9. SGR9 may promote detachment of amyloplasts from AFs, allowing the amyloplasts to sediment in the AFs-dependent equilibrium of amyloplast dynamics. PMID:21602290
Monitoring the Variability of the Supermassive Black Hole at the Galactic Center
Chen, Zhuo; Do, Tuan; Witzel, Gunther; Ghez, Andrea; Schödel, Rainer; Gallego, Laly; Sitarski, Breann; Lu, Jessica; Becklin, Eric Eric; Dehghanfar, Arezu; Gautam, Abhimat; Hees, Aurelien; Jia, Siyao; Matthews, Keith; Morris, Mark
2018-01-01
The variability of the supermassive black hole at the center of the Galaxy, Sgr A*, has been widely studied over the years in a variety of wavelengths. However, near-infrared studies of the variability of Sgr A* only began in 2003 with the then new technique Adaptive Optics (AO) as speckle shift-and-add data did not reach sufficient depth to detect Sgr A* (K baseline of 20 years. We find that the average magnitude of Sgr A* from 1995 to 2005 (K = 16.49 +/- 0.086) agrees very well with the average AO magnitude from 2005-2007 (Kp = 16.3). Our detections of Sgr A* are the first reported prior to 2002. In particular, a significant increase of power in the PSD between the main correlation timescale of ~300 min and 20 years can be excluded. This renders 300 min the dominant timescale and setting the variability state of Sgr A* in the time since 1995 apart from states discussed in the context of the X-ray echoes in the surrounding molecular clouds (for which extended bright periods of several years are required). Finally, we note that the 2001 periapse passage of the extended, dusty object G1, a source similar to G2, had no apparent effect on the emissivity of the accretion flow onto Sgr A*.
Telomerase Repeated Amplification Protocol (TRAP).
Mender, Ilgen; Shay, Jerry W
2015-11-20
Telomeres are found at the end of eukaryotic linear chromosomes, and proteins that bind to telomeres protect DNA from being recognized as double-strand breaks thus preventing end-to-end fusions (Griffith et al. , 1999). However, due to the end replication problem and other factors such as oxidative damage, the limited life span of cultured cells (Hayflick limit) results in progressive shortening of these protective structures (Hayflick and Moorhead, 1961; Olovnikov, 1973). The ribonucleoprotein enzyme complex telomerase-consisting of a protein catalytic component hTERT and a functional RNA component hTR or hTERC - counteracts telomere shortening by adding telomeric repeats to the end of chromosomes in ~90% of primary human tumors and in some transiently proliferating stem-like cells (Shay and Wright, 1996; Shay and Wright, 2001). This results in continuous proliferation of cells which is a hallmark of cancer. Therefore, telomere biology has a central role in aging, cancer progression/metastasis as well as targeted cancer therapies. There are commonly used methods in telomere biology such as Telomere Restriction Fragment (TRF) (Mender and Shay, 2015b), Telomere Repeat Amplification Protocol (TRAP) and Telomere dysfunction Induced Foci (TIF) analysis (Mender and Shay, 2015a). In this detailed protocol we describe Telomere Repeat Amplification Protocol (TRAP). The TRAP assay is a popular method to determine telomerase activity in mammalian cells and tissue samples (Kim et al. , 1994). The TRAP assay includes three steps: extension, amplification, and detection of telomerase products. In the extension step, telomeric repeats are added to the telomerase substrate (which is actually a non telomeric oligonucleotide, TS) by telomerase. In the amplification step, the extension products are amplified by the polymerase chain reaction (PCR) using specific primers (TS upstream primer and ACX downstream primer) and in the detection step, the presence or absence of telomerase is
Model-independent evidence for $J/\\psi p$ contributions to $\\Lambda_b^0\\to J/\\psi p K^-$ decays
Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baker, Sophie; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Betti, Federico; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borgheresi, Alessio; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Boubdir, Meriem; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chatzikonstantinidis, Georgios; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chobanova, Veronika; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Dendek, Adam; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Dijkstra, Hans; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Dungs, Kevin; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Fazzini, Davide; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fleuret, Frederic; Fohl, Klaus; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Garsed, Philip John; Gascon, David; Gaspar, Clara; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heister, Arno; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hongming, Li; Hulsbergen, Wouter; Humair, Thibaud; Hushchyn, Mikhail; Hussain, Nazim; Hutchcroft, David; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Kirn, Thomas; Klaver, Suzanne; Klimaszewski, Konrad; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemaitre, Florian; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusardi, Nicola; Lusiani, Alberto; Lyu, Xiao-Rui; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massacrier, Laure Marie; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Merli, Andrea; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Mulder, Mick; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen-Mau, Chung; Niess, Valentin; Nieswand, Simon; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pikies, Malgorzata; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; dos Reis, Alberto; Renaudin, Victor; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Rogozhnikov, Alexey; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schael, Stefan; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sergi, Antonino; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavomira; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Traill, Murdo; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valat, Sebastien; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; van Veghel, Maarten; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wicht, Jean; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wraight, Kenneth; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yin, Hang; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zheng, Yangheng; Zhokhov, Anatoly; Zhong, Liang; Zhukov, Valery; Zucchelli, Stefano
2016-08-18
The data sample of $\\Lambda_b^0\\to J/\\psi p K^-$ decays acquired with the LHCb detector from 7 and 8~TeV $pp$ collisions, corresponding to an integrated luminosity of 3 fb$^{-1}$, is inspected for the presence of $J/\\psi p$ or $J/\\psi K^-$ contributions with minimal assumptions about $K^- p$ contributions. It is demonstrated at more than 9 standard deviations that $\\Lambda_b^0\\to J/\\psi p K^-$ decays cannot be described with $K^- p$ contributions alone, and that $J/\\psi p$ contributions play a dominant role in this incompatibility. These model-independent results support the previously obtained model-dependent evidence for $P_c^+\\to J/\\psi p$ charmonium-pentaquark states in the same data sample.
Model-Independent Evidence for J/ψp Contributions to Λ_{b}^{0}→J/ψpK^{-} Decays.
Aaij, R; Abellán Beteta, C; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; d'Argent, P; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Bel, L J; Bellee, V; Belloli, N; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bertolin, A; Betti, F; Bettler, M-O; van Beuzekom, M; Bifani, S; Billoir, P; Bird, T; Birnkraut, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borgheresi, A; Borghi, S; Borisyak, M; Borsato, M; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britsch, M; Britton, T; Brodzicka, J; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cavallero, G; Cenci, R; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S-F; Chobanova, V; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coquereau, S; Corti, G; Corvo, M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Aguiar Francisco, O; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Dean, C-T; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Dungs, K; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Färber, C; Farley, N; Farry, S; Fay, R; Fazzini, D; Ferguson, D; Fernandez Albor, V; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Griffith, P; Grillo, L; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heister, A; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hongming, L; Hulsbergen, W; Humair, T; Hushchyn, M; Hussain, N; Hutchcroft, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jawahery, A; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kecke, M; Kelsey, M; Kenyon, I R; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Kozeiha, M; Kravchuk, L; Kreplin, K; Kreps, M; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Lindner, R; Linn, C; Lionetto, F; Liu, B; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusardi, N; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Manning, P; Mapelli, A; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurin, B; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M M; Müller, D; Müller, J; Müller, K; Müller, V; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen-Mau, C; Niess, V; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, C J G; Osorio Rodrigues, B; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Pappenheimer, C; Parker, W; Parkes, C; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pistone, A; Piucci, A; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Raven, G; Redi, F; Reichert, S; Dos Reis, A C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Rogozhnikov, A; Roiser, S; Romanovsky, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefkova, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Tournefier, E; Tourneur, S; Trabelsi, K; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valat, S; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Volkov, V; Vollhardt, A; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wright, S; Wyllie, K; Xie, Y; Xu, Z; Yang, Z; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhokhov, A; Zhong, L; Zhukov, V; Zucchelli, S
2016-08-19
The data sample of Λ_{b}^{0}→J/ψpK^{-} decays acquired with the LHCb detector from 7 and 8 TeV pp collisions, corresponding to an integrated luminosity of 3 fb^{-1}, is inspected for the presence of J/ψp or J/ψK^{-} contributions with minimal assumptions about K^{-}p contributions. It is demonstrated at more than nine standard deviations that Λ_{b}^{0}→J/ψpK^{-} decays cannot be described with K^{-}p contributions alone, and that J/ψp contributions play a dominant role in this incompatibility. These model-independent results support the previously obtained model-dependent evidence for P_{c}^{+}→J/ψp charmonium-pentaquark states in the same data sample.
Energy Technology Data Exchange (ETDEWEB)
Dai, Shuyan; Sun, Cancan; Tan, Kemin; Ye, Sheng; Zhang, Rongguang
2017-09-01
Eukaryotic thrombospondin type 3 repeat (TT3R) is an efficient calcium ion (Ca2+) binding motif only found in mammalian thrombospondin family. TT3R has also been found in prokaryotic cellulase Cel5G, which was thought to forfeit the Ca2+-binding capability due to the formation of intra-repeat disulfide bonds, instead of the inter-repeat ones possessed by eukaryotic TT3Rs. In this study, we have identified an enormous number of prokaryotic TT3R-containing proteins belonging to several different protein families, including outer membrane protein A (OmpA), an important structural protein connecting the outer membrane and the periplasmic peptidoglycan layer in gram-negative bacteria. Here, we report the crystal structure of the periplasmic region of OmpA from Capnocytophaga gingivalis, which contains a linker region comprising five consecutive TT3Rs. The structure of OmpA-TT3R exhibits a well-ordered architecture organized around two tightly-coordinated Ca2+ and confirms the presence of abnormal intra-repeat disulfide bonds. Further mutagenesis studies showed that the Ca2+-binding capability of OmpA-TT3R is indeed dependent on the proper formation of intra-repeat disulfide bonds, which help to fix a conserved glycine residue at its proper position for Ca2+ coordination. Additionally, despite lacking inter repeat disulfide bonds, the interfaces between adjacent OmpA-TT3Rs are enhanced by both hydrophobic and conserved aromatic-proline interactions.
Alamidi, Daniel F; Smailagic, Amir; Bidar, Abdel W; Parker, Nicole S; Olsson, Marita; Hockings, Paul D; Lagerstrand, Kerstin M; Olsson, Lars E
2018-03-08
Lung T 1 is a potential translational biomarker of lung disease. The precision and repeatability of variable flip angle (VFA) T 1 mapping using modern 3D ultrashort echo time (UTE) imaging of the whole lung needs to be established before it can be used to assess response to disease and therapy. To evaluate the feasibility of regional lung T 1 quantification with VFA 3D-UTE and to investigate long- and short-term T 1 repeatability in the lungs of naive mice. Prospective preclinical animal study. Eight naive mice and phantoms. 3D free-breathing radial UTE (8 μs) at 4.7T. VFA 3D-UTE T 1 calculations were validated against T 1 values measured with inversion recovery (IR) in phantoms. Lung T 1 and proton density (S 0 ) measurements of whole lung and muscle were repeated five times over 1 month in free-breathing naive mice. Two consecutive T 1 measurements were performed during one of the imaging sessions. Agreement in T 1 between VFA 3D-UTE and IR in phantoms was assessed using Bland-Altman and Pearson 's correlation analysis. The T 1 repeatability in mice was evaluated using coefficient of variation (CV), repeated-measures analysis of variance (ANOVA), and paired t-test. Good T 1 agreement between the VFA 3D-UTE and IR methods was found in phantoms. T 1 in lung and muscle showed a 5% and 3% CV (1255 ± 63 msec and 1432 ± 42 msec, respectively, mean ± SD) with no changes in T 1 or S 0 over a month. Consecutive measurements resulted in an increase of 2% in both lung T 1 and S 0 . VFA 3D-UTE shows promise as a reliable T 1 mapping method that enables full lung coverage, high signal-to-noise ratio (∼25), and spatial resolution (300 μm) in freely breathing animals. The precision of the VFA 3D-UTE method will enable better design and powering of studies. 1 Technical Efficacy: Stage 2 J. Magn. Reson. Imaging 2018. © 2018 International Society for Magnetic Resonance in Medicine.
Katastroofide järel heldelt lubatud abi pole alati kohale jõudnud / Kaivo Kopli
Kopli, Kaivo
2005-01-01
ÜRO peasekretär Kofi Annan kutsus üles täitma lubadusi anda abi Lõuna-Aasia tsunamis kannatanud riikidele. Artiklis tuuakse näiteid juhtumite kohta, kus looduskatastroofi järel on riikide abi jäänud lubatust väiksemaks
jQuery UI 1.10 the user interface library for jQuery
Libby, Alex
2013-01-01
This book consists of an easy-to-follow, example-based approach that leads you step-by-step through the implementation and customization of each library component.This book is for frontend designers and developers who need to learn how to use jQuery UI quickly. To get the most out of this book, you should have a good working knowledge of HTML, CSS, and JavaScript, and should ideally be comfortable using jQuery.
Discrepancy variation of dinucleotide microsatellite repeats in eukaryotic genomes
Directory of Open Access Journals (Sweden)
HUAN GAO
2009-01-01
Full Text Available To address whether there are differences of variation among repeat motif types and among taxonomic groups, we present here an analysis of variation and correlation of dinucleotide microsatellite repeats in eukaryotic genomes. Ten taxonomic groups were compared, those being primates, mammalia (excluding primates and rodentia, rodentia, birds, fish, amphibians and reptiles, insects, molluscs, plants and fungi, respectively. The data used in the analysis is from the literature published in the Journal of Molecular Ecology Notes. Analysis of variation reveals that there are no significant differences between AC and AG repeat motif types. Moreover, the number of alleles correlates positively with the copy number in both AG and AC repeats. Similar conclusions can be obtained from each taxonomic group. These results strongly suggest that the increase of SSR variation is almost linear with the increase of the copy number of each repeat motif. As well, the results suggest that the variability of SSR in the genomes of low-ranking species seem to be more than that of high-ranking species, excluding primates and fungi.
REPEATABILITY OF FRUIT QUALITY TRAITS OF CACTUS PEAR
Directory of Open Access Journals (Sweden)
VALTÂNIA XAVIER NUNES
2017-12-01
Full Text Available ABSTRACT Repeatability analysis has been used to study traits in several crops, assisting in the definition of the minimum number needed to evaluate genotypes more efficiently and with less time and resource consumption. So far, however, no repeatability studies on cactus pear have been found in the literature. The objective of this study was to determine the coefficient of repeatability for cactus pear fruits traits and the minimum number of evaluations (fruit that can provide acceptable accuracy for the prediction of the true value. The experiment was conducted at the Federal Institute of Bahia/Campus Guanambi, with 150 fruits collected from three municipalities in the state of Bahia. The coefficients of repeatability were estimated by the methods of analysis of variance, principal components based on the covariance (PCCV and correlation (PCC matrices, and structural analysis based on the correlation matrix (SA. The analysis of variance showed that, except for fruit diameter, the effect of the production site (municipality was significant for all traits evaluated. The PCCV method was proven the most suitable for studying the repeatability of quality traits of cactus pear fruits. Seven fruits were required to determine, with 90% confidence, the traits length, diameter, fruit firmness, skin thickness, number of seeds, fruit mass, bark mass, pulp mass, pH, titratable acidity, soluble solids, SS/AT ratio, and pulp yield.
International Nuclear Information System (INIS)
Abe, F.
1995-07-01
We report on the observation of the Cabibbo-suppresed mode B + J/ψπ + , with J/ψ → μ + μ - . Further, we calculate the relative branching ratio. BR(B + - J/ψπ + )/BR(B + → J/ψK + ) and find a value of (4.9 -1.7 + ±1.1)%
Gonzalo-Skok, Oliver; Tous-Fajardo, Julio; Arjol-Serrano, José Luis; Suarez-Arrones, Luis; Casajús, José Antonio; Mendez-Villanueva, Alberto
2016-05-01
To examine the effects of a low-volume repeated-power-ability (RPA) training program on repeated-sprint and change-of- direction (COD) ability and functional jumping performance. Twenty-two male elite young basketball players (age 16.2 ± 1.2 y, height 190.0 ± 10.0 cm, body mass 82.9 ± 10.1 kg) were randomly assigned either to an RPA-training group (n = 11) or a control group (n = 11). RPA training consisted of leg-press exercise, twice a week for 6 wk, of 1 or 2 blocks of 5 sets × 5 repetitions with 20 s of passive recovery between sets and 3 min between blocks with the load that maximized power output. Before and after training, performance was assessed by a repeated-sprint-ability (RSA) test, a repeated-COD-ability test, a hop for distance, and a drop jump followed by tests of a double unilateral hop with the right and left legs. Within-group and between-groups differences showed substantial improvements in slowest (RSAs) and mean time (RSAm) on RSA; best, slowest and mean time on repeated-COD ability; and unilateral right and left hop in the RPA group in comparison with control. While best time on RSA showed no improvement in any group, there was a large relationship (r = .68, 90% CI .43;.84) between the relative decrement in RSAm and RSAs, suggesting better sprint maintenance with RPA training. The relative improvements in best and mean repeated-COD ability were very largely correlated (r = .89, 90% CI .77;.94). Six weeks of lowvolume (4-14 min/wk) RPA training improved several physical-fitness tests in basketball players.
The absolute number of repeat operations for complex intra ...
African Journals Online (AJOL)
abdominal sepsis, questions about futility of treatment frequently arise. This study focuses specifically on patients who required two or more repeat laparotomies and describes the spectrum of disease necessitating multiple repeat laparotomies ...
Frees-jääksoode [looduslik] taimestumine / J. Paal, E. Leiner, T. Paal, T. Triisberg
2011-01-01
Lui looduslikus soos levivad paljud taimed eelkõige vegetatiivselt, siis jääksoos, eriti kui see ei piirne loodusliku sooga, seda toimuda ei saa, seega jääb seemneline uuendumine peamiselt tuulekandeliseks
Assembly of Repeat Content Using Next Generation Sequencing Data
Energy Technology Data Exchange (ETDEWEB)
labutti, Kurt; Kuo, Alan; Grigoriev, Igor; Copeland, Alex
2014-03-17
Repetitive organisms pose a challenge for short read assembly, and typically only unique regions and repeat regions shorter than the read length, can be accurately assembled. Recently, we have been investigating the use of Pacific Biosciences reads for de novo fungal assembly. We will present an assessment of the quality and degree of repeat reconstruction possible in a fungal genome using long read technology. We will also compare differences in assembly of repeat content using short read and long read technology.
Water levels in wells J-11 and J-12, 1989-91, Yucca Mountain Area, Nevada
International Nuclear Information System (INIS)
Boucher, M.S.
1994-01-01
Water levels have been measured in the Yucca Mountain area, Nevada, since 1981 in order to gain a better understanding of the ground-water flow system in the area. Water levels in wells J-11 and J-12 have been periodically measured using calibrated reeled steel tapes since 1989, however, calculation of water-level altitude was not possible prior to 1993 due to missing reference elevations. These elevations were determined in 1993 by the U.S. Geological Survey. During 1989-91, water-level altitudes for well J-11 ranged from 732.09 to 732.40 meters and the mean water-level altitude was 732.19 meters. During 1989-91, water-level altitudes for well J-12 ranged from 727.84 to 728.03 meters, and the mean water-level altitude was 727.95 meters
Chaffer, Jonathan
2013-01-01
Step through each of the core concepts of the jQuery library, building an overall picture of its capabilities. Once you have thoroughly covered the basics, the book returns to each concept to cover more advanced examples and techniques.This book is for web designers who want to create interactive elements for their designs, and for developers who want to create the best user interface for their web applications. Basic JavaScript programming and knowledge of HTML and CSS is required. No knowledge of jQuery is assumed, nor is experience with any other JavaScript libraries.
A study on the repeatability of ultrasonic testing data
International Nuclear Information System (INIS)
Yoshimura, Seiichi; Fukumoto, Hiroshi
1980-01-01
Reliability improvement of ultrasonic testing data is strongly desired in ultrasonic testing working of nuclear power plants. This paper deals with the problems of the testing by the manual and the remote control apparatus, and with the factors which influence the repeatability of ultrasonic testing data. Following results are found in it. (1) In the testing by the manual, working time and posture influence the repeatability of testing data. (2) Glycerin in suitable for the couplant in the respect of the repeatability of testing data. In the case of using machine oil, the pressure to the probe necessitates to be over 0.2 kg/cm 2 . (3) In the testing by the remote control apparatus, working time, working environment and defect position does not influence the repeatability of testing data. (author)
Smartphone tool to collect repeated 24 h dietary recall data in Nepal.
Harris-Fry, Helen; Beard, B James; Harrisson, Tom; Paudel, Puskar; Shrestha, Niva; Jha, Sonali; Shrestha, Bhim P; Manandhar, Dharma S; Costello, Anthony; Saville, Naomi M
2018-02-01
To outline the development of a smartphone-based tool to collect thrice-repeated 24 h dietary recall data in rural Nepal, and to describe energy intakes, common errors and researchers' experiences using the tool. We designed a novel tool to collect multi-pass 24 h dietary recalls in rural Nepal by combining the use of a CommCare questionnaire on smartphones, a paper form, a QR (quick response)-coded list of foods and a photographic atlas of portion sizes. Twenty interviewers collected dietary data on three non-consecutive days per respondent, with three respondents per household. Intakes were converted into nutrients using databases on nutritional composition of foods, recipes and portion sizes. Dhanusha and Mahottari districts, Nepal. Pregnant women, their mothers-in-law and male household heads. Energy intakes assessed in 150 households; data corrections and our experiences reported from 805 households and 6765 individual recalls. Dietary intake estimates gave plausible values, with male household heads appearing to have higher energy intakes (median (25th-75th centile): 12 079 (9293-14 108) kJ/d) than female members (8979 (7234-11 042) kJ/d for pregnant women). Manual editing of data was required when interviewers mistook portions for food codes and for coding items not on the food list. Smartphones enabled quick monitoring of data and interviewer performance, but we initially faced technical challenges with CommCare forms crashing. With sufficient time dedicated to development and pre-testing, this novel smartphone-based tool provides a useful method to collect data. Future work is needed to further validate this tool and adapt it for other contexts.
The Effects of Repeated Experience on Children's Suggestibility.
Powell, Martine B.; Roberts, Kim P.; Ceci, Stephen J.; Hembrooke, Helene
1999-01-01
Examined effect of suggestive questions on 3- to 5-year-olds' and 6- to 8-year-olds' recall of the final occurrence of repeated event. Found that relative to reports of children experiencing single occurrence, reports about fixed items of repeated events were less contaminated by false suggestions. Children's age and delay of interview were…
Momota, Yukihiro; Takano, Hideyuki; Kani, Koichi; Matsumoto, Fumihiro; Motegi, Katsumi; Aota, Keiko; Yamamura, Yoshiko; Omori, Mayuko; Tomioka, Shigemasa; Azuma, Masayuki
2013-03-01
Burning mouth syndrome (BMS) is characterized by the following subjective complaints without distinct organic changes: burning sensation in mouth or chronic pain of tongue. BMS is also known as glossodynia; both terms are used equivalently in Japan. Although the real cause of BMS is still unknown, it has been pointed out that BMS is related to some autonomic abnormality, and that stellate ganglion near-infrared irradiation (SGR) corrects the autonomic abnormality. Frequency analysis of heart rate variability (HRV) is expected to be useful for assessing autonomic abnormality. This study investigated whether frequency analysis of HRV could reveal autonomic abnormality associated with BMS, and whether autonomic changes were corrected after SGR. Eight subjects received SGR; the response to SGR was assessed by frequency analysis of HRV. No significant difference of autonomic activity concerning low-frequency (LF) norm, high-frequency (HF) norm, and low-frequency/high-frequency (LF/HF) was found between SGR effective and ineffective groups. Therefore, we proposed new parameters: differential normalized low frequency (D LF norm), differential normalized high frequency (D HF norm), and differential low-frequency/high-frequency (D LF/HF), which were defined as differentials between original parameters just before and after SGR. These parameters as indexes of responsiveness of autonomic nervous system (ANS) revealed autonomic changes in BMS, and BMS seems to be related to autonomic instability rather than autonomic imbalance. Frequency analysis of HRV revealed the autonomic instability associated with BMS and enabled tracing of autonomic changes corrected with SGR. It is suggested that frequency analysis of HRV is very useful in follow up of BMS and for determination of the therapeutic efficacy of SGR. Wiley Periodicals, Inc.
Non-radioactive detection of trinucleotide repeat size variability.
Tomé, Stéphanie; Nicole, Annie; Gomes-Pereira, Mario; Gourdon, Genevieve
2014-03-06
Many human diseases are associated with the abnormal expansion of unstable trinucleotide repeat sequences. The mechanisms of trinucleotide repeat size mutation have not been fully dissected, and their understanding must be grounded on the detailed analysis of repeat size distributions in human tissues and animal models. Small-pool PCR (SP-PCR) is a robust, highly sensitive and efficient PCR-based approach to assess the levels of repeat size variation, providing both quantitative and qualitative data. The method relies on the amplification of a very low number of DNA molecules, through sucessive dilution of a stock genomic DNA solution. Radioactive Southern blot hybridization is sensitive enough to detect SP-PCR products derived from single template molecules, separated by agarose gel electrophoresis and transferred onto DNA membranes. We describe a variation of the detection method that uses digoxigenin-labelled locked nucleic acid probes. This protocol keeps the sensitivity of the original method, while eliminating the health risks associated with the manipulation of radiolabelled probes, and the burden associated with their regulation, manipulation and waste disposal.
GeV Detection of HESS J0632+057
Energy Technology Data Exchange (ETDEWEB)
Li, Jian; Torres, Diego F.; Wilhelmi, Emma de Oña [Institute of Space Sciences (CSIC–IEEC), Campus UAB, Carrer de Magrans s/n, E-08193 Barcelona (Spain); Cheng, K.-S. [Department of Physics, University of Hong Kong, Pokfulam Road, Hong Kong (China); Kretschmar, Peter [European Space Astronomy Centre (ESA/ESAC), Science Operations Department, Villanueva de la Cañada (Madrid) (Spain); Hou, Xian [Yunnan Observatories, Chinese Academy of Sciences, 396 Yangfangwang, Guandu District, Kunming 650216 (China); Takata, Jumpei, E-mail: jian@ice.csic.es [School of Physics, Huazhong University of Science and Technology, Wuhan 430074 (China)
2017-09-10
HESS J0632+057 is the only gamma-ray binary that has been detected at TeV energies, but not at GeV energies yet. Based on nearly nine years of Fermi Large Area Telescope (LAT) Pass 8 data, we report here on a deep search for the gamma-ray emission from HESS J0632+057 in the 0.1–300 GeV energy range. We find a previously unknown gamma-ray source, Fermi J0632.6+0548, spatially coincident with HESS J0632+057. The measured flux of Fermi J0632.6+0548 is consistent with the previous flux upper limit on HESS J0632+057 and shows variability that can be related to the HESS J0632+057 orbital phase. We propose that Fermi J0632.6+0548 is the GeV counterpart of HESS J0632+057. Considering the Very High Energy spectrum of HESS J0632+057, a possible spectral turnover above 10 GeV may exist in Fermi J0632.6+0548, as appears to be common in other established gamma-ray binaries.
Repeated Causal Decision Making
Hagmayer, York; Meder, Bjorn
2013-01-01
Many of our decisions refer to actions that have a causal impact on the external environment. Such actions may not only allow for the mere learning of expected values or utilities but also for acquiring knowledge about the causal structure of our world. We used a repeated decision-making paradigm to examine what kind of knowledge people acquire in…
Development of ADINA-J-integral code
International Nuclear Information System (INIS)
Kurihara, Ryoichi
1988-07-01
A general purpose finite element program ADINA (Automatic Dynamic Incremental Nonlinear Analysis), which was developed by Bathe et al., was revised to be able to calculate the J- and J-integral. This report introduced the numerical method to add this capability to the code, and the evaluation of the revised ADINA-J code by using a few of examples of the J estimation model, i.e. a compact tension specimen, a center cracked panel subjected to dynamic load, and a thick shell cylinder having inner axial crack subjected to thermal load. The evaluation testified the function of the revised code. (author)
DO RADIO MAGNETARS PSR J1550-5418 AND J1622-4950 HAVE GIGAHERTZ-PEAKED SPECTRA?
Energy Technology Data Exchange (ETDEWEB)
Kijak, J.; Tarczewski, L.; Lewandowski, W. [Kepler Institute of Astronomy, University of Zielona Gora, Lubuska 2, 65-265 Zielona Gora (Poland); Melikidze, G., E-mail: jkijak@astro.ia.uz.zgora.pl [Also at Abastumani Astrophysical Observatory, Ilia State University, 3-5 Cholokashvili Avenue, Tbilisi 0160, Georgia. (Georgia)
2013-07-20
We study the radio spectra of two magnetars, PSR J1550-5418 and J1622-4950. We argue that they are good candidates for pulsars with gigahertz-peaked spectra (GPS), as their observed flux density decreases at frequencies below 7 GHz. We suggest that this behavior is due to the influence of the pulsars' environments on radio waves. Both of the magnetars are associated with supernova remnants and thus are surrounded by hot, ionized gas, which can be responsible for the free-free absorption of radio waves. We conclude that the GPS feature of both magnetars and typical pulsars are formed by similar processes in the surrounding media rather than by different radio-emission mechanisms. Thus, the radio magnetars PSR J1550-5418 and J1622-4950 can be included in the class of GPS pulsars.
Intra-examiner repeatability and agreement in accommodative response measurements.
Antona, B; Sanchez, I; Barrio, A; Barra, F; Gonzalez, E
2009-11-01
Clinical measurement of the accommodative response (AR) identifies the focusing plane of a subject with respect to the accommodative target. To establish whether a significant change in AR has occurred, it is important to determine the repeatability of this measurement. This study had two aims: First, to determine the intraexaminer repeatability of AR measurements using four clinical methods: Nott retinoscopy, monocular estimate method (MEM) retinoscopy, binocular crossed cylinder test (BCC) and near autorefractometry. Second, to study the level of agreement between AR measurements obtained with the different methods. The AR of the right eye at one accommodative demand of 2.50 D (40 cm) was measured on two separate occasions in 61 visually normal subjects of mean age 19.7 years (range 18-32 years). The intraexaminer repeatability of the tests, and agreement between them, were estimated by the Bland-Altman method. We determined mean differences (MD) and the 95% limits of agreement [coefficient of repeatability (COR) and coefficient of agreement (COA)]. Nott retinoscopy and BCC offered the best repeatability, showing the lowest MD and narrowest 95% interval of agreement (Nott: -0.10 +/- 0.66 D, BCC: -0.05 +/- 0.75 D). The 95% limits of agreement for the four techniques were similar (COA = +/- 0.92 to +/-1.00 D) yet clinically significant, according to the expected values of the AR. The two dynamic retinoscopy techniques (Nott and MEM) had a better agreement (COA = +/-0.64 D) although this COA must be interpreted in the context of the low MEM repeatability (COR = +/-0.98 D). The best method of assessing AR was Nott retinoscopy. The BCC technique was also repeatable, and both are recommended as suitable methods for clinical use. Despite better agreement between MEM and Nott, agreement among the remaining methods was poor such that their interchangeable use in clinical practice is not recommended.
Russell, Mark; Birch, Jack; Love, Thomas; Cook, Christian J; Bracken, Richard M; Taylor, Tom; Swift, Eamon; Cockburn, Emma; Finn, Charlie; Cunningham, Daniel; Wilson, Laura; Kilduff, Liam P
2017-02-01
Russell, M, Birch, J, Love, T, Cook, CJ, Bracken, RM, Taylor, T, Swift, E, Cockburn, E, Finn, C, Cunningham, D, Wilson, L, and Kilduff, LP. The effects of a single whole-body cryotherapy exposure on physiological, performance, and perceptual responses of professional academy soccer players after repeated sprint exercise. J Strength Cond Res 31(2): 415-421, 2017-In professional youth soccer players, the physiological, performance, and perceptual effects of a single whole-body cryotherapy (WBC) session performed shortly after repeated sprint exercise were investigated. In a randomized, counterbalanced, and crossover design, 14 habituated English Premier League academy soccer players performed 15 × 30 m sprints (each followed by a 10 m forced deceleration) on 2 occasions. Within 20 minutes of exercise cessation, players entered a WBC chamber (Cryo: 30 seconds at -60° C, 120 seconds at -135° C) or remained seated (Con) indoors in temperate conditions (∼25° C). Blood and saliva samples, peak power output (countermovement jump), and perceptual indices of recovery and soreness were assessed pre-exercise and immediately, 2-hour and 24-hour postexercise. When compared with Con, a greater testosterone response was observed at 2-hour (+32.5 ± 32.3 pg·ml, +21%) and 24-hour (+50.4 ± 48.9 pg·ml, +28%) postexercise (both P = 0.002) in Cryo (trial × treatment interaction: P = 0.001). No between-trial differences were observed for other salivary (cortisol and testosterone/cortisol ratio), blood (lactate and creatine kinase), performance (peak power output), or perceptual (recovery or soreness) markers (all trial × treatment interactions: P > 0.05); all of which were influenced by exercise (time effects: all P ≤ 0.05). A single session of WBC performed within 20 minutes of repeated sprint exercise elevated testosterone concentrations for 24 hours but did not affect any other performance, physiological, or perceptual measurements taken. Although unclear, WBC may be
Inclusive J / $\\psi$ Production at D0
Energy Technology Data Exchange (ETDEWEB)
Murphy, Christopher R. [Indiana U.
1995-04-01
We present results on inclusive $J/\\psi$ and b-quark production in $p\\bar{p}$ collisions at $\\sqrt{s}$ = 1.8 TeV. The results are based on data collected at the D0 experiment during the 1992-1993 FermiLab collider run. There is excellent agreement between the differential $J/\\psi$ cross section measured at D0 and that measured at the CDF detector. A measurement of the fraction of $J/\\psi$ events due to b-quark decays is presented and we extract from this a measurement of the integrated b-quark cross section. The radiative decays of $_{Xc}$ charmonium states into the $J/\\psi$ is discussed and we present results on the fraction of $J/\\psi$ mesons that are due to $_{Xc}$ decays. We also observe that a fraction of promptly produced $J/\\psi$ mesons is larger than the measured fraction of $J/\\psi$ due to $_{Xc}$ decays and is not accounted for by existing charmonium. production models.
Sign patterns of J-orthogonal matrices
Czech Academy of Sciences Publication Activity Database
Hall, F.J.; Li, Z.; Parnass, C.; Rozložník, Miroslav
2017-01-01
Roč. 5, č. 1 (2017), s. 225-241 ISSN 2300-7451 Institutional support: RVO:67985840 Keywords : G-matrix * J-orthogonal matrix * sign pattern matrix * sign patterns that allow J-orthogonality Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics https://www.degruyter.com/view/j/spma.2017.5.issue-1/spma-2017-0016/spma-2017-0016.xml?format=INT