WorldWideScience

Sample records for renata sukand ain

  1. Review, comments and perspectives with regard to Renata Sõukand's doctoral dissertation Herbal landscape / Almo Farina

    Index Scriptorium Estoniae

    Farina, Almo

    2011-01-01

    9. nov. 2010 kaitses Tartu Ülikoolis doktoriväitekirja semiootika ja kulturoloogia doktorant Renata Sõukand, juhendaja Kalevi Kull (Tartu Ülikool), oponendid Almo Farina (Urbino Ülikool, Itaalia) ja Myrdene Anderson (Purdue Ülikool, USA Indiana)

  2. Renata Sõukandi väitekiri Ravimtaimemaastik [Herbal landscape] / Almo Farina

    Index Scriptorium Estoniae

    Farina, Almo

    2011-01-01

    9. nov. 2010 kaitses Tartu Ülikoolis doktoriväitekirja semiootika ja kulturoloogia doktorant Renata Sõukand, juhendaja Kalevi Kull (Tartu Ülikool), oponendid Almo Farina (Urbino Ülikool, Itaalia) ja Myrdene Anderson (Purdue Ülikool, USA Indiana)

  3. Renata Adler Memorial Research Center for Child Welfare and Protection, Tel-Aviv University

    Science.gov (United States)

    Ronen, Tammie

    2011-01-01

    The Renata Adler Memorial Research Center for Child Welfare and Protection operates within the Bob Shapell School of Social Work at Tel-Aviv University in Israel. The main aims of this research center are to facilitate study and knowledge about the welfare of children experiencing abuse or neglect or children at risk and to link such knowledge to…

  4. ain defla, algeria

    African Journals Online (AJOL)

    Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

    2016-05-01

    May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...

  5. Remote access to an interferometric fringes stabilization active system via RENATA

    Science.gov (United States)

    Espitia-Gómez, Javier; Ángel-Toro, Luciano

    2013-11-01

    The Advanced Technology National Network (RENATA, for its acronym in Spanish) is a Colombian, collaborative work tool, linked to other networks worldwide, in which take participation researchers, teachers and students, by sharing laboratory resources located in different universities, institutes and research centers throughout the country. In the Universidad EAFIT (Medellín, Colombia) it has been designed an interferometric fringes stabilization active system, which can be accessed remotely via the RENATA network. A Mach-Zehnder interferometer was implemented, with independent piezoelectric actuators in each arm, with which the lengths of optical path of light that goes over in each of them can be modified. Using these actuators, one can simultaneously perturb the system and compensate the phase differences caused by that perturbation. This allows us to experiment with different disturbs, and analyze the system response to each one of them. This can be made from any location worldwide, and especially from those regions in which optical and optoelectronic components required for the implementation of the interferometer or for the stabilization system are not available. The device can also be used as a platform in order to conduct diverse experiments, involving optical and controlling aspects, constituting with this in a pedagogic tool. For the future, it can be predicted that remote access to available applications would be possible, as well as modifications of the implemented code in labVIEW™, so that researchers and teachers can adapt and improve their functionalities or develop new applications, based on the collaborative work.

  6. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  7. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  8. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  9. Fabrication of AIN/cU Composites Using Electroless Plating and Evaluation of Their Thermal Properties according to AIN Particle Size

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)

    2015-12-15

    AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.

  10. El desarrollo de aplicaciones colaborativas de alta calidad: una realidad sobre la Red Académica de alto desempeño (RENATA

    Directory of Open Access Journals (Sweden)

    José Tiberio Hernández

    2007-11-01

    Full Text Available Este artículo muestra las posibilidades del uso y desarrollo de aplicaciones colaborativas sobre la red académica de alta conectividad (RENATA, que conecta a Colombia con la red latinoamericana CLARA y a través de ésta con Europa (GEANT y con Estados Unidos (Internet2. Los prototipos presentados se desarrollaron sobre la plataforma Access Grid y muestran situaciones en donde esta infraestructura, junto con software de tele-colaboración, puede generar alto valor para los grupos de investigación y el sector empresarial. Los prototipos permiten compartir e interactuar sobre objetos virtuales en una teleconferencia y también integrar facilidades de computación distribuida (GridComputing para cálculos sobre grandes cantidades de datos./ This article shows the potential of collaborative applications over the RENATA network, the academic, high-bandwidth, Colombian communication infrastructure with access to other high-bandwidth initiatives in Latin America (CLARA network, Europe (GEANT, and USA (Internet2. Several prototypes on top of Access Grid show the added value for telecollaboration and teleoperation applications in the academic sector, and in the future for business. We show prototypes that enhance a teleconference with interaction with virtual 3D objects and the use of grid resources.

  11. Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

  12. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Index Scriptorium Estoniae

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  13. Profilaxis de la úlcera gastrointestinal producida por AINES

    Directory of Open Access Journals (Sweden)

    Carlos Bustamante Rojas

    1998-04-01

    Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

  14. Electronic structure and optical properties of AIN under high pressure

    International Nuclear Information System (INIS)

    Li Zetao; Dang Suihu; Li Chunxia

    2011-01-01

    We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)

  15. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  16. F-type centers in neutron-irradiated AIN

    International Nuclear Information System (INIS)

    Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.

    1990-01-01

    The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)

  17. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  18. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  19. Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco

    Directory of Open Access Journals (Sweden)

    Zitouni A.

    2018-01-01

    In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

  20. Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

    Index Scriptorium Estoniae

    Karnau, Andrus

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

  1. Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

    Science.gov (United States)

    Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

    2011-10-01

    In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

  2. Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays

    International Nuclear Information System (INIS)

    Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.

    2004-01-01

    The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone

  3. Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

    Directory of Open Access Journals (Sweden)

    Ferrán Catalá-López

    2014-09-01

    Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

  4. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  5. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  6. HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues

    Directory of Open Access Journals (Sweden)

    Stanley Margaret A

    2012-09-01

    Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.

  7. Ain't Gonna Study War No More? Explorations of War through Picture Books

    Science.gov (United States)

    Crawford, Patricia A.; Roberts, Sherron Killingsworth

    2009-01-01

    At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…

  8. Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets

    International Nuclear Information System (INIS)

    Natesan, K.

    1995-09-01

    The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications

  9. Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

  10. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  11. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  12. The Scientific Method Ain't What It Used to Be

    Science.gov (United States)

    Herreid, Clyde Freeman

    2010-01-01

    Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

  13. Pima Community College Planning Grant for Autonomous Intelligent Network of Systems (AINS) Science, Mathematics and Engineering Education Center

    National Research Council Canada - National Science Library

    2006-01-01

    .... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...

  14. Isotope hydrological investigation of Moghra and Ain El-Sharip environment, north western desert, Egypt

    International Nuclear Information System (INIS)

    Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.

    1991-01-01

    Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab

  15. Valik arvamusi läbi aastate / Ain-Elmar Kaasik

    Index Scriptorium Estoniae

    Kaasik, Ain-Elmar, 1934-

    2008-01-01

    Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik

  16. T his article is m ainly about using sim ple trigonom etric identities ...

    Indian Academy of Sciences (India)

    T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

  17. COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation

    Science.gov (United States)

    Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos

    2015-01-01

    The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.

  18. Mis teeb taimest ravimtaime? / Renata Sõukand

    Index Scriptorium Estoniae

    Sõukand, Renata, 1974-

    2007-01-01

    Sünteesides Ilmari Mannineni eesti rahvameditsiini kolmikjaotust Peirceѫi märgitüüpide kolmikjaotusega, järeldab autor, et 19. sajandi eesti taimravi toetub pigem taimega seotud kultuurilistele arusaamadele

  19. Dietary intake of ain-93 standard diet induces Fatty liver with altered hepatic fatty acid profile in Wistar rats.

    Science.gov (United States)

    Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha

    2015-05-01

    There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  20. Monsieur Philippe Galli Préfet de l’Ain France

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  1. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

    Directory of Open Access Journals (Sweden)

    Augusto García-Poma

    2007-03-01

    Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

  2. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Science.gov (United States)

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  3. Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.

    Index Scriptorium Estoniae

    2012-01-01

    Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima

  4. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  5. An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

    Science.gov (United States)

    Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

    2008-11-01

    The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

  6. Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

    Science.gov (United States)

    Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

    2017-07-01

    Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

  7. Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)

    Science.gov (United States)

    Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.

    2018-05-01

    Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

  8. TEM and XANES study of MOVPE grown InAIN layers with different indium content

    International Nuclear Information System (INIS)

    Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N

    2011-01-01

    We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.

  9. Evaluation of the clinical maxim: "If it ain't broke, don't fix it".

    Science.gov (United States)

    Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B

    2012-01-01

    A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.

  10. Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

    Directory of Open Access Journals (Sweden)

    Andrés A. Pérez Ruiz

    2002-08-01

    Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

  11. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Directory of Open Access Journals (Sweden)

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  12. Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.

    Science.gov (United States)

    Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar

    2012-02-01

    Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011

  13. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Science.gov (United States)

    Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M

    2013-01-01

    To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  14. Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

    Science.gov (United States)

    2013-01-01

    Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

  15. Climate change and their consequences on coastal zone of Ain el Turck in Oran

    Directory of Open Access Journals (Sweden)

    Mohammed Tewfik Bouroumi

    2017-12-01

    Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

  16. Deformation history of the Neoproterozoic basement complex, Ain Shams area, Western Arabian Shield, Saudi Arabia

    Science.gov (United States)

    El-Fakharani, Abdelhamid; Hamimi, Zakaria

    2013-04-01

    Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.

  17. A retrospective review of the Honduras AIN-C program guided by a community health worker performance logic model.

    Science.gov (United States)

    Rodríguez, Daniela C; Peterson, Lauren A

    2016-05-06

    Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The

  18. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    Science.gov (United States)

    Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh

    2009-01-01

    Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412

  19. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Nazirudeen Mohammad K

    2009-04-01

    Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.

  20. Spatial and temporal variability in sedimentation rates associated with cutoff channel infill deposits: Ain River, France

    Science.gov (United States)

    Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.

    2008-01-01

    Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.

  1. Implementation of TiAIN and CrN coatings and ion implantation in the modern plastics moulding industry

    International Nuclear Information System (INIS)

    Bienk, E.J.; Mikkelsen, N.J.

    1997-01-01

    Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)

  2. Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria)

    OpenAIRE

    Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila

    2018-01-01

    Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...

  3. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Directory of Open Access Journals (Sweden)

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  4. Kas uus töölepingu seaduse eelnõu on õnnestunud? / Olga Aasav, Arno Arukask, Ain Tammvere...[jt.] ; interv. Martin Pau

    Index Scriptorium Estoniae

    2008-01-01

    Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger

  5. Impact of Dietary, Socioeconomic, and Physical Factors on Obese and Overweight Schoolchildren Living in Sidi-Bel-Abbes (West of Algeria and Ain Defla (Centre

    Directory of Open Access Journals (Sweden)

    Didaoui Hayat

    2018-03-01

    Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.

  6. Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

    Directory of Open Access Journals (Sweden)

    Rosa Maria Garcia Camin

    2015-03-01

    Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

  7. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  8. Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

    Science.gov (United States)

    Abou Zakhem, Boulos; Kattaa, Bassam

    2017-10-01

    The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

  9. Mne nravitsja vljubljatsja v talant / Renata Litvinova ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Litvinova, Renata

    2007-01-01

    Viiburis (Võborg) toimunud vene kino festivalil "Aken Euroopasse" peetud pressikonverentsil tutvustas näitleja ja režissöör oma uusimat projekti, muusikalist filmi lauljanna Zemfirast, esialgse pealkirjaga "Zeljonõi teatr v Zemfire"

  10. Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

    International Nuclear Information System (INIS)

    Ben Ammar, Safouan

    2007-01-01

    In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

  11. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  12. Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

    International Nuclear Information System (INIS)

    Kattan, Z.

    2003-01-01

    This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

  13. EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

    Directory of Open Access Journals (Sweden)

    B BENRACHI

    2002-12-01

    Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

  14. High performance W-AIN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management

    2004-01-25

    High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)

  15. The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

    International Nuclear Information System (INIS)

    Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

    1998-06-01

    A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

  16. Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria

    Directory of Open Access Journals (Sweden)

    Derdour Abdessamed

    2018-03-01

    Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.

  17. Rahvusvaheline turismikonverents / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2011-01-01

    Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

  18. Eeslid / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2003-01-01

    Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

  19. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  20. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  1. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  2. Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

    CERN Multimedia

    Caraban Gonzalez, Noemi

    2018-01-01

    Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

  3. Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

  4. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  5. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9

    International Nuclear Information System (INIS)

    Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.

    2009-01-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  6. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Science.gov (United States)

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  7. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Energy Technology Data Exchange (ETDEWEB)

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  8. [Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

    Science.gov (United States)

    Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

    2018-01-01

    To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

  9. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    Directory of Open Access Journals (Sweden)

    Ahmad Saleh Al Khatib

    2014-05-01

    Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

  10. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Science.gov (United States)

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  11. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

    Science.gov (United States)

    Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

  12. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

    Science.gov (United States)

    Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

  13. Sõja kunst ja kunsti sõda / Renata Salecl ; tõlk. Jan Kaus

    Index Scriptorium Estoniae

    Salecl, Renata

    2000-01-01

    Autor võtab tänapäeva sõdu ja kunste kui sfääre, mille puhul saab esile tõsta ühist probleemi, mis puudutab kaasaegse ühiskonna subjektiivsuse loomust ning keskendub rahutuse küsimusele. Näited kunstist. Sõda Bosnias on inspireerinud J. Holzerit, M. Abramovici jt.

  14. Omanimetus või õige nimetus? Eestlaste ravimtaimetundmise alustest / Raivo Kalle, Renata Sõukand

    Index Scriptorium Estoniae

    Kalle, Raivo, 1976-

    2011-01-01

    Käsitletakse Eestis kasvavate taimede nimetamise praktika laiemat ajaloolist tausta ja analüüsitakse ravimtaimede omanimetuste asendumist õigete nimetustega ning selle mõju taimepärimuse lähtaluse muutumisele

  15. Consent ain't anything

    DEFF Research Database (Denmark)

    Di Nucci, Ezio

    2016-01-01

    I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

  16. Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2008-01-01

    Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi

  17. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Directory of Open Access Journals (Sweden)

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  18. Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

    International Nuclear Information System (INIS)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru

    2016-01-01

    Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

  19. Production of biosurfactant on crude date syrup under saline conditions by entrapped cells of Natrialba sp. strain E21, an extremely halophilic bacterium isolated from a solar saltern (Ain Salah, Algeria).

    Science.gov (United States)

    Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine

    2013-11-01

    A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.

  20. Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

    Directory of Open Access Journals (Sweden)

    Issam Sellika

    2016-10-01

    Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

  1. Teacher Tenure "Ain't" the Problem.

    Science.gov (United States)

    Hansen, Kenneth; Ellena, William J.

    The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…

  2. VJ annab muusikale visuaalsuse / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare

  3. Investorid on dilemma ees / Ain Kivisaar

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

  4. Euroopa abiraha igatseb taotlejaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

  5. Rumsfeldi ei ole kunagi unustatud / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu

  6. Külmetav haigekassa / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2008-01-01

    Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus

  7. Makita kalmistu antropoloogiline aines / Luule Heapost

    Index Scriptorium Estoniae

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  8. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  9. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  10. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  11. You ain't seen nothing yet

    NARCIS (Netherlands)

    Walhof, Gert

    Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes

  12. Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

    2016-06-15

    Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

  13. EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

    Directory of Open Access Journals (Sweden)

    Khadija OUAISSA

    2017-05-01

    Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

  14. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  15. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  16. Euroopa tootjad ei ole rahul USA survega / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Seoses USA survega Euroopa turgude avanemiseks ning probleemidega Brasiilia toidukaupade ekspordi osas, kutsub üleeuroopalise põllumajandustootjate liit COPA ja põllumajandustööandjate organisatsioonide liit COGECA Euroopa valitsusjuhte üles lõpetama järeleandmiste tegemise

  17. Invsteeringutoetuste saajate ring väheneb / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Eestimaa talupidajate keskliit ei ole rahul mikropõllumajandusettevõtte arendamise investeeringutoetuse (meede 1.4.1) ja loomakasvatusehitiste investeeringutoetuse (meede 1.4.2) määruses tehtud muudatustega

  18. Multivariate statistical characterization of groundwater quality in Ain ...

    African Journals Online (AJOL)

    Administrator

    blended water (group 3), based on the similarity of groundwater quality characteristics. Principal component analysis, applied to the data sets of the three different groups obtained from ...... from Butucatu aquifer in Sao Paulo State, Brazil.

  19. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  20. Toodangu maht sõltub impordist / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2002-01-01

    Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

  1. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  2. Peptic ulcer frequency differences related to h. Pylori or aines.

    Science.gov (United States)

    Carli, Diego Michelon de; Pires, Rafael Cardoso; Rohde, Sofia Laura; Kavalco, Caroline Mayara; Fagundes, Renato Borges

    2015-01-01

    Peptic ulcer etiology has been changing because of H. pylori decline. To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000) and B (2007-2010), searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000), increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000) and idiopathic peptic ulcer (P=0.002). The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002). Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  3. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  4. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  5. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  6. The cytometric future: it ain't necessarily flow!

    Science.gov (United States)

    Shapiro, Howard M

    2011-01-01

    Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology.

  7. PEPTIC ULCER FREQUENCY DIFFERENCES RELATED TO H. PYLORI OR AINES

    Directory of Open Access Journals (Sweden)

    Diego Michelon de CARLI

    Full Text Available Background Peptic ulcer etiology has been changing because of H. pylori decline. Objectives To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000 and B (2007-2010, searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Results Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000, increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000 and idiopathic peptic ulcer (P=0.002. The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002. Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. Conclusions After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  8. Farmide rajamiseks tuleb EList Eestisse 170 miljonit krooni / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    12.-26. oktoobrini 2009 saavad loomapidajad esitada Põllumajanduse Registrite ja Informatsiooni Ametile (PRIA) taotlusi investeeringutoetuse saamiseks loomakasvatusehitiste rajamiseks ja neisse vajalike seadmete soetamiseks. Lisa: toetus peab kindlustama konkurentsivõimet

  9. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  10. Eesti ehitusturu kasv tipneb 2006. aastal / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Taanis asuva uuringufirma European Construction Research, mis jälgib ja prognoosib Ida- ja Lääne-Euroopa ning Lähis-Ida, Hiina ja Aasia ehitusturgu, ennustab Eestile jätkuvat kasvu. Diagramm: Eesti ehitusturu areng 1999-2010

  11. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  12. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  13. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    Boulos Abou Zakhem

    2017-10-06

    Oct 6, 2017 ... development of sustainable water resources management program to reduce long-term drought risks, ... Anatolian mountain chain at >1000 m ASL (Turk- ... due to climatic change effect by global warming. ... supply levels.

  14. Multivariate statistical characterization of groundwater quality in Ain ...

    African Journals Online (AJOL)

    Administrator

    depends much on the sustainability of the available water resources. Water of .... 18 wells currently in use were selected based on the preliminary field survey carried out to ... In recent times, multivariate statistical methods have been applied ...

  15. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  16. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  17. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  18. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  19. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de TaAIN depositados por magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K. [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Hubler, R. [Pontificia Universidade Catolica do Rio Grande do Sul (PUC-RS), RS (Brazil); Silva Junior, A.H. da, E-mail: brito-g@hotmail.com [Universidade Federal do Rio Grande do Sul (UFRGS), RS (Brazil)

    2016-07-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  20. Keskaegne Tallinna kambersuurtükk / Kaupo Kangur, Ain Mäesalu

    Index Scriptorium Estoniae

    Kangur, Kaupo

    2008-01-01

    Kambersuurtükid olid 15.-16. sajandi Euroopas laialt levinud relvatüüp. Tallinnast leitud kambersuurtükk paikneb Peterburgi artilleria Ajaloo Muuseumis. Kambertulirelvade üldisest ajaloost, Tallinna kambersuurtüki mõõtmestest, välisilmest, valmistamistehnoloogiast ja vanusest. Vaadeldav suurtükk võis olla valmistatud Eestis, kõige tõenäolisemalt Tallinnas. Ta on üks kõige vanemaid tänaseni säilinud tagantlaetavaid tulirelvi kogu maailmas

  1. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  2. Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2006-01-01

    3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides

  3. "If It Ain't Broke, Don't Fix It"

    DEFF Research Database (Denmark)

    Blasco, Maribel; Tackney, Charles

    2013-01-01

    embedded in the hidden curriculum, which made Danish higher education effective at producing graduates with analytical and personal abilities and dispositions, such as reflexivity, curiosity, collaboration and trust that are particularly suitable for today's globalised, knowledge–based economies. We...

  4. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Index Scriptorium Estoniae

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  5. Sulev Keedus : "Jonathan" on film esti indiaanlastest / Sulev Keedus ; interv. Ain Lember

    Index Scriptorium Estoniae

    Keedus, Sulev, 1957-

    2007-01-01

    Dokumentaalfilm "Jonathan Austraaliast" : režissöör ja operaator Sulev Keedus : F-Seitse 2007. Režissöör filmist, kaitstes end kohaliku rahva süüdistuste vastu filmis kujutatu ebaeetilisuse üle

  6. Väärt vara linnas ning maal / Ain Alvela ; kommenteerinud Mart Saa

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Uus Maa Kinnisvarabüroo tegevjuhi Mika Sucksdorffi hinnangul on Tallinnas kinnisvara üks arengusuundi Kalamaja-Kopli-Paljassaare piirkond. A&A Kinnisvara tegevjuhi Aivar Villemsoni hinnangul hakkavad kinnisvarahinnad tõusma esmalt pealinna keskmes, Rocca al Mare ja Pirita kandis

  7. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Index Scriptorium Estoniae

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  8. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Index Scriptorium Estoniae

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  9. A successful chronic care program in Al Ain-United Arab Emirates.

    Science.gov (United States)

    Baynouna, Latifa M; Shamsan, Amal I; Ali, Tahira A; Al Mukini, Lolowa A; Al Kuwiti, Moza H; Al Ameri, Thuraya A; Nagelkerke, Nico J D; Abusamak, Ahmad M; Ahmed, Nader M; Al Deen, Sanaa M Zein; Jaber, Tariq M; Elkhalid, Abdulkarim M; Revel, Anthony D; Al Husaini, Alhusini I; Nour, Fouad A; Ahmad, Hayat O; Nazirudeen, Mohammad K; Al Dhahiri, Rowaya; Al Abdeen, Yahya O Zain; Omar, Aziza O

    2010-02-22

    The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. The project, using the principles of quality assurance cycles, was conducted in 4 stages.The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development.In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity); improvement in recording physical signs (e.g. body mass index (BMI)); and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  10. Euroopa tootjad tahavad jätkata sotsiaalset põllumajandust / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Üleeuroopaline põllumajandustootjate liit COPA ja põllumajandustöötajate organisatsioonide liit COGECA kutsuvad säilitama Euroopas juurdunud põllumajandusmudelit, mis on sattunud muu maailma surve alla

  11. Trial excavations of the northern part of the Lehmja settlement site / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain

    2004-01-01

    Hilisrauaajal on pinnaveetaseme tõus sundinud Lehmja asukaid ümber asuma Tuuleveskimäe lõuna- ja edelajalamile. 2003. aasta kaevamiste põhjal näib, et Tuuleveskimäe edelanõlvale tekkis asustus keskajal

  12. The Danish health care system: it ain't broke... so don't fix it.

    Science.gov (United States)

    Mooney, Gavin

    2002-02-01

    The organisation and financing of the Danish health care system was evaluated within a framework of analysis of strengths, weaknesses, opportunities and threats (a SWOT analysis) by a panel of five members with a background in health economics. The evaluation was based on reading an extensive amount of selected documents and literature on the Danish health care system, and a 1 week-visit to health care authorities, providers and key persons. This paper includes the main findings by one of the panel members. The international competition 'wave' passed by Denmark, and the Danish might rightly say 'thank goodness'. Funding is very largely public and there is a single dominant authority, i.e. the county, which makes planning easier. Low levels of patient payments and the smaller size of the private sector reflect Danish 'solidarity' and promote equity. Planning is good. Exceptions to this are the over-concern with hospital waiting lists and the flirting with DRG based funding. Greater investment in planning approaches would make the system yet better. The GP blended remuneration system with capitation and fee for service is a major strength. The fact that the system has such potential for technical and allocative efficiency and also equity but is not fully exploited suggests the need for more investment in health services research. While there is scope for improving the health care system in Denmark, the rest of the world has as much to learn from the Danes as the Danes have from the rest of the world.

  13. 500 tudengiga aines kontrollib eksamitöid õppejõu eest arvuti / Anu Mõistlik

    Index Scriptorium Estoniae

    Mõistlik, Anu

    2003-01-01

    Tartu Ülikooli selle semestri rahvarohkeima, 500 kuulajaga sotsiaalkultuurilise psühholoogia loengukursuse lõpus kirjutasid tudengid eksamitööks valikvastustega testi, mida hakkavad kontrollima arvutid

  14. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  15. Мain stages in the development of systems of accounting expenses

    Directory of Open Access Journals (Sweden)

    N.P. Snachov

    2012-08-01

    Full Text Available The importances of the historical cost indicate a memo public reporting and cost accounting of primitive society. Knowledge of the costs originates from the theory of value. Foundations of modern vision expenses were laid out in the XIX th century. Increasing needs of production were the impetus for the subsequent study of the costs. Costs are subject to control and measure the impact of economic activities of enterprises.

  16. Tarmo Kriis: Eesti majandus kukkus tagasi aastasse 2007 / Lemmi Kann ; kommenteerinud Ain Seppik

    Index Scriptorium Estoniae

    Kann, Lemmi

    2009-01-01

    Tööandjate keskliidu juht Tarmo Kriis esitles eelarve kokkuhoiukava tutvustamisel tööandjate prognoosi, mille järgi on Eesti majandus tagasi aastas 2007 ning maksimumtase kulude osas saabki olla sama, mis 2007. aastal

  17. Hilissügise õhtul : [luuletused] / Ain Väät

    Index Scriptorium Estoniae

    Väät, Ain

    2001-01-01

    Sisu: Hilissügise õhtul ; Kalalkäik ; Koerailm ; Tasakaal ; Hiirte elu ; Vabaõhukontsert ; Õhtu varestega ; Heliredel ; Noorte kukkede koor ; Lindude kaitseks ; Valge hommik ; Kala mäng ; Siili vatitekk ; Taevane lugu ; Toad on vahel segamini ; Õhtu tuleb ; Õhtul ; Juss sööb õuna ; Sirtsud ; Tõnu jõulusalm

  18. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  19. "You Ain't My Daddy!": Black Male Teachers and the Politics of Surrogate Fatherhood

    Science.gov (United States)

    Brockenbrough, Ed

    2012-01-01

    Recent scholarship on male teachers across several national contexts has investigated the dilemmas of hegemonic masculinity for male educators while only recently beginning to examine race as a mediator of masculinity politics in teaching. Conversely, an emergent body of work on Black male teachers has centred analyses of race and culture, but has…

  20. Academic Advising Ain't What It Used to Be: Strangers in the University.

    Science.gov (United States)

    Byrd, Marquita L.

    1995-01-01

    Ways in which undergraduate education is changing in terms of student diversity, financing, and time required for graduation are discussed, and ways these changes affect academic advising are considered. It is suggested that colleges provide faculty advisors with specific training and make advising an official and evaluated aspect of faculty…

  1. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  2. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  3. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  4. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Index Scriptorium Estoniae

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  5. Jaani seek väärib säilitamist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2001-01-01

    5. oktoobril kogunes Jaani seegi varemete vahele Eesti juhtivatest arheoloogidest koosnev arheoloogiamälestiste nõukogu, kes otsustas, et müüristik on väga väärtuslik muinsus. Samal seisukohal on ka muinsuskaitsjad. Agne Trummali ja Toomas Tamla kommentaarid

  6. Eesti ei maksa Natura aladel toetust 7800 krooni hektari kohta / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    EL 2007-2013 eelarve eelnõu kohaselt võib Natura 2000 aladel tegutsevatele põllumajandustootjatele maksta põllumajanduskõlviku hektari kohta igal aastal kuni 7800 krooni. Põllumajandusministeeriumi spetsialistid ei pea nii suurte toetuste maksmist võimalikuks

  7. All That Glitters Ain't Gold, It's A Goldmine For Growth And Impact

    OpenAIRE

    Dallas, DeLeon Demetrius

    2018-01-01

    When it was announced that Othello was going to be a part of the ‘Winter Season’ I was excited, as were my peers. I landed the role and could not contain my enthusiasm; however, no one, including myself, knew the impact that this role would have on me. I am classically trained and have the technique required to execute this role. So why did I feel so conflicted? It became clear to me that the more I got to know Othello, the more I realized that this role was not written for me, or any Black m...

  8. Deposition and characterization of NbAIN thin films by reactive magnetron sputtering

    International Nuclear Information System (INIS)

    Carvalho, R.G.; Felix, L.C.; Fernandez, D.A.R.; Fontes Junior, A.S.; Oliveira, G.B.; Tentardini, E.K.

    2016-01-01

    The objective of this work was to study NbAlN thin films and the influence of variation in the concentration of aluminum in the crystal structure and oxidation resistance of these coatings. The thin films were deposited by reactive magnetron sputtering and characterized by Grazing Incidence X-ray Diffraction (GIXRD), Energy Dispersive Spectroscopy (EDS) and oxidation tests at high temperatures. NbAlN thin films were deposited and present at concentration of 10, 20 and 42 at% Al. The NbAlN crystalline phase obtained was the δ-NbN, however it was observed a shift of the peaks in the patterns obtained GIXRD of regions for larger angles for these samples, indicating the formation of a solid solution. The higher oxidation resistance temperature was 700° C for the sample with 42 in at% Al. From the SEM analysis it was possible to observe the surface of the film after oxidation, all films showed defects, however the amount of such defects was lower in samples with higher aluminum concentrations. (author)

  9. Applying of whole-tree harvesting method; Kokopuujuontomenetelmaen soveltaminen aines- ja energiapuun hankintaan

    Energy Technology Data Exchange (ETDEWEB)

    Vesisenaho, T [VTT Energy, Jyvaeskylae (Finland); Liukkonen, S [VTT Manufacturing Technology, Espoo (Finland)

    1997-12-01

    The objective of this project is to apply whole-tree harvesting method to Finnish timber harvesting conditions in order to lower the harvesting costs of energy wood and timber in spruce-dominant final cuttings. In Finnish conditions timber harvesting is normally based on the log-length method. Because of small landings and the high level of thinning cuttings, whole-tree skidding methods cannot be utilised extensively. The share of stands which could be harvested with whole-tree skidding method showed up to be about 10 % of the total harvesting amount of 50 mill. m{sup 3}. The corresponding harvesting potential of energy wood is 0,25 Mtoe. The aim of the structural measurements made in this project was to get information about the effect of different hauling methods into the structural response of the tractor, and thus reveal the possible special requirements that the new whole-tree skidding places forest tractor design. Altogether 7 strain gauge based sensors were mounted into the rear frame structures and drive shafts of the forest tractor. Five strain gauges measured local strains in some critical details and two sensors measured the torque moments of the front and rear bogie drive shafts. Also the revolution speed of the rear drive shaft was recorded. Signal time histories, maximum peaks, Time at Level distributions and Rainflow distributions were gathered in different hauling modes. From these, maximum values, average stress levels and fatigue life estimates were calculated for each mode, and a comparison of the different methods from the structural point of view was performed

  10. Pattern of community acquired pneumonia in pregnant ladies in Ain Shams University hospitals

    Directory of Open Access Journals (Sweden)

    Aya M. Abdel Dayem

    2012-10-01

    Conclusion: Morbidity and mortality in pregnant patients with pneumonia continue to present a significant challenge. Early recognition of the diseases process and prompt treatment are required to ascertain an optimal outcome. The treatments in the gravid patients generally follow standard guide lines for the treatment of pneumonia in adults. Concern for fetal outcome should not delay treatment as improvement in maternal oxygenation and status is the best way to ensure fetal protection.

  11. Ain't No Neuroscience Mountain High Enough: Experiences of a Neurogardener.

    Science.gov (United States)

    Abdullah, Jafri Malin

    2015-01-01

    16 years have passed since the idea was mooted in 1999 by five neurosurgeons in the corridors of Hotel Perdana, Kota Bharu. They were Dato' Dr Johari Siregar Bin Adnan, Dato' Professor Dr Ahmad Zubaidi Abdul Latif , Dr Azmin Kass Bin Rosman, Dato' Dr Mohammed Saffari Bin Mohammed Haspani and Professor Dato' Dr Jafri Malin Abdullah. They initiated the beginning of the first programme in Neurosurgery in Malaysia. The rest is history.

  12. A successful chronic care program in Al Ain-United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Al Husaini Alhusini I

    2010-02-01

    Full Text Available Abstract Background The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. Settings and Methods The project, using the principles of quality assurance cycles, was conducted in 4 stages. The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development. In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. Results The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity; improvement in recording physical signs (e.g. body mass index (BMI; and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Conclusion Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  13. Fabrication of surface micromachined ain piezoelectric microstructures and its potential apllication to rf resonators

    NARCIS (Netherlands)

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    2005-01-01

    We report on a novel microfabrication method to fabricate aluminum nitride (AlN) piezoelectric microstructures down to 2 microns size by a surface micromachining process. Highly c-axis oriented AlN thin films are deposited between thin Cr electrodes on polysilicon structural layers by rf reactive

  14. Surface micromachined fabrication of piezoelectric ain unimorph suspension devices for rf resonator applications

    NARCIS (Netherlands)

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    We report a surface micromachining process for aluminum nitride (AlN) thin films to fabricate piezoelectric unimorph suspension devices for actuator applications. Polysilicon is used as a structural layer. Highly c-axis oriented AlN thin films 1 /spl mu/m thick are deposited by rf reactive

  15. "Ain't no one here but us social forces": constructing the professional responsibility of engineers.

    Science.gov (United States)

    Davis, Michael

    2012-03-01

    There are many ways to avoid responsibility, for example, explaining what happens as the work of the gods, fate, society, or the system. For engineers, "technology" or "the organization" will serve this purpose quite well. We may distinguish at least nine (related) senses of "responsibility", the most important of which are: (a) responsibility-as-causation (the storm is responsible for flooding), (b) responsibility-as-liability (he is the person responsible and will have to pay), (c) responsibility-as-competency (he's a responsible person, that is, he's rational), (d) responsibility-as-office (he's the responsible person, that is, the person in charge), and (e) a responsibility-as-domain-of-tasks (these are her responsibilities, that is, the things she is supposed to do). For all but the causal sense of responsibility, responsibility may be taken (in a relatively straightforward sense)-and generally is. Why then would anyone want to claim that certain technologies make it impossible to attribute responsibility to engineers (or anyone else)? In this paper, I identify seven arguments for that claim and explain why each is fallacious. The most important are: (1) the argument from "many hands", (2) the argument from individual ignorance, and (3) the argument from blind forces. Each of these arguments makes the same fundamental mistake, the assumption that a certain factual situation, being fixed, settles responsibility, that is, that individuals, either individually or by some group decision, cannot take responsibility. I conclude by pointing out the sort of decisions (and consequences) engineers have explicitly taken responsibility for and why taking responsibility for them is rational, all things considered. There is no technological bar to such responsibility. © Springer Science+Business Media B.V. 2010

  16. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    African Journals Online (AJOL)

    recruitment and retention of blacks and women in senior posts is still the major challenge facing .... classed social space in order to gain trust and to succeed in their careers. ... In this paper, we examine how participants in one particular ADP experience the .... they didn't want a new way of doing things and they believed the.

  17. It Don't Mean a Thing If It Ain't Got That Swing.

    Science.gov (United States)

    Stainburn, Samantha

    2002-01-01

    Trumpeter Wynton Marsalis created a curriculum that focuses on jazz music, which he asserts can cure what ails today's students, because its unique musical characteristics (collective improvisation, call and response, solos, and unexpected rhythms) demand respect and patience as musicians listen to one another and collaborate. The article suggests…

  18. Everyday Engineering: Ain't She Sweet--Bats, Rackets, Golf Clubs, and All

    Science.gov (United States)

    Moyer, Richard; Everett, Susan

    2011-01-01

    The pitcher throws the ball and the batter takes a mighty swing. Crack! The ball is hit on the sweet spot and soars to the outfield. Or, you hear a thud! This time, the ball dribbles along the infield ground and the batter's hands sting. Everyone who has played baseball or softball has probably experienced both of these outcomes. This may not seem…

  19. Füüsikud maailma päästmas / Ain Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  20. Enha utiliz de anceme ation b erived f ent of by stra from s bioma ain ...

    African Journals Online (AJOL)

    SAM

    2015-01-12

    Jan 12, 2015 ... mutants (Higuchi et al., 2000). ... factors to induce tolerance to subsequent lethal stress ... source replacement are as follows: glucose, 10 g/L; yeast extract, .... as the absorbance of cell suspensions at 600 nm in a UV/VIS.

  1. Maailmas süveneb nõudlus lehtmetallist toodete järele / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Promõshlennost 2. mai lk. 13. AS Favor on oma 17 tegevusaasta vältel teostanud allhankeid, mis on kujunenud tulusaks ja perspektiivseks äriks. Vt. samas: Tooraine tuleb hajutatud kanaleid mööda; Favori neli ärisuunda

  2. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  3. 2018 : tööstust veavad keskkond ja tervis / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga

  4. ... ain pild erheben, als das zu perln gehoret... - Relief- und Perlstickerei des Spätmittelalters

    Czech Academy of Sciences Publication Activity Database

    Wetter, Evelin

    -, č. 70 (2014), s. 112-125 ISSN 0231-5793 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : textile works of art from the treasuries * liturgical robes * embroidery * serial production * made-to-order production Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Cancer Diagnostics: The Future Ain't What It Used to Be

    NARCIS (Netherlands)

    Groenendijk, F.H.

    2015-01-01

    Cancer is a genomic disease. Most cancers contain multiple genetics alterations that drive their unrestrained proliferation, progression and metastatic capacity. For most cancer types, it is known what these alterations are and what their frequency is. Genomics technologies have made it possible to

  6. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  7. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  8. Ain't I Black Too: Counterstories of Black Atheists in College

    Science.gov (United States)

    Snipes, Jeremy T.

    2017-01-01

    Increasingly Black college students are identifying as atheist, however few empirical studies in higher education and student affairs are exploring the phenomenon. This dissertation examines the question, "How do Black atheist understand their identity in college?" Using Higginbotham's Politics of Respectability and tenants of Critical…

  9. Theory Ain't Practice: Four Novice Researchers Navigate Dilemmas of Representation within Immigrant Populations

    Science.gov (United States)

    Aleixo, Marina; Hansen, Sarah; Horii, Sachiko; Un, Silvy

    2014-01-01

    This article illuminates instances in which four graduate students have struggled with issues of representation--of themselves and of immigrant participants--at their research sites and in their writing. These dilemmas are situated within the literature on the politics of representation in qualitative research. Although these dilemmas are not…

  10. Saaremaa maaelu ja põllumajandus said mullu ligi 140 miljonit toetust / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Saare maakond sai 2004. aastal enam kui 138 miljoni krooni eest maaelu- ja põllumajandustoetusi, mis teeb iga maal elava inimese kohta 6760 krooni. Tabelid: Toetussumma maakonna lõikes; Toetussumma iga maal elava inimese kohta (kroonides)

  11. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    African Journals Online (AJOL)

    The paper is based on interviews with 18 black lecturers who entered the academic workforce through the university's ADP. Employing Pierre Bourdieu's theoretical framework of social and cultural reproduction, we discuss how difficult it is to interrupt the naturalised norms and values that form part of the existing institutional ...

  12. Ellipsometric study of GaN/AIN/Si(111) heterostructures grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    Nabi, M. A. U.; Ashfaq, A.; Arshad, M. I.; Ali, A.; Mahmood, K.; Hasan, M. A.; Asghar, M.

    2013-01-01

    GaN and related structures attracted a great interest in the recent years for electronic and optoelectronic applications due to their promising properties. GaN is grown popularly on foreign substrates like sapphire and SiC. However, silicon due to its favourable properties attended the great attention of material scientists and researchers to utilize as substrate for heteroepitaxy of GaN based structures and devices. Silicon substrates are low cost, available in large diameters and have well characterized thermal and electrical properties. In this study, GaN/AlN/Si(111) heterostructures were grown by molecular beam epitaxy. We performed x-ray diffraction spectroscopy and spectroscopic ellipsometry on these samples to study their structural and optical properties. XRD measurements performed on these samples revealed the presence of high quality GaN films as well as the presence of AlN buffer layer with the following miller indices: GaN (002), GaN (004), GaN (006) and GaN (110) along with Si peak of phase (111). The ellipsometric data obtained were used to characterize the GaN/Si samples as a function of film thickness. Refractive index, extinction coefficient and dielectric constant were calculated by the measured data. (author)

  13. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Science.gov (United States)

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  14. Literacy in the Content Areas: Ain't No Need to Sing the Blues.

    Science.gov (United States)

    Deegan, Dorothy

    1994-01-01

    Presents a portrait of a content area reading course taken by undergraduates in a health/physical education teacher preparation program. Discusses how resistance was anticipated and rallied as a way of driving the work done over the course of the semester. (RS)

  15. Promõshlennõje zonõ ohvatil "mjortvõi sezon" / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arendajad on tehnoparkide rajamise ooterežiimile pannud - ostjaid jaguks, kuid võimalusi napib. Diagramm: Za pjat let stoimost zemli promõshlennogo naznatshenija võrosla v pjat raz; Tabel: Naiboleje dorogaja zemlja - v promparke Lasnamäe. Kommenteerivad Enn Tosso, Nikolai Pitshugov ja Urmas Ahven

  16. Tõnu Virve: filmi aines puudutas mu enda mälestusi / Tõnu Virve ; intervjueerinud Andres Laasik

    Index Scriptorium Estoniae

    Virve, Tõnu, 1946-

    2009-01-01

    Intervjuu 22. septembril Kumu auditooriumis esilinastunud dokumentaalfilmi "Monument" (Freyja Film, 2009) režissööri Tõnu Virvega. Kesksel kohal on filmis Tallinna Tõnismäe monument (skulptor Enn Roos, arhitekt Arnold Alas)

  17. prevalence of hepatitis B and C viruses among health care workers in Ain Shams university hospitals

    International Nuclear Information System (INIS)

    El-fouly, A.H.A.

    2005-01-01

    exposure to blood borne pathogens poses a serious risk to health care workers (HCW), since the transmission of viral hepatitis B and C to health care workers has became of worldwide concern. hepatitis B and C viruses are the most frequent occupational disease in health care service workers, HCW are defined as persons (doctors, nurses, employees, students, contractors, attending clinicians, public-safety workers, or volunteers) whose activities involve contact with patients or with blood or other body fluids from patients in a health - care, laboratory, or public-safety setting . the potential exists for blood and body fluid exposure to other workers, and the same principle of exposure management could be applied to other setting.in the united states, the prevalence of HBV and HCV among HCWs range between (6-30%) and (2.7-10%) respectively . in spain HBV prevalence is 11.6% and HCV is 28.8%. while in taiwan 16.7% of HCWs were seropositive to HBsAG and 12.7% were seropositive for HCV. In Egypt, screening of 1485 HCWs in the Ministry of health hospitals, 35% were exposed to needle sticks

  18. Eesti edukad ettevõtted ahvatlevad varakaid piiritaguseid ülesostjaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Viimasel ajal on sagenenud ettevõtete ülevõtmine piiritaguste firmade poolt. Vt. samas: Atria pole Valga kasumlikkust tõstnud; Valio sai Võru juustu näol oma kontserni ka juustutööstuse; Tartu Õlletehas neelas Ösel Foodsi; Plus Brewery nime saanud Pärnu Õlu uuendab seadmeid ja brände

  19. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering

    International Nuclear Information System (INIS)

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K.; Silva Junior, A.H. da

    2016-01-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  20. Recubrimientos protectores de TiN y AIN: comportamiento frente a temperatura

    Directory of Open Access Journals (Sweden)

    Auger, M. A.

    2006-04-01

    Full Text Available The use of ceramic materials like titanium and aluminium nitrides have experienced a great improvement in the last years due to the variety of applications they show. The use as protective coatings on industrial tools is one important application with very favorable results for the moment, as it is the use as coating molds used for different elements fabrication. One of the mostly often used techniques to deposit protective coatings is the sputtering technique, which has been used in this work. In the present study we have analysed structural and mechanical properties of TiN and AlN thin films, using X-Ray diffraction, scanning electron microscopy, nanoindentation and pin-on-disk techniques. Thermal treatments have been applied on the mentioned films, applying three different temperature values: 750oC, 850oC y 950oC. Changes in their properties before and after the treatments have been observed. TiN layers show a thermal resistance around 750oC. The thermal resistance for AlN layers is around 850oC, being also observed an improvement in their properties when applying 850ºC of thermal treatment.

    La utilización de materiales cerámicos como el nitruro de titanio o de aluminio ha experimentado una gran popularización en los últimos años gracias a su gran variedad de aplicaciones. Una importante aplicación que cuenta hasta el momento con resultados muy favorables es la de su uso como recubrimientos protectores de herramientas industriales, así como de moldes empleados en la fabricación de diferentes elementos. Una de las técnicas más utilizadas en la obtención de recubrimientos protectores es la técnica de sputtering, utilizada en este trabajo. En el presente estudio se han analizado las propiedades estructurales y mecánicas de láminas delgadas de TiN y AlN mediante las técnicas de difracción de rayos X, microscopía electrónica de barrido, nanoindentación y pin-on-disk. Dichas capas han sido sometidas a un tratamiento térmico en el que se han aplicado tres temperaturas: 750oC, 850oC y 950oC, y se han observado variaciones en sus propiedades antes y después del tratamiento. Las capas de TiN presentan una resistencia térmica en torno a 750oC. Las capas de AlN resisten hasta una temperatura en torno a 850oC, observándose además una mejoría en sus propiedades al ser sometidas a dicha temperatura de 850oC.

  1. Detoxification Of Ochratoxin AIN Green Coffee Beans By Physical Methods With Studying Genotoxicity Of Treated Samples

    International Nuclear Information System (INIS)

    FARAG, S.A.; SHAMS EL DIEEN, N.M.M.; EL-SIDEEK, L

    2010-01-01

    Ochratoxin A (OTA) is potently nephrotoxic, teratogenic and carcinogenic, and the potency was varied markedly between species and sexes. Unfortunately, OTA are present due to mold contamination in different food stuffs such as coffee bean, therefore, the present study was carried out on collected imported coffee samples from super markets in Egypt. The isolation and identification proved presence of Penicilli sp. and Aspergillus sp. whereas the last one was dominant in two samples as A. niger and A. ochoruses. Determination of OTA by using HPLC analysis showed presence of high levels than the allowance levels in green coffee beans (more than 5 μg/kg; ppb). In addition, another group of collected samples as roasted coffee beans indicated the presence of high toxic concentrations of OTA. The study was then conducted on samples contain the highest OTA content by using some physical methods as gamma irradiation (5 and 10 kGy), charcoal (powder, granules), roasting (at 200 0 C for 7-10 min and 20 min). The results showed that proposed physical methods, mainly gamma irradiation and charcoal, could be efficient to decrease OTA in green beans coffee without produce toxic substance as well as non-significant changes in its properties. In addition, safety of resulted coffee beans after treatments were checked by ESR and genotoxicity test, which raise the preferability of gamma irradiation (10 kGy) treatment before using medium roasting to get coffee beans free from OTA

  2. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  3. Küla arengukava on külaarengu toetuse saamiseks vajalik / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Liikumine Kodukant kavatseb esitada põllumajandusministeeriumile protestikirja, kuna ei nõustu ministeeriumi infopäevadel levitatava tõlgendusega nagu võiks külade taastamise ja arendamise meetme toetust taotleda ka ilma küla arengukavata. Arvamust avaldavad: Maris Ode, Lemmi Maasik, Heli Raamets, Marek Raud ja Sille Rähn

  4. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Index Scriptorium Estoniae

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  5. A Completely New Type of Actuator -or- This Ain't Your Grandfather's Internal Combustion Engine

    Science.gov (United States)

    Gore, Brian W.; Hawkins, Gary F.; Hess, Peter A.; Moore, Teresa A.; Fournier, Eric W.

    2010-01-01

    A completely new type of actuator - one that is proposed for use in a variety of environments from sea to land to air to space - has been designed, patented, built, and tested. The actuator is loosely based on the principle of the internal combustion engine, except that it is a completely closed system, only requiring electrical input, and the working fuel is water. This paper outlines the theory behind the electrolysis- and ignition-based cycle upon which the actuator operates and describes the performance capability test apparatus and results for the actuator. A mechanism application that harnessed the unit s power to twist a scaled rotor blade is also highlighted.

  6. Veiko Õunpuu pälvis Euroopa Talendi auhinna / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2008-01-01

    Cannes'i filmifestivali raames toimuval Euroopa päeval antakse filmirežissöör Veiko Õunpuule üle Euroopa Talendi auhind (European Talent Prize) mängufilmiprojekti "Püha Tõnu Kiusamine" eest (produtsent Katrin Kissa). MEDIA Desk Eesti juht Anu Ernits peab seda suureks võiduks kogu Eesti filmile

  7. 274 REVIEW ARTICLE

    African Journals Online (AJOL)

    boaz

    Le consentement informé verbal et écrit a été prise de tous les patients. Un total de 404 VIH .... 2014. 404 HIV seropositive clients who attended. Kogi State University Teaching Hospital Anyigba ..... Renata AB, Renata ZAM, Geovana MN etal.

  8. In-situ metrology in multiwafer reactors during MOVPE of AIN-based UV-LEDs (Conference Presentation)

    Science.gov (United States)

    Knauer, Arne; Brunner, Frank; Kolbe, Tim; Hagedorn, Sylvia; Kueller, Viola; Weyers, Markus

    2017-02-01

    UV-LEDs are of great interest for applications like disinfection, gas sensing, and phototherapy. The cost sensitive LEDs are commonly grown by MOVPE on transparent AlN/sapphire templates. The large thermal and lattice mismatch between AlN and sapphire generates a very high dislocation density (DD) and causes big challenges in strain management. The threading dislocation density should be reduced to the order of low 108cm-2 for high internal efficiency of the AlGaN based UV-LED structures. The TDD will be reduced mainly by dislocation annihilation during the growth of thick Al(Ga)N layers, which is a challenge in terms of strain management. We present how in-situ reflectometry and curvature measurement (EpiCurveTT(at)LayTec) in commercial multiwafer growth reactors helps to optimize the growth processes concerning growth rates, surface roughening and avoidance of layer cracking on 2inch substrates and enhance the reproducibility of epitaxial growth. The growth of up to 3 μm thick planar AlN templates and up-to 10 μm thick AlN/sapphire templates by epitaxial lateral overgrowth of stripe patterned templates for UV-C LED structures will be highlighted. The implementation of different types of AlN/GaN superlattices for the subsequent growth of up to 5μm thick Al0.5Ga0.5N layer for UVB LED structures will be shown. Correlations to ex-situ measurements like X-ray diffraction and TEM analysis of defects in the LED structures will be shown. Some challenges of in-situ control through very narrow viewports as in Close Coupled Showerhead reactors will be discussed as well as the influence of silicon doping on curvature and dislocation density in Al(Ga)N layers.

  9. Üks liblika tiivalöök Brasiilias võib tekitada Texases tornaado / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2008-01-01

    Meteoroloog ja matemaatik Edward Norton Lorenz (1917-2008) tegi 1961. aastal tavalist numbrilist ilmaprognoosi. Arvutustes tehtud väikese ümarduse tõttu muutus lõpp-prognoos ebatäpseks. Kogetu põhjal formuleeris ta ühe kaoseteooria põhiprintsiibi

  10. Catering for Pilgrims: Petrographic Analysis of Late Antique Kitchenware from the Monastery of St Lot at Deir 'Ain 'Abata, Jordan

    Directory of Open Access Journals (Sweden)

    Louise Joyner

    2000-10-01

    Full Text Available Petrography has been used to elucidate patterns of production and consumption of kitchenware at a typical Early Christian desert monastery on the Pilgrim route. While some vessels may have been produced locally, there is evidence for long distance trade of other vessels.

  11. Ain't no mountain high enough? Setting high weight loss goals predict effort and short-term weight loss.

    Science.gov (United States)

    De Vet, Emely; Nelissen, Rob M A; Zeelenberg, Marcel; De Ridder, Denise T D

    2013-05-01

    Although psychological theories outline that it might be beneficial to set more challenging goals, people attempting to lose weight are generally recommended to set modest weight loss goals. The present study explores whether the amount of weight loss individuals strive for is associated with more positive psychological and behavioral outcomes. Hereto, 447 overweight and obese participants trying to lose weight completed two questionnaires with a 2-month interval. Many participants set goals that could be considered unrealistically high. However, higher weight loss goals did not predict dissatisfaction but predicted more effort in the weight loss attempt, as well as more self-reported short-term weight loss when baseline commitment and motivation were controlled for.

  12. The application of magnetic self-filter to optimization of AIN film growth process during the impulse plasma deposition synthesis

    Directory of Open Access Journals (Sweden)

    Chodun Rafal

    2016-03-01

    Full Text Available This work presents the very first results of the application of plasma magnetic filtering achieved by a coil coupled with an electrical circuit of a coaxial accelerator during the synthesis of A1N thin films by use of Impulse Plasma Deposition method (IPD. The uniqueness of this technical solution lies in the fact that the filter is not supplied, controlled and synchronized from any external device. Our solution uses the energy from the electrical circuit of plasma accelerator. The plasma state was described on the basis of OES studies. Estimation of the effects of plasma filtering on the film quality was carried out on the basis of characterization of structure morphology (SEM, phase and chemical composition (vibrational spectroscopy. Our work has shown that the use of the developed magnetic self-filter improved the structure of the AlN coatings synthesized under the condition of impulse plasma, especially by the minimization of the tendency to deposit metallic aluminum droplets and columnar growth.

  13. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    International Nuclear Information System (INIS)

    Bakraji, E.H.; Othman, I.; Karajou, J.

    2001-01-01

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109 Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials

  14. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope x-ray fluorescence method

    International Nuclear Information System (INIS)

    Bakraji, E. H.; Karajou, J.; Othman, I.

    2002-01-01

    The radioisotope x-ray fluorescence method was applied to provenance studies of ceramics fragments originated from the Mar-Takla site in Syria. 35 samples were analyzed, where each sample was irradiated 1000 s by sup 1 sup 0 sup 9 Cd radioisotope source and the elements (As, Ca, fe, Ga, Nb, Mn, Pb, Rb, Sr, Ti, Y, Zn, and Zr) were determined. The data were subjected to two multivariate statistical methods, cluster and principal component analysis (PCA). The study show that 94% of the samples can be considered to be manufactured using two sources of raw materials. (Authors)

  15. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Index Scriptorium Estoniae

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  16. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  17. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  18. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  19. The antioxidant response of the liver of male Swiss mice raised on a AIN 93 or commercial diet

    OpenAIRE

    Caetano, Aline C; da Veiga, Lucimara F; Capaldi, Fl?via R; de Alencar, Severino M; Azevedo, Ricardo A; Bezerra, Rosangela MN

    2013-01-01

    Abstract Background Reactive oxygen species (ROS) are formed under natural physiological conditions and are thought to play an important role in many human diseases. A wide range of antioxidants are involved in cellular defense mechanisms against ROS, which can be generated in excess during stressful conditions, these include enzymes and non-enzymatic antioxidants. The aim of this study was to evaluate the antioxid...

  20. "Sa, haavapuu, kesköösel valendad..." : [luuletused] / Paul Celan ; saksa k. tlk. [ja saatesõna]: Ain Kaalep

    Index Scriptorium Estoniae

    Celan, Paul, pseud., 1920-1970

    2001-01-01

    Autorist lk. 49-50. Sisu: "Sa, haavapuu, kesköösel valendad..." ; Mälestus Prantsusmaast ; Aastad sinust minuni ; Surmafuuga ; Aja silm ; Kõnevõre ; Silm, lahtine ; Zürich, "Toonekure" kohvik : Nelly Sachsile ; Psalm ; "Niitpäikesed..." ; "Maovankris, mööda..." ; "Maastik urnidega..." ; Prahas ; "Kõmin: see on..." ; "Üks hambajälg eikuskilpool..." ; "Kahinais, otsekui meie alguses..." ; Teine ; "Teie oma..." ; "See, mis meid..." ; "Lõika palvekäsi..." ; "Ma kuulen, et kirves lõi õitsema..." ; "Leht, mille puu küljest..."

  1. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    Science.gov (United States)

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  2. Formation, structure and magnetism of the metastable defect fluorite phases AVO3.5+x (A=In, Sc)

    International Nuclear Information System (INIS)

    Shafi, Shahid P.; Lundgren, Rylan J.; Cranswick, Lachlan M.D.; Bieringer, Mario

    2007-01-01

    We report the preparation and stability of ScVO 3.5+x and the novel phase InVO 3.5+x . AVO 3.5+x (A=Sc, In) defect fluorite structures are formed as metastable intermediates during the topotactic oxidation of AVO 3 bixbyites. The oxidation pathway has been studied in detail by means of thermogravimetric/differential thermal analysis and in-situ powder X-ray diffraction. The oxidation of the bixbyite phase follows a topotactic pathway at temperatures between 300 and 400 deg. C in air/carbon dioxide. The range of accessible oxygen stoichiometries for the AVO 3.5+x structures following this pathway are 0.00≤x≤0.22. Rietveld refinements against powder X-ray and neutron data revealed that InVO 3.54 and ScVO 3.70 crystallize in the defect fluorite structure in space group Fm-3 m (227) with a=4.9863(5) and 4.9697(3)A, respectively with A 3+ /V 4+ disorder on the (4a) cation site. Powder neutron diffraction experiments indicate clustering of oxide defects in all samples. Bulk magnetic measurements showed the presence of V 4+ and the absence of magnetic ordering at low temperatures. Powder neutron diffraction experiments confirmed the absence of a long range ordered magnetic ground state. - Graphical abstract: Topotactic oxidation of AVO 3 bixbyite to AVO 3.5 defect fluorite structure followed by in-situ powder X-ray diffraction. The upper structural diagram shows a six coordinated (A/V)-O 6 fragment in bixbyite, the lower structure illustrates the same seven-fold coordinated (A/V)-O 7 cubic environment in the defect fluorite structure

  3. Eestlane tahab tasuta kvaliteetset arstiabi, järjekorras ootamata / Risto Sverdlik ; kommenteerinud Ain Aaviksoo, Eiki Nestor

    Index Scriptorium Estoniae

    Sverdlik, Risto

    2009-01-01

    Autori hinnangul on Eesti tervishoiusüsteem sotsialistlik ning suhteliselt sarnase tervishoiusüsteemiga riikides on samad probleemid: ravijärjekorrad ja kulude kasv. Singapuri tervishoiumudelist. Autor leiab, et keskse planeerimisega tervishoiusüsteemi puhul kannatavad kõige rohkem vaesed, turumajanduslikus süsteemis aga ravihinnad järjest väheneksid

  4. 115 Qualité de la source Ain Hamma et effet du déversement de ses ...

    African Journals Online (AJOL)

    AKA BOKO

    contamination fécale : Coliformes totales, Coliformes fécaux, Streptocoques fécaux et Entérocoques intestinaux. Ces eaux ne semblent pas être influencées par la qualité bactériologique des eaux de la source dont le degré de pollution est inférieur à celui de l'oued mais reste inquiétant et pouvant constituer un.

  5. Nahast küünarvarrekaitsmed keskaegsest Tartust / Ain Mäesalu, Jüri Peets, Elna Haiba

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2008-01-01

    2000. aastal Tartust leitud 14. sajandi lõpukümnenditest või 15. sajandi algusest pärinevatest küünarvarrekaitsmetest. Keskaegsest kaitsevarustusest, Tartu küünarvarrekaitsmete valmistamistehnikast, nende kahjustustest ja konserveerimisest

  6. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  7. Ain't Necessarily So : Review and Critique of Recent Meta-Analyses of Behavioral Medicine Interventions in Health Psychology

    NARCIS (Netherlands)

    Coyne, James C.; Thombs, Brett D.; Hagedoorn, Mariet

    Objective: We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based

  8. Ain't necessarily so: review and critique of recent meta-analyses of behavioral medicine interventions in health psychology.

    Science.gov (United States)

    Coyne, James C; Thombs, Brett D; Hagedoorn, Mariet

    2010-03-01

    We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based Treatment Reviews section of Health Psychology. Narrative review. We applied the following criteria to each meta-analysis: (1) whether each meta-analysis was described accurately, adequately, and transparently in the article; (2) whether there was an adequate attempt to deal with methodological quality of the original trials; (3) the extent to which the meta-analysis depended on small, underpowered studies; and (4) the extent to which the meta-analysis provided valid and useful evidence-based recommendations. Across the four meta-analyses, we identified substantial problems with the transparency and completeness with which these meta-analyses were reported, as well as a dependence on small, underpowered trials of generally poor quality. Results of our exercise raise questions about the clinical validity and utility of the conclusions of these meta-analyses. Results should serve as a wake up call to prospective authors, reviewers, and end-users of meta-analyses now appearing in the literature. Copyright 2010 APA, all rights reserved.

  9. Antisymmetric entangled two-photon states generated in nonlinear GaN/AIN photonic-band-gap structures

    Czech Academy of Sciences Publication Activity Database

    Peřina ml., Jan; Centini, M.; Sibilia, C.; Bertolotti, M.; Scalora, M.

    2007-01-01

    Roč. 75, č. 1 (2007), 013805/1-013805/1 ISSN 1050-2947 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : parametric down-conversion * quantum teleportation * interference * indistinguishability * dispersion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.893, year: 2007

  10. Päästetute koor : [luuletused] / Nelly Sachs ; saksa k. tlk. [ja järelsõna:] Ain Kaalep

    Index Scriptorium Estoniae

    Sachs, Nelly

    2003-01-01

    Sisu: Päästetute koor ; Kes aga tühjendas liivast teie kingad ; Et jälitatuist ei saaks jälitajad ; Sündmatute koor ; Liblikas ; Maailma rahvad ; Valmis on kõik maad ; Nii üksildane on inimene

  11. A New Look at Shelter 131/51 in the Natufian Site of Eynan (Ain-Mallaha, Israel.

    Directory of Open Access Journals (Sweden)

    Gil Haklay

    Full Text Available In the past 25 years since the reconstruction of Shelter 131 of Eynan was suggested by Francois Valla, its image has become almost iconic--a highly cited symbol of early sedentism constituting a significant part of our knowledge on early stone constructions and the people behind them. A new look at the architectural remains and the stratigraphy resulted in an alternative reconstruction, essentially different than the one we have come to know. We used spatial (architectural-geometrical analysis in order to study the relationships between the different architectural elements and to test our hypothesis that the series of postholes may have not pertained to the upper floor 131 of Layer IV as suggested by Perrot and Valla, but rather to the successive occupational and architectural episode. The association of the postholes with Wall 51 of Layer III sheds new light on the architectural remains revealing their geometric design, an important characteristic of Early Natufian Architecture, the meaning and implications of which we shortly discuss.

  12. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  13. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III

  14. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Index Scriptorium Estoniae

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  15. Straight talk about high-fructose corn syrup: what it is and what it ain't.

    Science.gov (United States)

    White, John S

    2008-12-01

    High-fructose corn syrup (HFCS) is a fructose-glucose liquid sweetener alternative to sucrose (common table sugar) first introduced to the food and beverage industry in the 1970s. It is not meaningfully different in composition or metabolism from other fructose-glucose sweeteners like sucrose, honey, and fruit juice concentrates. HFCS was widely embraced by food formulators, and its use grew between the mid-1970s and mid-1990s, principally as a replacement for sucrose. This was primarily because of its sweetness comparable with that of sucrose, improved stability and functionality, and ease of use. Although HFCS use today is nearly equivalent to sucrose use in the United States, we live in a decidedly sucrose-sweetened world: >90% of the nutritive sweetener used worldwide is sucrose. Here I review the history, composition, availability, and characteristics of HFCS in a factual manner to clarify common misunderstandings that have been a source of confusion to health professionals and the general public alike. In particular, I evaluate the strength of the popular hypothesis that HFCS is uniquely responsible for obesity. Although examples of pure fructose causing metabolic upset at high concentrations abound, especially when fed as the sole carbohydrate source, there is no evidence that the common fructose-glucose sweeteners do the same. Thus, studies using extreme carbohydrate diets may be useful for probing biochemical pathways, but they have no relevance to the human diet or to current consumption. I conclude that the HFCS-obesity hypothesis is supported neither in the United States nor worldwide.

  16. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cerio, Frank

    2013-09-14

    The DOE has set aggressive goals for solid state lighting (SSL) adoption, which require manufacturing and quality improvements for virtually all process steps leading to an LED luminaire product. The goals pertinent to this proposed project are to reduce the cost and improve the quality of the epitaxial growth processes used to build LED structures. The objectives outlined in this proposal focus on achieving cost reduction and performance improvements over state-of-the-art, using technologies that are low in cost and amenable to high efficiency manufacturing. The objectives of the outlined proposal focus on cost reductions in epitaxial growth by reducing epitaxy layer thickness and hetero-epitaxial strain, and by enabling the use of larger, less expensive silicon substrates and would be accomplished through the introduction of a high productivity reactive sputtering system and an effective sputtered aluminum-nitride (AlN) buffer/nucleation layer process. Success of the proposed project could enable efficient adoption of GaN on-silicon (GaN/Si) epitaxial technology on 150mm silicon substrates. The reduction in epitaxy cost per cm{sup 2} using 150mm GaN-on-Si technology derives from (1) a reduction in cost of ownership and increase in throughput for the buffer deposition process via the elimination of MOCVD buffer layers and other throughput and CoO enhancements, (2) improvement in brightness through reductions in defect density, (3) reduction in substrate cost through the replacement of sapphire with silicon, and (4) reduction in non-ESD yield loss through reductions in wafer bow and temperature variation. The adoption of 150mm GaN/Si processing will also facilitate significant cost reductions in subsequent wafer fabrication manufacturing costs. There were three phases to this project. These three phases overlap in order to aggressively facilitate a commercially available production GaN/Si capability. In Phase I of the project, the repeatability of the performance was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  17. "It ain't all as bad as it may seem": young Black lesbians' responses to sexual prejudice.

    Science.gov (United States)

    Reed, Sarah J; Valenti, Maria T

    2012-01-01

    This article explores the ways in which young, Black lesbians manage their sexual minority identity when experiencing sexual prejudice. Fourteen Black lesbians between the ages of 16 and 24 participated in semistructured interviews. Instances of sexual prejudice and the young women's responses were thematically analyzed using open and axial qualitative coding techniques. Results indicated that participants experienced sexual prejudice frequently and even within the lesbian community. Responses to sexual prejudice included: cognitive reframing of heterosexist messages, passing, gaining support from self-created gay families, and fighting back (physically and verbally) in the event of isolated instances of sexual prejudice. Analysis focuses on how gender identity relates to experiences of sexual prejudice and identity management strategies. Findings suggest that there are parallels between the management strategies of these women and young, Black gay and bisexual males and between these women and Black women who are coping with sexism and racism.

  18. Merle Karusoo uue tüki aines pärineb lõpukirjandist / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Merle Karusoo alustab proove eesti ja vene koolide õpilaste lõpukirjandite põhjal koostatud lavastusega. Septembris Draamateatris esietenduva Karusoo lavastuse tööpealkiri on "Küpsuskirjand 2005"

  19. Merle Karusoo uue tüki aines pärineb lõpukirjanditest / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Lavastaja Merle Karusoo alustab peagi proove lavastusega, mis on koostatud õpilaste lõpukirjandite põhjal. Käsitletavad kirjanditeemad on venekeelsetelt lõpetajatelt ́ђجSeda maad nimetan ma kodumaakśђح ja eestlastelt ́ђجRahvussuhted 21. sajandiĺђح

  20. Nitric oxide as a mediator of gastrointestinal mucosal injury?—Say it ain't so

    Directory of Open Access Journals (Sweden)

    Paul Kubes

    1995-01-01

    Full Text Available Nitric oxide has been suggested as a contributor to tissue injury in various experimental models of gastrointestinal inflammation. However, there is overwhelming evidence that nitric oxide is one of the most important mediators of mucosal defence, influencing such factors as mucus secretion, mucosal blood flow, ulcer repair and the activity of a variety of mucosal immunocytes. Nitric oxide has the capacity to down-regulate inflammatory responses in the gastrointestinal tract, to scavenge various free radical species and to protect the mucosa from injury induced by topical irritants. Moreover, questions can be raised regarding the evidence purported to support a role for nitric oxide in producing tissue injury. In this review, we provide an overview of the evidence supporting a role for nitric oxide in protecting the gastrointestinal tract from injury.

  1. If it ain't broke, don't price fix it: the OFT and the PPRS.

    Science.gov (United States)

    Towse, Adrian

    2007-07-01

    The Office of Fair Trading (OFT) Report on the UK Pharmaceutical Price Regulation Scheme (PPRS) recommends that when the current five-year PPRS expires in 2010 it be replaced with 'value-based pricing' which involves pre-launch centralised government price setting based on a cost-per-QALY threshold plus periodic ex post reviews. I examine the validity of the OFTs criticisms of the existing PPRS, review its proposals and propose an alternative way forward. I conclude that PPRS has performed well as a procurement bargain between industry and the UK government. It does not, however, incentivise efficient relative prices. That is not its job. I identify a number of problems with the OFT proposals. I recommend that key elements of a reformed UK pharmaceutical environment for 2010 should include an expanded role for HTA but with companies retaining freedom to set prices at launch; HTA use targeted via a contingent value of information approach; a retained backstop PPRS, perhaps moving to an RPI-X type control; the use of risk sharing and non-linear pricing arrangements; measures to ensure more effective therapeutic switching at local level; and measures to improve the take up of cost-effective treatments. Copyright (c) 2007 John Wiley & Sons, Ltd.

  2. Evaluations of parameters peculiar to the third group nitrides: BN, AIN, GaN and InN

    CERN Document Server

    Davydov, S Y

    2002-01-01

    The estimations of dielectric, optical electrooptical, magnetic and phonon characteristics of XN (X = B, Al, Ga, In) crystals are obtained by means of simple methods using both quantum mechanics and semiempirical approaches. The values of deformation potentials and magnetic susceptibility these nitrides are defined. The calculation results are compared with experimental data and data obtained by other authors

  3. It ain't what you say, it's how you say it: linguistic and cultural diversity in the classroom.

    Science.gov (United States)

    Robinson, Cynthia Cole; Clardy, Pauline

    2011-01-01

    The disparity between the cultural and linguistic diversity of the teaching population and the student population continues to grow as teacher education programs enroll and graduate primarily white teacher candidates (83.7%). At the same time, the diversity of the K-12 student body has increased with 65% of public school students being from culturally and linguistically diverse backgrounds (National Center for Education Statistics, 2007). This chasm between the diversity of the teaching force and student population is of concern as many teachers report that they do not have the cultural knowledge and experience of working or living in diverse environments, yet will be faced with teaching a very diverse student population. Hence, the need for teacher candidates and current teachers to be explicitly taught the skills needed to successfully teach diverse student populations is urgent. In this article, we explore the following phenomena: how linguistic and cultural diversity is regarded in teacher education programs, as well as teacher candidates' and current K-12 teachers' dispositions towards students who do not share their cultural backgrounds or language (including those who vary in their dialects). Finally, we will present strategies that teacher educators can use to embrace and empower culturally and linguistically diverse (CLD) teacher candidates, as well as prepare teacher candidates to teach diverse student populations.

  4. Your tooth it ain't so purty but it's gen-u-ine: Cole Porter's comic song "Snagtooth Gertie".

    Science.gov (United States)

    Christen, Arden G; Christen, Joan A

    2010-01-01

    Cole Porter (1891-1964), an American musical icon, has been internationally acknowledged as one of the most cosmopolitan, sophisticated, elegant and influential composer-lyricists of the 20th century. Born in Indiana and raised in wealth and privilege, he attended both Yale and Harvard universities where he honed his song-writing skills. In his 800 tunes, many of which became smash hits, he blended fresh, witty, urbane and colloquial lyrics with catchy, singable melodies. He composed musical scores for both Broadway stage and Hollywood movies, but focused on the former. While Porter enjoyed penning comic songs, he rarely had them published. In 1946, Cole wrote the music and lyrics for a Broadway show entitled Around the World in Eighty Days. Deemed a failure, it closed after only 75 performances. One light-hearted ditty, "Snagtooth Gertie", which he composed for the show, was never used. The lyrics are presented for the first time in this paper.

  5. Küttimine võib septembris peatuda. Maaomanikud vs. jahimehed / Ain Alvela ; kommenteerinud Heiki Hepner, Val Rajasaar

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Maksumaksjad ja maaomanikud toetavad Eesti jahindust sisuliselt viie miljoni euroga aastas, kuigi keskkonnaspetsialistide hinnangul võiks asi olla vastupidi. Kehtiv jahiseadus ei aita kaasa metsa väärtuse parandamisele. Tabelid

  6. "I Ain't Changing Anything": A Case-Study of Successful Generation 1.5 Immigrant College Students' Writing

    Science.gov (United States)

    Riazantseva, Anastasia

    2012-01-01

    The purpose of this case-study was to understand the relationship between success in college and L2 academic writing of three Generation 1.5 Russian-speaking middle-class college students and to describe the factors that could have contributed to the levels of academic literacy that these students developed. The following research questions were…

  7. Piimandus: laenukarid, ikaldused ja hinnaralli tõid kriisi / Ain Alvela ; kommenteerinud Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Kuigi piimatootmisega tegelevad ettevõtted vajaksid tegevuse arendamiseks hädasti investeeringuid, jäävad enamiku rahastamisplaanid paremaid aegu ootama. Diagramm. Kommenteerivad Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

  8. Slow Food: por um alimento bom, limpo e justo

    OpenAIRE

    Porazzi, Fabiele

    2012-01-01

    REVIEW:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p. RESEÑA:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p. http://dx.doi.org/10.5007/1807-1384.2012v9n1p384 RESENHA:PETRINI, Carlo. Slow Food: princípios da nova gastronomia. Trad. de Renata Lúcia Botina. São Paulo: Editora Senac, 2009. 245 p.

  9. Uhhodjashtshaja natura / Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Hrustaljov, Nikolai

    2006-01-01

    Lõppes 12. Gatshina filmifestival "Kirjandus ja Kino". Režissöör Rustam Hamdamovist ja tema filmist "Vokaalsed paralleelid", stsenarist Renata Litvinova : Kasahstan 2005, võitjatest, huvitavamatest filmidest, festivalikülalistest

  10. Southern African Linguistics and Applied Language Studies - Vol 29 ...

    African Journals Online (AJOL)

    A grammatical analysis of the spontaneous L2 English use of schizophrenic bilinguals compared to typical bilinguals · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mathilda Smit, Simone Conradie, Renata Schoeman ...

  11. Just watching the game ain't enough: striatal fMRI reward responses to successes and failures in a video game during active and vicarious playing.

    Science.gov (United States)

    Kätsyri, Jari; Hari, Riitta; Ravaja, Niklas; Nummenmaa, Lauri

    2013-01-01

    Although the multimodal stimulation provided by modern audiovisual video games is pleasing by itself, the rewarding nature of video game playing depends critically also on the players' active engagement in the gameplay. The extent to which active engagement influences dopaminergic brain reward circuit responses remains unsettled. Here we show that striatal reward circuit responses elicited by successes (wins) and failures (losses) in a video game are stronger during active than vicarious gameplay. Eleven healthy males both played a competitive first-person tank shooter game (active playing) and watched a pre-recorded gameplay video (vicarious playing) while their hemodynamic brain activation was measured with 3-tesla functional magnetic resonance imaging (fMRI). Wins and losses were paired with symmetrical monetary rewards and punishments during active and vicarious playing so that the external reward context remained identical during both conditions. Brain activation was stronger in the orbitomedial prefrontal cortex (omPFC) during winning than losing, both during active and vicarious playing. In contrast, both wins and losses suppressed activations in the midbrain and striatum during active playing; however, the striatal suppression, particularly in the anterior putamen, was more pronounced during loss than win events. Sensorimotor confounds related to joystick movements did not account for the results. Self-ratings indicated losing to be more unpleasant during active than vicarious playing. Our findings demonstrate striatum to be selectively sensitive to self-acquired rewards, in contrast to frontal components of the reward circuit that process both self-acquired and passively received rewards. We propose that the striatal responses to repeated acquisition of rewards that are contingent on game related successes contribute to the motivational pull of video-game playing.

  12. Perforated Peptic Ulcer: Different Ethnic, Climatic and Fasting Risk Factors for Morbidity in Al-Ain Medical District, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Fawaz Chikh Torab

    2009-04-01

    Conclusion: Patients with dyspeptic symptoms and a history of previous PUD should be considered for prophylactic treatment to prevent ulcer recurrence during prolonged daytime fasting in Ramadan, especially during the winter time.

  13. Maastikusõiduk UTV aitab tööd teha ja lõõgastuda / Ain Alvela ; kommenteerinud Tanel Rütman

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Analoogselt ATVga (ingl k All Terrain Vehicle - iga maastiku sõiduk) võib ka UTVd (ingl k Utility Terrain Vehicle - vahend maastikul liikumiseks) käsitleda nii tarbesõidukina väiksemate maatööde tegemiseks või raskestiläbitaval maastikul liikumiseks kui ka lihtsalt adrenaliinilaksu pakkuva meelelahutajana

  14. I've got 99 problems but a phone ain't one: Electronic and mobile health in low and middle income countries.

    Science.gov (United States)

    Kumar, Pratap; Paton, Chris; Kirigia, Doris

    2016-10-01

    Mobile technology is very prevalent in Kenya-mobile phone penetration is at 88% and mobile data subscriptions form 99% of all internet subscriptions. While there is great potential for such ubiquitous technology to revolutionise access and quality of healthcare in low-resource settings, there have been few successes at scale. Implementations of electronic health (e-Health) and mobile health (m-Health) technologies in countries like Kenya are yet to tackle human resource constraints or the political, ethical and financial considerations of such technologies. We outline recent innovations that could improve access and quality while considering the costs of healthcare. One is an attempt to create a scalable clinical decision support system by engaging a global network of specialist doctors and reversing some of the damaging effects of medical brain drain. The other efficiently extracts digital information from paper-based records using low-cost and locally produced tools such as rubber stamps to improve adherence to clinical practice guidelines. By bringing down the costs of remote consultations and clinical audit, respectively, these projects offer the potential for clinics in resource-limited settings to deliver high-quality care. This paper makes a case for continued and increased investment in social enterprises that bridge academia, public and private sectors to deliver sustainable and scalable e-Health and m-Health solutions. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  15. Mööbel vajab nišše ja ekspordiauke. Vallutamist ootab vana Euroopa / Ain Alvela ; kommenteerinud Ari Lustila, Heido Vitsur, Priit Tamm

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Olukorrast mööbliturul: edukamad on olnud korpusmööbliga tegelevad ettevõtted. Arvamust avaldavad ASi Suwem turundusjuht Mart Nilson ja OÜ Bellus Furnitur tootmisjuht Rolf Kristian Relander. Diagrammid

  16. The atomic world spooky? It ain't necessarily so! emergent quantum mechanics, how the classical laws of nature can conspire to cause quantum-like behaviour

    CERN Document Server

    van Holten, Theo

    2017-01-01

    The present book takes the discovery that quantum-like behaviour is not solely reserved to atomic particles one step further. If electrons are modelled as vibrating droplets instead of the usually assumed point objects, and if the classical laws of nature are applied, then exactly the same behaviour as in quantum theory is found, quantitatively correct! The world of atoms is strange and quantum mechanics, the theory of this world, is almost magic. Or is it? Tiny droplets of oil bouncing round on a fluid surface can also mimic the world of quantum mechanics. For the layman - for whom the main part of this book is written - this is good news. If the everyday laws of nature can conspire to show up quantum-like phenomena, there is hope to form mental pictures how the atomic world works. The book is almost formula-free, and explains everything by using many sketches and diagrams. The mathematical derivations underlying the main text are kept separate in a -peer reviewed - appendix. The author, a retired professor ...

  17. Mars ain't the kind of place to raise your kid: ethical implications of pregnancy on missions to colonize other planets.

    Science.gov (United States)

    Schuster, Haley; Peck, Steven L

    2016-12-01

    The colonization of a new planet will inevitably bring about new bioethical issues. One is the possibility of pregnancy during the mission. During the journey to the target planet or moon, and for the first couple of years before a colony has been established and the colony has been accommodated for children, a pregnancy would jeopardize the safety of the crew and the wellbeing of the child. The principal concern with a pregnancy during an interplanetary mission is that it could put the entire crew in danger. Resources such as air, food, and medical supplies will be limited and calculated to keep the crew members alive. We explore the bioethical concerns of near-future space travel.

  18. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    Index Scriptorium Estoniae

    2006-01-01

    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  19. Õnnistus : [luuletused] / Charles Baudelaire ; tlk. Johannes Semper, Ants Oras, August Sang, Ilmar Laaban, Ain Kaalep, Indrek Hirv, Jaan Kross

    Index Scriptorium Estoniae

    Baudelaire, Charles, 1821-1867

    2006-01-01

    Sisu: Õnnistus ; Albatross ; Ülenemine ; Vastavusi ; Kutse teekonnale ; Muusika ; Elav tungal ; Vaenlane ; Ebaõnn ; Mees ja meri ; Ilu ; Hiigelnaine ; Hümn ilule ; Kalliskivid ; Eksootiline lõhn ; Raibe ; Vampiir ; Pihtimus ; Kass ; Mis ütled, vaene hing ; Lõhnapudel ; Sume laotus ; Kutse teele ; Sügissonett ; Öökullid ; Olematuse maitse ; Spliin : "Mu mälestuste last on nii painajalik..." ; Spliin : "Ma olen nii kui vürst, vürst sajulisel maal..." ; Mõrane kell ; "Nagu põhjatu taevas, öös tummuv ja mustav..." ; Kell ; Maastik ; Päike ; Punajuukselisele kerjustüdrukule ; Luik ; Hämarus ; Mäng ; Somp ja udud ; Pariisi unenägu ; Hommikuhämarik ; Üksildaste vein ; Üks märtritar ; Beatrice ; Aabel ja Kain ; Armastajate surm ; Vaeste surm ; Matk ; Lunahind ; Ühe pilgu lubadused. Eluloolisi andmeid autori kohta lk. 703

  20. Kuidas on läinud vene koolide eestikeelsele aineõppele üleminek? / Natalja Lapikova, Vjatšeslav Gussarov, Irene Käosaar

    Index Scriptorium Estoniae

    Lapikova, Natalja

    2008-01-01

    Küsimusele vastavad Tallinna Haridusameti hariduskorralduse teenistuse üldhariduse osakonna vanemspetsialist Natalja Lapikova, Tallinna Kesklinna Vene Gümnaasiumi direktor Vjatšeslav Gussarov ja HTM-i rahvusvähemuste hariduse osakonna juhataja Irene Käosaar

  1. 'It ain't what you do it's the way that you do it': lessons for health care from decommissioning of older people's services.

    Science.gov (United States)

    Robinson, Suzanne; Glasby, Jon; Allen, Kerry

    2013-11-01

    Public sector organisations are facing one of the most difficult financial periods in history and local decision-makers are tasked with making tough rationing decisions. Withdrawing or limiting services is an emotive and complex task and something the National Health Service has always found difficult. Over time, local authorities have gained significant experience in the closure of care homes - an equally complex and controversial issue. Drawing on local knowledge and best practice examples, this article highlights lessons and themes identified by those decommissioning care home services. We believe that such lessons are relevant to those making disinvestment decisions across public sector services, including health-care. The study employed semi-structured interviews with 12 Directors of Adult Social Services who had been highlighted nationally as having extensive experience of home closures. Interviews were conducted over a 2-week period in March 2011. Results from the study found that having local policy guidance that is perceived as fair and reasonable was advocated by those involved in home closures. Many local policies had evolved over time and had often been developed following experiences of home closures (both good and bad). Decisions to close care home services require a combination of strong leadership, clear strategic goals, a fair decision-making process, strong evidence of the need for change and good communication, alongside wider stakeholder engagement and support. The current financial challenge means that public sector organisations need to make tough choices on investment and disinvestment decisions. Any such decisions need to be influenced by what we know constitutes best practice. Sharing lessons and experiences within and between sectors could well inform and develop decision-making practices. © 2013 John Wiley & Sons Ltd.

  2. Ehitusmaavarad ümber puhkes poliitiline kemplemine. Ettevõtjad loodavad kindlust tuleviku ees / Ain Alvela ; kommenteerinud Veljo Haube ja Enno Reinsalu

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Valitsus on kinnitanud ehitusmaavarade arengukava aastani 2020 ja sinna on sisse kirjutatud ka Nabala karstiala lubjakivivarud, kuigi enne 6. märtsil toimunud parlamendivalimisi oli lubatud, et need jäetakse arengukavast välja. Tõstetakse ka ressursitasusid

  3. Kõrghoone "Tower" Tallinnas, Tartu mnt. ja Pääsukese tänava nurgal. Projekt, 1996. Arhitektid Vilen Künnapu ja Ain Padrik

    Index Scriptorium Estoniae

    1997-01-01

    32-korruselise torni neljal esimesel korrusel on kaubamaja, järgmisel viiel korrusel parkla, siis tehnilise korruse järel on 14 korrusel bürooruumid, seejärel viiel korrusel korterid, järgnevastel korrustel bürood, restoran, baar jm.

  4. It Don't Mean a Thing if It Ain't Got Musicality: A Music-First Method for Teaching Historically Rooted Jazz Dance

    Science.gov (United States)

    Liebhard, Erinn

    2015-01-01

    This article proposes a method for teaching jazz dance technique according to music concepts and prioritizing deep embodiment of music. This method addresses what can be seen as a disconnect between current practices and historical understanding in jazz dance today, a gap that can be bridged with education empowering students to make innovative…

  5. Interacción analgésica entre antiinflamatorios no esteroideos (AINES) y opiáceos durante la anestesia inhalatoria en la rata

    OpenAIRE

    Benito de la Víbora, Javier

    2016-01-01

    La reducción de las necesidades de anestésicos inhalatorios mediante la coadministración de analgésicos intraoperatorios conlleva un incremento del margen de seguridad del paciente pero también una disminución de la polución ambiental y una reducción de costes. La combinación de diferentes tipos de analgésicos puede incrementar dicho efecto ahorrador de anestésico e incluso se ha observado un efecto potenciador derivado de la administración conjunta con de inhibidores de la ciclooxigenasa (CO...

  6. "That Ain't No Ninja Turtles": The Prevalence and Influence of Popular Culture in the Talk and Writing of Prekindergarten Children

    Science.gov (United States)

    Kissel, Brian T.

    2011-01-01

    This article describes how 2 classrooms of 4-year-old children incorporated popular media (cartoons, television shows, video games, movies, and music) into their conversations with peers during writing. The findings assert that (a) children naturally incorporate popular culture into their writing, (b) children include popular culture in their…

  7. I Ain't Gonna Make It. Comparing Job Demands-Resources and Attrition Intention Between Senior Teachers and Senior Employees of Six Other Occupational Categories in Flanders.

    Science.gov (United States)

    Van Droogenbroeck, Filip; Spruyt, Bram

    2016-07-01

    Teachers are often thought to retire early and have more stress and burnout than other human service professionals. In this article, we investigate attrition intention amongst senior teachers and senior employees of six other blue- and white-collar occupational categories using the Job Demands-Resources (JD-R) model. We followed a two-step approach. First, analysis of variance and logistic regression analysis was used to assess differences in the level of job demands, resources, and attrition intention between occupations for male and female employees separately. Subsequently, multiple group path analysis was used to assess the invariance of the JD-R model across occupational groups and genders. We used representative data gathered in Flanders among 6,810 senior employees (45 years or older). Results indicate that there are differences in the determinants of attrition intention between men and women. The differences in attrition intention are minimal between occupations once controlled for job demands and resources. In addition, the JD-R model is largely invariant across white-collar occupations and gender. We provide support for both the energetic and motivational process of the JD-R model. © The Author(s) 2016.

  8. A nickel ain't worth a dime anymore: the illusion of money and the rapid encoding of its true value.

    Directory of Open Access Journals (Sweden)

    Rongjun Yu

    Full Text Available People often evaluate money based on its face value and overlook its real purchasing power, known as the money illusion. For example, the same 100 Chinese Yuan can buy many more goods in Tibet than in Beijing, but such difference in buying power is usually underestimated. Using event related potential combined with a gambling task, we sought to investigate the encoding of both the real value and the face value of money in the human brain. We found that the self-reported pleasantness of outcomes was modulated by both values. The feedback related negativity (FRN, which peaks around 250ms after feedback and is believed to be generated in the anterior cingulate cortex (ACC, was only modulated by the true value but not the face value of money. We conclude that the real value of money is rapidly encoded in the human brain even when participants exhibit the money illusion at the behavioral level.

  9. Mass movement susceptibility mapping - A comparison of logistic regression and Weight of evidence methods in Taounate-Ain Aicha region (Central Rif, Morocco

    Directory of Open Access Journals (Sweden)

    JEMMAH A I

    2018-01-01

    Full Text Available Taounate region is known by a high density of mass movements which cause several human and economic losses. The goal of this paper is to assess the landslide susceptibility of Taounate using the Weight of Evidence method (WofE and the Logistic Regression method (LR. Seven conditioning factors were used in this study: lithology, fault, drainage, slope, elevation, exposure and land use. Over the years, this site and its surroundings have experienced repeated landslides. For this reason, landslide susceptibility mapping is mandatory for risk prevention and land-use management. In this study, we have focused on recent large-scale mass movements. Finally, the ROC curves were established to evaluate the degree of fit of the model and to choose the best landslide susceptibility zonation. A total mass movements location were detected; 50% were randomly selected as input data for the entire process using the Spatial Data Model (SDM and the remaining locations were used for validation purposes. The obtained WofE’s landslide susceptibility map shows that high to very high susceptibility zones contain 62% of the total of inventoried landslides, while the same zones contain only 47% of landslides in the map obtained by the LR method. This landslide susceptibility map obtained is a major contribution to various urban and regional development plans under the Taounate Region National Development Program.

  10. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Index Scriptorium Estoniae

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  11. Your blues ain't like mine: considering integrative antiracism in HIV prevention research with black men who have sex with men in Canada and the United States.

    Science.gov (United States)

    Nelson, LaRon E; Walker, Ja'Nina J; DuBois, Steve N; Giwa, Sulaimon

    2014-12-01

    Evidence-based interventions have been developed and used to prevent HIV infections among black men who have sex with men (MSM) in Canada and the United States; however, the degree to which interventions address racism and other interlocking oppressions that influence HIV vulnerability is not well known. We utilize integrative antiracism to guide a review of HIV prevention intervention studies with black MSM and to determine how racism and religious oppression are addressed in the current intervention evidence base. We searched CINAHL, PsychInfo, MEDLINE and the CDC compendium of evidence-based HIV prevention interventions and identified seventeen interventions. Three interventions targeted black MSM, yet only one intervention addressed racism, religious oppression, cultural assets and religious assets. Most interventions' samples included low numbers of black MSM. More research is needed on interventions that address racism and religious oppression on HIV vulnerability among black MSM. Future research should focus on explicating mechanisms by which multiple oppressions impact HIV vulnerability. We recommend the development and integration of social justice tools for nursing practice that aid in addressing the impacts of racism and other oppressions on HIV vulnerability of black MSM. © 2014 John Wiley & Sons Ltd.

  12. Ėtude sur l’alimentation du poulet de chaire à base du maïs Zenata et Ain kebira

    OpenAIRE

    KENZI, MOHAMMED ZAKARYA; WAHAJ, MOHAMMED

    2016-01-01

    Résume L’aliment représente 70% du cout de production dans l’élevage de poulet de chair, il est donc important d’accorder une attention particulière à ce paramètre. Ce dernier est le premier poste intervenant dans le prix de revient du poulet de chair. La supplémentation de l’aliment du poulet en 2 5% de maïs durant le démarrage et croissance permet aussi de réduire le cout d’élevage et d’améliorer le poids a l’abattage. Study chair of chicken feed made of corn Summ...

  13. It Ain't the Heat, It's the Humanity: Evidence and Implications of a Knowledge-Based Consensus on Man-Made Global Warming

    Science.gov (United States)

    Jacobs, P.; Cook, J.; Nuccitelli, D. A.

    2013-12-01

    One of the most worrisome misconceptions among the general public about climate change is a belief that scientists disagree not only about the cause of the present climate change, but also whether or not the planet is currently warming. Recent surveys have demonstrated that an overwhelming consensus exists, both within the scientific literature and among scientists with climate expertise, that the planet is warming and humans are driving this climatic change. This disconnect, or 'consensus gap', between scientific agreement and public belief has significant consequences for public understanding of the reality and cause of climate change, as well as support for potential solutions. Ensuring that the consensus message is not simply broadcast but is also accepted as legitimate by the public appears to be a primary education and communications opportunity. While the existence of a consensus is not itself evidence of a position's truth, according to Miller (2013) scientific consensus can be taken as evidence that a position is true if it is 'knowledge-based', satisfying the conditions of social calibration, apparent consilience of evidence, and social diversity. We demonstrate that the scientific consensus on anthropogenic climate change is knowledge-based, satisfying Miller's criteria. In so doing, we hope to increase confidence in its use as an education and communications tool, and assure the public of its validity. We show the consensus is socially calibrated, based on common evidential standards, ontological schemes, and shared formalism. We establish that consilience of evidence points overwhelmingly to the reality of anthropogenic climate change by examining the evidence from several perspectives. We identify unique fingerprints expected as a result of increased greenhouse forcing, eliminate potential natural drivers of climate change as the cause of the present change, and demonstrate the consistency of the observed climate response with known changes in natural and manmade forcings across a wide variety of indices. Finally, we determine that the consensus is socially diverse, being geographically and disciplinarily varied, supported within public and private institutions, and endorsed by research organizations as well as groups with obvious financial incentives to deny it, such as fossil fuel companies. Additionally, we briefly discuss examples of purported incorrect consensus in climate research, and detail how they fail to satisfy one or more aspects of Miller's criteria. We conclude by discussing the key role that knowledge-based consensus can potentially play in education, influencing public beliefs about climate change, and increasing support for solutions.

  14. Gene : CBRC-GGOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

  15. Resonance April Cover Pg TP

    Indian Academy of Sciences (India)

    Admin

    word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.

  16. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS

  17. Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men

    NARCIS (Netherlands)

    Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.

    2013-01-01

    Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high

  18. Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

    Directory of Open Access Journals (Sweden)

    Abdulla Aljawder

    2016-01-01

    Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

  19. Download this PDF file

    African Journals Online (AJOL)

    Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

  20. Browse Title Index

    African Journals Online (AJOL)

    AM Quilez, S Montserrat-de la Paz, R De la Puerta, MA Fernandez-Arche, MD Gargia-Gimenez ... Danubia C. Sá-Caputo, Carla da F. Dionello, Éric Heleno F.F. Frederico, Laisa L. Paineiras-Domingos, Cintia Renata Sousa-Gonçalves, Danielle S. Morel, Eloá Moreira-Marconi, Marianne Unger, Mario Bernardo-Filho.

  1. Southern African Linguistics and Applied Language Studies - Vol 27 ...

    African Journals Online (AJOL)

    Bilingualism and psychosis: a linguistic analysis of a patient with differential symptom severity across languages · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Frenette Southwood, Renata Schoeman, Robin Emsley. http://dx.doi.org/10.2989/SALALS.2009.27.2.4.867 ...

  2. Integrated stratigraphy, astronomical dating and proxy records of the Ain el Beida and Loulja sections (NW Morocco). Implications for regional climate change, glacial history and the Messinian Salinity Crisis. Geologica Ultraiectina (324)

    NARCIS (Netherlands)

    van der Laan, E.

    2010-01-01

    This Ph.D. thesis aims to provide a better understanding of the origin of sedimentary colour cycles in the Bou Regreg area in NW Morocco. Sediments were deposited during the late Miocene and early Pliocene at times that the Mediterranean was isolated from the Atlantic during the Messinian salinity

  3. "It Don't Mean a Thing if It Ain't Got that Swing"- an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings.

    Science.gov (United States)

    Richter, Joachim; Ostovar, Roya

    2016-01-01

    The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside (proto-)language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D) as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-)language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Conceivable evolutionary functions of R&D include sexual attraction and transmission of mating signals. Social functions include bonding, synchronization of many individuals, appeasement of hostile individuals, and pre- and extra-verbal communication enabling embodied individual and collective memorizing. In many cultures R&D are used for entering trance, a base for shamanism and early religions. Individual benefits of R&D include improvement of body coordination, as well as painkilling, anti-depressive, and anti-boredom effects. Rhythm most likely paved the way for human speech as supported by studies confirming the overlaps between cognitive and neural resources recruited for language and rhythm. In addition, dance encompasses visual and gestural communication. In future studies attention should be paid to which attribute of music is focused on and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  4. "It don't mean a thing if it ain't got that swing"– an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings

    Directory of Open Access Journals (Sweden)

    Joachim Richter

    2016-10-01

    Full Text Available The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside proto-language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. If this behavior is universal, R&D must have an essential function in human evolution. Conceivable evolutionary functions of R&D include sexual attraction, transmission of mating signals, synchronization of many individuals, social bonding, appeasement of hostile individuals, pre- and extra-verbal communication, improvement of body coordination, as well as pain killing, anti-depressive, and anti-boredom functions. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Dance enables embodied individual and collective memorizing; in many cultures R&D are used for entering trance, a base for shamanism and early religions. Rhythm is necessary to codify human speech and dance encompasses gesture. In future studies attention should be paid to which attribute of music is focused and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  5. If It Ain't Broke, Why Fix It? Framework and Processes for Engaging in Constructive Institutional Development and Renewal in the Context of Increasing Standards, Assessments, and Accountability for University-Based Teacher Preparation

    Science.gov (United States)

    Lit, Ira; Nager, Nancy; Snyder, Jon David

    2010-01-01

    In this article, the authors offer a descriptive essay outlining the framework and processes of a five-year institutional renewal effort at Bank Street College of Education. Extended the opportunity to participate in the "Teachers for a New Era" (TNE) initiative, a multi-year, multi-million dollar effort to enhance and "radically…

  6. Cultural tourism 2011 - Projekt Central Baltic INTERREGIV A Project Cultural Tourism 2011 - Developing cultural tourism as a joint network in Capitals of Culture 2011 võtab kokku ja plaanib jätku / Maritta Hiltunen, Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2012-01-01

    Soome organisatsiooni Matkailun ja elämystuotannon osaamisklusteri (OSKE) algatatud koostööprojektist Tallinna ja Turu kultuuripealinna vahel, mille laiem eesmärk on edendada Läänemere regiooni kultuuriturismi alast koostööd ning luua Läänemere regiooni hõlmav kultuuriturismi bränd

  7. Stiiliharjutused / Raymond Queneau ; prantsuse k. tlk. Jana Porila, värsstekstid tlk. Ain Kaalep, Toim. Hasso Krull, Järelsõna: M. V. [Märt Väljataga

    Index Scriptorium Estoniae

    Queneau, Raymond

    1995-01-01

    Sisu: Märkmed; Kahekordselt; Litootes; Metafoorselt; Tagasivaateline; Üllatused; Unenägu; Prognoosid; Vikerkaar; Kõhklused; Täpsustused; Subjektiivne pool; Teistpidi isiklik; Jutustus; Liitsõnad; Eitus; Animism; Anagrammid; Ametlik kiri; Annotatsioon; Teadmatus; Aleksandriinid; Mina igatahes; Hüüatused; Ja siis; Ülev; Ülekuulamine; Komöödia; Vahelaused; Kummituslik; Kõnetlus; Sonett; Gustatiivne; Taktiilne; Telegraafiline; Tanka; Kirjeldus; Hüüdsõnad; Ootamatu

  8. Uudised : Vello Pähn Savonlinnas. Eri Klas pärast juubelit. Ain Anger Mirjam Helini konkursil. Türnpu sünnipäevakontsert / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    V. Pähn dirigeeris Savonlinna ooperifestivalil Gounod" ooperit "Faust". E.Klas erinevate orkestrite ees juuni-september 1999. 8.-20. augustini Helsingis toimunud IV rahvusvahelisest M. Helini konkursist, kus osales A. Anger. 13.augustil tähistati K. Türnpu 134. sünniaastapäeva kontserdiga Tuulna külas Keila vallas

  9. MR imaging findings of anterior interosseous nerve lesions

    Energy Technology Data Exchange (ETDEWEB)

    Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)

    2007-12-15

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  10. MR imaging findings of anterior interosseous nerve lesions

    International Nuclear Information System (INIS)

    Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.

    2007-01-01

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  11. "Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

  12. Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

    LENUS (Irish Health Repository)

    Garvey, J P

    2009-11-01

    Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

  13. Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR

  14. Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

  15. Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

  16. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...

  17. Kaks debüüti / Lilian Vellerand

    Index Scriptorium Estoniae

    Vellerand, Lilian, 1932-

    1997-01-01

    "Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

  18. Los costes socioeconómicos y la calidad de vida relacionada con la salud en pacientes con enfermedades raras en España, de López Bastida, J. et al.

    Directory of Open Access Journals (Sweden)

    SIIS Centro de Documentación y Estudios

    2013-07-01

    Full Text Available Reseña de la obra 'Los costes socioeconómicos y la calidad de vida relacionada con la salud en pacientes con enfermedades raras en España' (2012 de Julio López Bastida, Renata Linertová, Pedro Serrano Aguilar, Manuel Hens Pérez, Manuel Posada de la Paz y Juan Oliva Moreno.

  19. Imaging and Molecular Markers for Patients with Lung Cancer: Approaches with Molecular Targets, Complementary/Innovative Treatment, and Therapeutic Modalities

    Science.gov (United States)

    2011-02-01

    Therapeutic and Imaging Agents to Lung Cancer (PI and co-PI: Renata Pasqualini , Ph.D., Wadih Arap, M.D., Ph.D.) The studies outlined in this proposal...with Drs. Pasqualini , Arap, and Wistuba. The IHC staining of lung cancer TMAs (390 cases) has been completed. We are working with investigators to...Project 3, R. Pasqualini ). This project was completed and a manuscript is in preparation by Dr. Pasqualini’s lab. b) Molecular abnormalities

  20. One lesion, one virus: individual components of high-grade anal intraepithelial neoplasia in HIV-positive men contain a single HPV type

    NARCIS (Netherlands)

    Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.

    2014-01-01

    High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  2. Pärast kõike / intervjueerinud Veiko Märka

    Index Scriptorium Estoniae

    1998-01-01

    Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

  3. Teatrilugu nendest, kes teatris ei käi / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2000-01-01

    Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist

  4. Hypothyroidism could be the only manifestation of mitochondrial ...

    African Journals Online (AJOL)

    Hoda Tomoum

    2012-11-24

    Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...

  5. Exegi monumentum ehk palee Tallinnas / Siim Sultson

    Index Scriptorium Estoniae

    Sultson, Siim

    2007-01-01

    Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

  6. "É muito dificultoso!": etnografia dos cuidados a pacientes com hipertensão e/ou diabetes na atenção básica, em Manaus, Amazonas, Brasil "It sure ain't easy!": an ethnographic study of primary health care for patients with hypertension and/or diabetes in Manaus, Amazonas State, Brazil

    Directory of Open Access Journals (Sweden)

    Maximiliano Loiola Ponte de Souza

    2008-01-01

    Full Text Available O texto analisa os resultados de pesquisa avaliativa da Atenção Básica à Saúde do paciente com hipertensão e/ou diabetes em Manaus, Amazonas, Brasil. A abordagem etnográfica utilizou, como categorias analíticas centrais, o acesso aos serviços e a integralidade do cuidado, comparando-se as práticas sanitárias desenvolvidas em unidade do Programa Saúde da Família (PSF e em unidade básica de saúde não-PSF. A facilitação do acesso à unidade de saúde da família implantada em comunidade carente é limitada pela precariedade de infra-estrutura urbana do seu entorno. A unidade básica de saúde tem, nas grandes distâncias, a sua principal barreira de acesso. A inexistência de sistema de referência entre os distintos níveis de complexidade compromete o acesso dos pacientes a exames e especialistas. O cuidado oferecido nas duas unidades é restrito às queixas físicas passíveis de abordagem farmacológica, comprometendo a integralidade. Há baixa capacidade de escuta dos profissionais para problemas distintos do foco da ação programática. Destacam-se as potencialidades da utilização da etnografia na pesquisa avaliativa de sistemas e serviços de saúde.This paper analyzes the results of an evaluative study in the city of Manaus, Amazonas State, Brazil, on primary health care for patients with hypertension and/or diabetes. The ethnographic approach used access to services and comprehensiveness of health care as core analytical categories, comparing the health practices developed by Family Health Program (FHP units with traditional non-FHP primary care units. Access to family health care units in low-income communities is limited by the precarious surrounding urban infrastructure. The main barrier to access to primary care units is distance. The lack of a referral system between the various levels of complexity jeopardizes patients' access to tests and specialists. The care supplied by the two units is limited to patient conditions that can be treated pharmacologically, thus compromising the comprehensiveness of care. The health professionals display a limited capacity to hear problems outside the immediate focus of the program activity. The paper highlights the potential for using ethnography in evaluative research on health systems and services.

  7. TiC含量和烧结工艺对AlN-TiC复相陶瓷烧结性能的影响%Effect of TiC Content and Sintering Process on Sintering Properties of AIN-SiC Composite Ceramics

    Institute of Scientific and Technical Information of China (English)

    程卫华

    2012-01-01

    Taking A1N and TiC as raw materials, the A1N-TiC composite ceramics were prepared by hot pressing sintering process, and the effects of TiC content and sintering process on sintering properties of A1N-SiC composite ceramics were studied. The results show that the composite ceramics didnlt generate new phase and consisted of A1N and TiC phases during sintering. The compact composite ceramics could be prepared after sintering at 1 900 ℃ for 1 h, the relative density reached more than 99%and the TiC content had no effect on sintering properties of the composite ceramics.%以A1N和TiC粉为原料,采用热压烧结工艺制备AlN-TiC复相陶瓷,研究了TiC含量、烧结工艺对复相陶瓷烧结性能的影响。结果表明:在烧结过程中复相陶瓷没有新相生成,由AlN和TiC两相组成;在1900℃下烧结1h后,可以制备出致密的A1N-TiC复相陶瓷,其相对密度达到了99%以上,TiC的加入量对复相陶瓷的烧结性能无影响。

  8. Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability

    Science.gov (United States)

    Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.

    2014-01-01

    SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970

  9. Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram

    Directory of Open Access Journals (Sweden)

    Irfan Moinuddin

    2015-01-01

    Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.

  10. Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

    Science.gov (United States)

    Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

    2012-04-01

    Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

  11. Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

    Science.gov (United States)

    Lee, Su Young; Kim, Sang Ho

    2014-12-01

    The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

  12. Hydrogeological and isotopic studies for selected springs in Sinai Peninsula

    Energy Technology Data Exchange (ETDEWEB)

    Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)

    1995-10-01

    This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.

  13. Asociación entre el consumo de antiinflamatorios no esteroideos y la aparición o descompensación de insuficiencia cardíaca congestiva : estudio de casos y controles

    OpenAIRE

    Rodríguez Bernardino, Ángel

    2003-01-01

    La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...

  14. Spies, Assassins, and Statesmen in Mexico’s Cold War

    Directory of Open Access Journals (Sweden)

    Wil G. Pansters

    2017-06-01

    Full Text Available Book Review Essay Eclipse of the Assassins. The CIA, Imperial Politics, and the Slaying of Mexican Journalist Manuel Buendía, by Russell H. Bartley and Sylvia Erickson Bartley. University of Wisconsin Press, 2015. Mexico’s Cold War. Cuba, the United States, and the Legacy of the Mexican Revolution, by Renata Keller. Cambridge University Press, 2015. The Logic of Compromise in Mexico. How the Countryside Was Key to the Emergence of Authoritarianism, by Gladys I. McCormick. The University of North Carolina Press, 2016.

  15. Wpływ ilości spożywanych posiłków na wartość wskaźnika BMI = Influence amount of food meals for BMI

    OpenAIRE

    Nalepa, Dorota; Weber, Dorota; Rogala, Renata; Charzyńska-Gula, Marianna

    2016-01-01

    Nalepa, Dorota, Weber, Dorota, Rogala, Renata, Charzyńska-Gula, Marianna. Wpływ ilości spożywanych posiłków na wartość wskaźnika BMI = Influence amount of food meals for BMI. Journal of Education, Health and Sport. 2016;6(3):48-61. eISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.47438 http://ojs.ukw.edu.pl/index.php/johs/article/view/3400 https://pbn.nauka.gov.pl/works/719646 The journal has had 7 points in Ministry of Science and Higher Education parametric evaluation...

  16. Effectiveness of carboxytherapy in the treatment of cellulite in healthy women: a pilot study

    OpenAIRE

    Sant'Ana, Estela Maria Correia; Pianez,Luana Ramalho Gomes; Custódio,Fernanda Silva; Guidi,Renata Michelini; de Freitas,Jauru Nunes

    2016-01-01

    Luana Ramalho Pianez,1 Fernanda Silva Custódio,1 Renata Michelini Guidi,1-4 Jauru Nunes de Freitas,5-7 Estela Sant’Ana8-10 1Ibramed Center for Education and Advanced Training (CEFAI), Amparo, 2Santa Casa de Misericórdia Hospital, Porto Alegre, 3University of Campinas, Campinas, 4Ibramed Research and Development Department, Amparo, São Paulo, Brazil; 5Universitá Tor Vergata, Rome, Italy; 6Centro de Medicina Pesquisa e Ensino (CEMEPE), Belo ...

  17. Herrens röst

    DEFF Research Database (Denmark)

    Rösing, Lilian Munk

    2015-01-01

    Om språket är gränsen mellan djur och människor, vad innebär det när hundar talar? I filmen Upp pratar de animerade hundarna, men med sin husses röst. Lilian Munk Rösing ser filmen i sällskap av bland andra Jacques Lacan, Slavoj Žižek och Renata Salecl och finner en röst utan kropp, en kropp besj...

  18. AFOSR Chemistry Program Review FY-79 (24th).

    Science.gov (United States)

    1980-03-01

    made can be found in the "EOARD Quarterly Highlights." NEW PROJECTS An exciting new project in the field of multi-component glasses for optical...fibers was begun with Professor Renata Reisfeld at the Hebrew University of Jerusalem. Purpose of the study is to develop multi-component glass which will...have a high transparency in the 0.8 to 1.5 Um region of the spectrum. Combinations of oxides such as Si02, B20 3 , P 205 , GeO2 and TeO2 with alkali

  19. In situ EELS and TEM observation of Al implanted with nitrogen ions

    International Nuclear Information System (INIS)

    Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

    1995-01-01

    Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

  20. Drug Allergy

    African Journals Online (AJOL)

    EL-HAKIM

    Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.

  1. President Meri annetas aumärke

    Index Scriptorium Estoniae

    1996-01-01

    Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele

  2. Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

    Index Scriptorium Estoniae

    Ivanov, Sergei, 1958-

    2005-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

  3. Materjalide jagamisest võidavad kõik / Maarja Soone

    Index Scriptorium Estoniae

    Soone, Maarja

    2011-01-01

    Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

  4. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2006-01-01

    Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

  5. Sekulariseeruv sakraalarhitektuur / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2002-01-01

    Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

  6. Dgroup: DG00804 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic

  7. Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

    Index Scriptorium Estoniae

    2008-01-01

    Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

  8. 9. II avati taas von Krahli Akna galerii

    Index Scriptorium Estoniae

    2004-01-01

    Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

  9. Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma

    Index Scriptorium Estoniae

    Aarma, Jüri, 1951-

    2010-01-01

    Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike

  10. Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2000-01-01

    Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

  11. Pap smears for men: a vision of the future?

    LENUS (Irish Health Repository)

    Oon, S F

    2012-02-01

    BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

  12. Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

    Index Scriptorium Estoniae

    Varju, Peep

    2008-01-01

    Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

  13. Ainevaldkond "Kehakultuur" / Leila Oja

    Index Scriptorium Estoniae

    Oja, Leila, 1966-

    2006-01-01

    Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid

  14. Bez kota mõsham razdolje / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2004-01-01

    Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme

  15. Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous

  16. Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2007-01-01

    Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

  17. Neurofibromatosis type 1 and multiple sclerosis: Genetically related ...

    African Journals Online (AJOL)

    Solaf M. Elsayed

    2016-10-25

    Oct 25, 2016 ... a Genetics Unit, Children's Hospital, Ain Shams University, Egypt b Neurology Department ... Through the past 6 months, she started to develop short term memory loss with intact long term memory. There was no other motor ...

  18. Rector's office as of 31 December 2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  19. Rector's office as of 31 December 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  20. Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Hongxing

    2008-10-31

    Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

  1. Structural and frequency dependencies of a.c. and dielectric ...

    Indian Academy of Sciences (India)

    6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.

  2. Dgroup: DG01675 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl

  3. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2006-01-01

    Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

  4. Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2003-01-01

    Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

  5. Plaat

    Index Scriptorium Estoniae

    2008-01-01

    Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

  6. Analytical solutions for one-dimensional advection– dispersion ...

    Indian Academy of Sciences (India)

    Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...

  7. Spielpläne

    Index Scriptorium Estoniae

    2007-01-01

    Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

  8. ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik

    Index Scriptorium Estoniae

    Vetik, Anne

    2006-01-01

    Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video

  9. Download this PDF file

    African Journals Online (AJOL)

    Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...

  10. Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

    Index Scriptorium Estoniae

    Leijen, Äli, 1979-

    2013-01-01

    Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

  11. Sumerki klassitsizma / Iosef Kats

    Index Scriptorium Estoniae

    Kats, Iosef

    2004-01-01

    Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri

  12. Алексий II 1929-2008

    Index Scriptorium Estoniae

    2008-01-01

    Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

  13. Mis saab maaärist? / Ester Šank

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2000-01-01

    Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

  14. Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

  15. AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2011-01-01

    2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

  16. Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli

    Index Scriptorium Estoniae

    Fontanelli, Fillippo

    2017-01-01

    Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga

  17. Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil

    Index Scriptorium Estoniae

    2007-01-01

    Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann

  18. Disease: H00536 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta

  19. Download this PDF file

    African Journals Online (AJOL)

    rme

    1Medical Genetic Center, Faculty of Medicine, Ain Shams University,. 2Community ... indications for amniocentesis in 60.8% were history of having previous child .... best location for placing the needle ..... leukemia, 8.5% for neural tube defects.

  20. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2005-01-01

    Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

  1. Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman

    Index Scriptorium Estoniae

    Tooman, Artur, 1971-

    2006-01-01

    Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta

  2. Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

    Index Scriptorium Estoniae

    Marx, Karl

    2000-01-01

    Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

  3. Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2001-01-01

    Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

  4. Vene elu hõng Pilistvere rehealuses / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2008-01-01

    Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar

  5. Meie igapäevane paanika / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2007-01-01

    Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

  6. R102G polymorphism of the complement component 3 gene in ...

    African Journals Online (AJOL)

    Nur Afiqah Mohamad

    a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.

  7. deletion polymorphism of ACE gene and Alzheimerв€™s disease

    African Journals Online (AJOL)

    Omayma M. Hassanin

    2014-06-27

    Jun 27, 2014 ... ease, 45 males and 39 females aged 65 ± 7 years from the Geriatric Department at Ain-Shams Uni- ..... alternative therapy provided by the ACE protein. .... enzyme (ACE) gene polymorphism in relation to physical perfor-.

  8. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  9. Ohtlikud lennud / Simo Meinert

    Index Scriptorium Estoniae

    Meinert, Simo

    2006-01-01

    ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill

  10. Itaalia seadustab ainuõige pitsa / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2004-01-01

    Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 149 ... ... of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic ... Vol 15, No 1 (2017), Gastrointestinal manifestations in children ... Vol 6, No 1 (2008), Immunogenetics of type 1 diabetes mellitus, Abstract PDF.

  12. Automating the AFROTC Four-Year Scholarship Program.

    Science.gov (United States)

    1986-04-01

    ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95

  13. [Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2011-01-01

    Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

  14. Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook

    Index Scriptorium Estoniae

    Jõõts, Hillar

    2005-01-01

    Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega

  15. Rektoraat seisuga 31.12. 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  16. Rektoraat seisuga 31.12.2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  17. Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg

    Index Scriptorium Estoniae

    Kalberg, Signe, 1959-

    2006-01-01

    Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut

  18. Lugedes Pilve ja Pazi / Mathura

    Index Scriptorium Estoniae

    Mathura, pseud., 1973-

    2007-01-01

    Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

  19. Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

    Index Scriptorium Estoniae

    Iir Hermeliin, pseud., 1973-

    2000-01-01

    Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

  20. Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...

    African Journals Online (AJOL)

    Acer

    3 Institute of Earth and Environmental Science, University of Potsdam, ... Some beaches are characterized by a red-brownish sand colour, the Ain Achir and the ... The occurrence of clays has been determined using the methyl-blue method.

  1. Moroz i rozõ / Lev Livshits

    Index Scriptorium Estoniae

    Лившиц, Лев, 1924-2013

    2006-01-01

    Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

  2. Challenges in diagnosis and counseling of a family with two ...

    African Journals Online (AJOL)

    Heba S. Abd-Elkhalek

    2015-12-29

    Dec 29, 2015 ... Genetics Unit, Childrens' Hospital, Ain Shams University, Cairo, Egypt. Available online 29 ... normal milestones of development in the first 6 months of life .... most important clue in family history that indicated the pres- ence of ...

  3. Dual-sided electrosurgery handpiece for simultaneous tissue cutting and coagulation: first report on a conceptual design validated by an animal experiment

    OpenAIRE

    Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad

    2015-01-01

    Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...

  4. Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

    International Nuclear Information System (INIS)

    Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.

    1997-01-01

    A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

  5. Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

    Directory of Open Access Journals (Sweden)

    Juan Villa

    2014-11-01

    Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

  6. Teatriekspressiga Äksist Põltsamaale / Riina Mägi

    Index Scriptorium Estoniae

    Mägi, Riina, 1957-

    2007-01-01

    Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)

  7. Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

    LENUS (Irish Health Repository)

    Mansur, Abdurrezagh

    2011-01-01

    Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

  8. Colonic aberrant crypt formation accompanies an increase of opportunistic pathogenic bacteria in C57BL/6 mice fed a high-fat diet.

    Science.gov (United States)

    Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R

    2018-04-01

    The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.

  9. Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

    Index Scriptorium Estoniae

    Mäe, Aarne, 1967-

    2008-01-01

    7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

  10. Pose de la première pierre du bâtiment SMA18 du Cern

    CERN Multimedia

    CERN Press Office. Geneva

    1999-01-01

    On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.

  11. Acute interstitial nephritis with acetaminophen and alcohol intoxication

    Directory of Open Access Journals (Sweden)

    Alexopoulou Iakovina

    2011-04-01

    Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

  12. Wireless intelligent network: infrastructure before services?

    Science.gov (United States)

    Chu, Narisa N.

    1996-01-01

    The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.

  13. Fractal dimension and image statistics of anal intraepithelial neoplasia

    International Nuclear Information System (INIS)

    Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.

    2011-01-01

    Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

  14. Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)

    Institute of Scientific and Technical Information of China (English)

    L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara

    2004-01-01

    Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.

  15. Determination of aluminium nitride or free nitrogen in low carbon steel

    International Nuclear Information System (INIS)

    Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.

    2001-01-01

    As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by

  16. Graphene–poly(5-aminoindole) composite film as Pt catalyst support for methanol electrooxidation in alkaline medium

    International Nuclear Information System (INIS)

    Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun

    2013-01-01

    Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells

  17. Ressources et partage de l'eau dans l'oasis de Kenadsa (Sud-Ouest Algerien; approche historique et constat

    Directory of Open Access Journals (Sweden)

    YOUCEF BENMOUSSA

    2015-07-01

    Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..

  18. Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    1999-01-01

    Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998

  19. AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu

    Directory of Open Access Journals (Sweden)

    Dr. Junaid Akbar

    2017-01-01

    Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules

  20. Avaliação do perfil antiinflamatório e analgésico, e dos efeitos colaterais da administração oral de meloxicam em equinos: avaliação física, laboratorial e gastroscópica

    OpenAIRE

    Veronezi, Regina de Cássia [UNESP

    2007-01-01

    Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...

  1. GW182-Free microRNA Silencing Complex Controls Post-transcriptional Gene Expression during Caenorhabditis elegans Embryogenesis.

    Directory of Open Access Journals (Sweden)

    Guillaume Jannot

    2016-12-01

    Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.

  2. AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2

    Directory of Open Access Journals (Sweden)

    Cícero Cardoso VALLE FILHO

    2015-12-01

    Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam.   No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332.  Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.

  3. Secretory leukocyte protease inhibitor expression and high-risk HPV infection in anal lesions of HIV positive patients

    Science.gov (United States)

    NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin

    2016-01-01

    Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102

  4. Desenvolvimento e aplicação do Litterae: um sistema para marcação, etiquetação, estatística e busca de unidades textuais e processuais

    OpenAIRE

    Daniel Couto Vale

    2009-01-01

    Esta dissertação, desenvolvida no âmbito do projeto SEGTRAD (Segmentação Cognitiva e Sistemas de Memória de Tradução) e vinculada ao LETRA (Laboratório Experimental de Tradução) da Faculdade de Letras da Universidade Federal de Minas Gerais, propõe um novo método de anotação de registros de teclado (keylog) gravados pelo Translog® com a ferramenta Litterae. Usando os registros do SEGTRAD analisados por Renata R. Rodrigues (2009) de 12 tradutores profissionais nos pares lingüísticos alemão-por...

  5. Editorial

    Directory of Open Access Journals (Sweden)

    Reinaldo Giraldo Díaz

    2014-12-01

    Full Text Available La Universidad Nancional Abierta y a Distancia (UNAD, através de contrato con la Red Nacional Académica de Tecnología Avanzada (RENATA, ha migrado el contenido de sus publicaciones (revistas, libros derivados de investigaciones, boletines y otros materiales universitarios al Open Journal System (OJS, un sistema de Administración y publicación de revistas y documentos periódicos (seriados en internet. El sistema permite reducir el tiempo y energías del proceso editorial y de esta forma lograr un manejo más eficiente y unificado del mismo, acelerando el acceso de los autores y la difusión de los artículos de investigación producidos por la comunidad académica.

  6. Aluminium nitrate ceramics: A potential UV dosemeter material

    DEFF Research Database (Denmark)

    Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

    2002-01-01

    The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...

  7. Piperazine side-effects in a patient with pre-existing renal insufficiency

    Directory of Open Access Journals (Sweden)

    Majid Malaki

    2014-01-01

    Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.

  8. [Acute severe colitis with recto-vaginal fistula during treatment with non-steroidal anti-inflammatory agents].

    Science.gov (United States)

    Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y

    2002-07-13

    We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.

  9. Comparison of imiquimod, topical fluorouracil, and electrocautery for the treatment of anal intraepithelial neoplasia in HIV-positive men who have sex with men: an open-label, randomised controlled trial.

    Science.gov (United States)

    Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M

    2013-04-01

    Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients

  10. Dzhässikavad toovad linna jõulurõõmu / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2008-01-01

    "Jazzkaare" kolm dzhässiõhtut Pärnus - 3. dets. Eliisabeti kirikus Raivo Tafenau, Ain Agan ja Laura Põldvere, 9. dets. Endla teatris Saksamaa vokaalansambel Berlin Voices (Esther Kaiser, Sarah Kaiser, Marc Secara, Kristofer Benn) ja 11. dets. Ammende villas norra laulja Gine Andressen. Berlin Voices soojendusansamblina esineb Pärnu noorte vokaalansambel Greip

  11. File list: Oth.YSt.05.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.05.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.05.DNA-RNA_hybrids.AllCell.bed ...

  12. File list: Oth.YSt.50.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.50.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.50.DNA-RNA_hybrids.AllCell.bed ...

  13. File list: Oth.YSt.20.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.20.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.20.DNA-RNA_hybrids.AllCell.bed ...

  14. File list: Oth.YSt.10.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.10.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.10.DNA-RNA_hybrids.AllCell.bed ...

  15. Analytical electron microscopy investigation of the AlN-ZrO2 system

    International Nuclear Information System (INIS)

    Stoto, T.; Doukhan, J.C.; Mocellin, A.

    1989-01-01

    A combination of electron microscopy, diffraction, and spectroscopic techniques were used to identify and characterize the quaternary Zr-Al-O-N phase, which forms during reaction sintering of AIN + ZrO 2 mixtures. In this paper it is proposed that this phase has a space group Fd 3 m; several compositions are suggested

  16. Eesti Metodisti Kirik : Balti Misjoni Keskus, Narva mnt. 51, Tallinn = Estonian Methodist Church / Vilen Künnapu

    Index Scriptorium Estoniae

    Künnapu, Vilen, 1948-

    2000-01-01

    Projekteerija Arhitektuuribüroo Künnapu & Padrik. Arhitektid Vilen Künnapu, Ain Padrik. Konstruktsioonide autor Andres Laur. Sisekujundajad Argo ja Katrin Vaikla. Projekt 1994, valmis 2000. Kirik on klaasja pikliku koolitiivaga (teoloogiline seminar). 7 ill.: I korruse plaan, lõige, välis- ja sisevaated

  17. Modulation of dopaminergic neurotransmission by morphine in the rat

    NARCIS (Netherlands)

    P. Moleman (Peter)

    1977-01-01

    textabstractThe pleasant effects of opium were already known 6000 years ago and opium has been used for medical purposes for at least 3500 years. Opium, and its r.1ain constituent morphine, evoke a feeling of well-being and always relieve pain of any origin, in other words, a perfect analgesic and

  18. Grunge kodukujunduses / Ene Vool

    Index Scriptorium Estoniae

    Vool, Ene, 1948-

    2004-01-01

    Low-tech, campi ja grunge ehitus- ja sisustusstiilidest meil ja mujal - kommenteerivad Andro Kööp ja Ain Nurmela. Tutvustatakse ka Mari-Mira projekti Pariisis, mis kujutab endast nn. mutant-küla, putka- ja onnikultuuri koketeriid. Artikli lõpus kommenteerib kunstiteadlane Karin Paulus grungestiili muusikas, riietuses ja sisekujunduses.

  19. Täna läheb käima suveteatrimaraton / Meelis Kapstas

    Index Scriptorium Estoniae

    Kapstas, Meelis, 1963-

    2000-01-01

    Eesti teatrite suvelavastustest - "Väike õuduste pood", "Save Our Souls", Meil aiaäärne tänavas", "Surm ooperis", "Aristokraadid", "Huck", "Leonce ja Lena" ja "Armastajad kurja tähe all".Lisatud suveteatri lavastajate - Merle Karusoo, Evald Hermaküla, Ain Prosa ja Georg Malviuse - saatesõnad oma lavastustele. Samuti lisatud suvelavastuste kava

  20. 3 + 2 = 450 : 3+2 õppesüsteem tõi kaasa kuni 450 tudengiga hiigelloengud / Anu Mõistlik, Jüri Saar

    Index Scriptorium Estoniae

    Mõistlik, Anu, 1980-

    2002-01-01

    Vastne õppekord pakib loengusaali sadu noori. 3+2 tuleku otsustas kuue inimese hääletus. Vanade õppekavade ained kaovad järjestikku tunniplaanidest. Teadusmagistreid enam ei tule. Ainepunktide ülekandmiseks peab üliõpilane ise vaeva nägema

  1. Antibacterial, antioxidant and cytotoxic activities of extracts from the ...

    African Journals Online (AJOL)

    Unicellular green algal strains, identified as Cosmarium (Chlorophyta), were isolated from Ain-Echeffa hot spring in north Tunisia. Different extracts (methanol, hexane, acetone, acetone: methanol and water) obtained from both biomass and extracellular polysaccharides (EPS) were evaluated for their antibacterial, ...

  2. Eesti Kirjanike Liit praegu : ankeedivastused

    Index Scriptorium Estoniae

    1997-01-01

    Aut.: Ain Kaalep, Juhan Habicht, Valeria Ränik, Karl Muru, Mart Velsker, Janika Kronberg, Maie Kalda, Hannes Varblane, Toomas Raudam, Priidu Beier, Kati Murutar, Dagmar Normet, Enn Vetemaa, Henn-Kaarel Hellat, Vello Lattik, Kajar Pruul, Kauksi Ülle, Ene Mihkelson, Jüri Ehlvest

  3. Methionine synthase A2756G and reduced folate carrier1 A80G ...

    African Journals Online (AJOL)

    Maha Moustafa

    2015-10-09

    Oct 9, 2015 ... folate carrier (RFC1) A80G gene polymorphisms on the maternal risk for DS. Patients: This ... Peer review under responsibility of Ain Shams University. ... Folate is the general term for a water-soluble B vitamin (vita- min B9) ...

  4. Topical 5-fluorouracil treatment of anal intraepithelial neoplasia in human immunodeficiency virus-positive men

    NARCIS (Netherlands)

    Richel, O.; Wieland, U.; de Vries, H. J. C.; Brockmeyer, N. H.; van Noesel, C.; Potthoff, A.; Prins, J. M.; Kreuter, A.

    2010-01-01

    Background Anal intraepithelial neoplasia (AIN), a human papillomavirus (HPV) induced potential precursor lesion of anal cancer, is frequent among human immunodeficiency virus (HIV)-positive men who have sex with men (MSM). So far, only a few prospective studies have been performed on the topical

  5. A Strong Impact of Genetic Background on Gut Microflora in Mice

    Directory of Open Access Journals (Sweden)

    R. Steven Esworthy

    2010-01-01

    Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.

  6. Solving unit commitment and economic load dispatch problems ...

    African Journals Online (AJOL)

    2 Department of Electrical Power and Machines, Faculty of engineering, Ain shams ... intricate basic leadership process and it is hard to build up any thorough ... These pre-committed schedules are optimized by BAT algorithm thus .... and the current best location (solution) is x0 which is situated in the wake of looking at.

  7. Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD

  8. Most "Druzhba" priobretajet politisheskoje znatshenije / Konstantin Vikentejev

    Index Scriptorium Estoniae

    Vikentejev, Konstantin

    2005-01-01

    Eesti ja Venemaa välisministrite Urmas Paeti ja Sergei Lavrovi kohtumisest Sloveenias, kus kinnitati ka vajadust Sõpruse sild rekonstrueerida. Arvamust avaldavad: Ago Silde, Sergei Jastrzhembski, Arnold Rüütel, Margus Leivo, Jaanus Õunapuu, Tiit Vähi, Ain Uiga, Vadim Gustov, Riho Sõrmus

  9. Mechanisms of Chinese Red Yeast Rice Inhibition of Prostate Cancer Growth

    Science.gov (United States)

    2009-10-01

    following treatment with LV and RYR. MATERIALS AND METHODS Extract and standard preparation Chinese RYR powder purchased from Botanica Bio- Science (Ojai...RYR diet contains 5% of RYR powder ( Botanica Bioscience, Ojai, CA) with the modified AIN93G diet. For lovastatin diet, lovastatin (Mylan

  10. Suvehooaeg Emajõe Ateenas liidab lugusid mitmest sajandist / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    Tartu suvelavastustest : Urmas Lennuki "Koidula" Andres Dvinjaninovi lavastuses (Emajõe Suveteater) ; Jan Rahmani "Sõit" Ain Mäeotsa lavastuses (Hansahoovi Teater), Raivo Adlase lavastus "Vaesed ja patused" August Jakobsoni ainetel Tartu raudteejaamas (Vilde Teater), G. Bizet' "Carmen" Ago-Endrik Kerge lavastuses (Muusikaline loomeühendus KaivConsort)

  11. Suvelavastuste hooaeg Tartus liidab endasse lugusid mitmest sajandist / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    Tartu suvelavastustest : Urmas Lennuki "Koidula" Andres Dvinjaninovi lavastuses (Emajõe Suveteater) ; Jan Rahmani "Sõit" Ain Mäeotsa lavastuses (Hansahoovi Teater), Raivo Adlase lavastus "Vaesed ja patused" August Jakobsoni ainetel Tartu raudteejaamas (Vilde Teater), G. Bizet' "Carmen" Ago-Endrik Kerge lavastuses (Muusikaline loomeühendus KaivConsort)

  12. Comparison of imiquimod, topical fluorouracil, and electrocautery for the treatment of anal intraepithelial neoplasia in HIV-positive men who have sex with men: an open-label, randomised controlled trial

    NARCIS (Netherlands)

    Richel, Olivier; de Vries, Henry J. C.; van Noesel, Carel J. M.; Dijkgraaf, Marcel. G. W.; Prins, Jan M.

    2013-01-01

    Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and

  13. Anal intraepithelial neoplasia in HIV+ men

    NARCIS (Netherlands)

    Richel, O.

    2014-01-01

    In this thesis we investigated several aspects of anal intraepithelial neoplasia (AIN) in HIV+ men who have sex with men (MSM). This condition has gained clinical interest because of the impressive increase of the anal cancer incidence in HIV+ MSM since the introduction of combination antiretroviral

  14. Naised Ilvesenahkades / Agnes Nõu

    Index Scriptorium Estoniae

    Nõu, Agnes

    2006-01-01

    Jahtlaeva Santa Maria kapteni Ain Roosma soovist kogu jahtlaeva naiskond ühtsesse vormi riietada sündis tuntud Eesti spordiriiete tootjal AS-il Ilves-Extra uus tootegrupp - purjetamisrõivad. Vt. samas: Ilves-Extra valmistab nüüd purjetamisrõivaid

  15. Spordipreemiad leidsid omaniku / Anne Põder

    Index Scriptorium Estoniae

    Põder, Anne, 1973-

    2007-01-01

    Järvamaa omavalitsuste liit ja spordiliit tunnustasid maakonna parimaid sportlasi, kelleks osutusid Ain-Alar Juhanson, Mikko Vanaisak, Viktoria Leks ja Grit Shadeiko. Spordiedendaja preemia sai Tiit Kavak, spordi elutöö preemia pälvis Enn Sõmeri

  16. Soomlased teevad silma Eesti toidutööstusele / Silva Männik

    Index Scriptorium Estoniae

    Männik, Silva, 1974-

    2004-01-01

    EL-iga liitumise eel plaanivad mitmed Soome ettevõtjad investeerida Eesti toiduainetööstustesse ja viia Eesti tooted Soome turule. Diagrammid: Soomlane sööb üha enam Eesti toitu. Kommenteerivad Joakim Helenius ja Ain Hanschmidt. Lisa: Näiteid soomlaste tehingutest

  17. Iidamast ja Aadamast ehk "Ahvide planeet" / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2001-01-01

    Taas on ekraanile jõudnud Pierre Boulle'i raamatu ainetel "Ahvide planeet" ("Planet of the Apes") : režissöör Tim Burton : Ameerika Ühendriigid 2001. Autor võrdleb seda 1968.a. filmiga ning Ain Kaalepi näidendiga "Iidamast ja Aadamast"

  18. Naissoo ja Agan - 2 in 1 / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    15. mail Tallinnas Mustpeade majas toimunud kontserdist "Naissoo ja Agan 111", kus esinesid Tõnu Naissoo, Ain Agan, Teemu Viinikainen, Raul Sööt, Daniel Aljo, Joel-Rasmus Remmel, Mihkel Mälgand, Toomas Rull ja Tallinna Kammerorkester Jüri-Ruut Kanguri juhatusel

  19. Viis näitust haaravad eri aastasadu / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2009-01-01

    Viljandi uue kunsti muuseumis avati fotograaf Ain Kimberi aktinäitus "Igavene teema", Johann Christoph Brotze pärandit tutvustav näitus, Belgia fotokunstniku Patavoli "Taevariik", Valgevene kunstniku Valeri Slauki litograafiad ning kunstitudengite Eva Järve ja Liis Dvorjanski kineetilised heinakuhjad

  20. Epidemiological Pattern and Management of Pediatric Asthma ...

    African Journals Online (AJOL)

    EL-HAKIM

    Egypt J Pediatr Allergy Immunol 2008; 6(2): 51-56. 51. Epidemiological Pattern and Management of Pediatric Asthma. Review of Ain Shams Pediatric Hospital Chest Clinic Data. Cairo, Egypt 1995-2004. INTRODUCTION. Bronchial asthma is a major worldwide health problem, which has received increased attention in.

  1. Eesti - Soome turismikaubamaja -5%

    Index Scriptorium Estoniae

    2006-01-01

    Turismikonverentsil "Eesti - Soome turismikaubamaja -5%" analüüsiti Eesti ja Soome vahelisi turismivõimalusi ning seati sihte edaspidiseks. Ülevaade Reilika Lelovi (Turismimaailm OÜ), Pauli Santala (Finnish Consulting Group), Tarja Vaakanaineni (Tallink Finland Vice Managing), Ain Hinsbergi (Turismimaailm OÜ), Jari Auraneni (Go Finland Oy) ja Mikko Saviko (The Baltic Guide) ettekannetest

  2. Influência de frações da parede celular de levedura (Saccharomyces cerevisiae sobre os índices séricos de glicose e lipídios, microbiota intestinal e produção de ácidos graxos voláteis (AGV de cadeias curtas de ratos em crescimento Influence of yeast (Saccharomyces cerevisiae cell wall fractions on serum indexes of glucose and lipids, intestinal microbiota and production of short-chain volatile fatty acids (VFA in growing rats

    Directory of Open Access Journals (Sweden)

    Saula Goulart Chaud

    2007-06-01

    Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a

  3. The antiproliferative effect of mulberry (Morus alba L.) plant on ...

    African Journals Online (AJOL)

    Shadia A. Fathy

    2013-08-12

    Aug 12, 2013 ... cell line HepG2 ... a Faculty of Science, Ain Shams University, Egypt ... Mulberry leaf extracts were prepared using the solvents: water, 50% aqueous ... cused on the search for a potential source rich in biologically ... Materials and methods. 2.1. ... HPLC grade (means high quality) were obtained from Fisher.

  4. "Kalevipoeg" ja "Kalevala" / Märt Laarman

    Index Scriptorium Estoniae

    Laarman, Märt, 1896-1979

    1998-01-01

    Varem ilmunud: Tallinn : Kool, 1922. Autori pseudonüüm M. Salak. . Sisu: "Kalevipoja" saamislugu; "Kalevipoeg" ja "Kalevala"; Vead "Kalevipoja" värsitehnikas ja keeles; Eesti ained "Kalevalas"; "Kalevala" mõju "Kalevipojale"; Kalevipoja algupära; "Kalevipoja" kompositsioon ja tegelased; Kaunid kohad "Kalevipojas"; Kokkuvõte.

  5. BIG tahab pangaks saada / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2004-01-01

    Ilmunud ka: Delovõje Vedomosti : Finansõ 19. jaan. 2005 lk. 2. Kiirlaenukontorina tegutsev Balti Investeringute Grupp tahab saada pangaks. Kommenteerivad Ain Hanschmidt, Loit Linnupõld, Indrek Neivelt ja Alvar Jõgeva. Vt. samas: Krista Taim. Väikeinvestor kiidab BIG-i soodsat protsenti; Kiirelt saadud laen tänini kukil ja suhted sugulastega sassis

  6. Download this PDF file

    African Journals Online (AJOL)

    yakoub@AHMED

    We may tentatively suggest on the basis oř recent molecular evidence that induced elevation oř .... Ph.D.Thesis Faculty oř Sci. Ain Shams ... 23: 1389. 1395. Kim K N, Cheong YH, Grant JJ, Pandey GK & Luan S (2003) CIPK3, a calcium sensor.

  7. Hepatoadrenal syndrome in Egyptian children with liver cirrhosis ...

    African Journals Online (AJOL)

    Amel A.M. Elfaramawy

    2012-08-03

    Aug 3, 2012 ... E-mail address: amelhome4@gmail.com. Peer review under responsibility of Ain Shams University. Production and hosting by ..... [23] Ho JT, Al-Musalhi H, Chapman MJ, Quach T, Thomas PD, Bagley. CJ, et al. Septic shock ...

  8. Determination of thorium and uranium contents in soil samples ...

    Indian Academy of Sciences (India)

    Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egyp; Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egypt; Faculty of Girls for Art, Science and Education, Ain-Shams ...

  9. Armusuhted tööl - meeleolu tõuseb, töökvaliteet langeb / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-

    2005-01-01

    Ilmunud ka: Juhi ideelaegas. - Tallinn, 2006, lk. 77-79. A. Le Coqi juhatuse esimees Tarmo Noop, Alexela Oili tegevjuht Ain Kuusik ja Tööinspektsiooni õigusosakonna juhataja Niina Siitam isiklikest suhetest ja armumisest tööl. Kommenteerib BDA Estonia projektikonsultatsioonide juht Maria Kütt

  10. Lahkus juhmi Hundi ja kavala Jänese looja / Andri Maimets, Marko Lillemägi

    Index Scriptorium Estoniae

    Maimets, Andri, 1979-

    2006-01-01

    Suri vene animakunstnik, kuulsate tegelaskujude - Hundi ja Jänese looja joonisfilmisarjas (1969-1986) "Oota sa!" ("Nu, pogodi!") Svetozar Russakov (sünd. 3.04.1923). Filmi omaaegset mõju meenutab Rein Raamat. Kommenteerivad Raivo Järvi, Hendrik Normann, Ain Nurmela, Marika Korolev, Evelin Samuel

  11. Research Article

    African Journals Online (AJOL)

    2017-09-01

    Sep 1, 2017 ... Prp.Totl (%). 54.59. 10.93. Cumul - %. 54.59. 65.52. The bold values indicate the correlated variables. 5. CONCLUSION. The aim of our study was to determine the influence of urban, agricultural and industrial discharges on Ain Zada's dam waters. The chemical composition of these waters was determined ...

  12. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Department of Mathematics, Faculty of Sciences of Ain Chock, University of Hassan II, Casablanca, Morocco; Department of Mathematics, Keio University at Fujisawa, 5322 Endo, Kanagawa 252-8520, Japan; School of Science and Technology, Kwansei Gakuin University, 2-1 Gakuen, Sanda-City 6691337, Japan ...

  13. Veel vene koolist ja krokodillipisaratest / Yana Toom

    Index Scriptorium Estoniae

    Toom, Yana, 1966-

    2011-01-01

    Artikli autori arvates ei ole eesti keele õpetamise kvaliteet piisav, et seada eesmärgiks eestikeelne aineõpe vene koolide gümnaasiumiastmes. Vastukaja artiklile: Priit Simson. Venekeelne kool ja krokodillipisarad. Eesti Päevaleht (2011) 9. sept., lk. 2

  14. Libman–Sacks endocarditis, and other echocardiographic findings in systemic lupus erythematosus: Case report

    Directory of Open Access Journals (Sweden)

    Mohamed Atef Hamza

    2012-09-01

    Full Text Available Case report of a 19 year-old female patient with systemic lupus erythematosus (SLE who was presented to Ain Shams University Hospital complaining of dyspnea on moderate exertion. Echocardiography showed the presence of sterile vegetation on the mitral valve, Libman–Sacks endocarditis (LSE.

  15. Libman–Sacks endocarditis, and other echocardiographic findings in systemic lupus erythematosus: Case report

    OpenAIRE

    Hamza, Mohamed Atef; Allam, Lamyaa

    2012-01-01

    Case report of a 19 year-old female patient with systemic lupus erythematosus (SLE) who was presented to Ain Shams University Hospital complaining of dyspnea on moderate exertion. Echocardiography showed the presence of sterile vegetation on the mitral valve, Libman–Sacks endocarditis (LSE).

  16. Uus silt turul - clean label / Gunnel Koba

    Index Scriptorium Estoniae

    Koba, Gunnel

    2013-01-01

    Suurbritanniast alguse saanud clean labeli toiduainete märgis annab tarbijale kindlustunde, et tegemist on võimalikult puhta lihtsa ja arusaadava koostisega tootega. Samas pole märgisel ametlikku definitsiooni ning pole välistatud, et toiduaine koostises ei ole ka mõni e-aine

  17. P-type doping of GaN

    International Nuclear Information System (INIS)

    Wong, R.K.

    2000-01-01

    After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover

  18. Portugalikeelse kirjanduse retseptsioon Eestis / Mele Pesti

    Index Scriptorium Estoniae

    Pesti, Mele, 1979-

    2011-01-01

    Portugalikeelse kirjanduse tõlgetest ja nende vastuvõtust alates esimese tõlke ilmumisest 1890. aastal kuni 2005. aastani ning retseptsiooni pärssinud teguritest. Ülevaade kahe olulisema tõlkija Aita Kurfeldti ja Ain Kaalepi tööst

  19. Type 1 diabetes mellitus and atopic diseases in children.

    African Journals Online (AJOL)

    Ehab

    Nancy S. Elbarbary. Assistant Professor of Pediatrics, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Background. Diabetes mellitus type 1 (T1DM) is a complex disease resulting from the interplay of genetic, epigenetic, and environmental factors.1 Worldwide,. T1DM epidemic represents an increasing global.

  20. Risk factors for autism: An Egyptian study

    African Journals Online (AJOL)

    Farida El-Baz

    IQ assessment using Stanford–Binrent intelligence scale, and assessment of severity ... All studied developmental milestones were delayed among autistic children than ... Peer review under responsibility of Ain Shams University. ..... Treatment and educa- ..... communication in people with autism and intellectual disability. J.

  1. Finding Innovation and Imagination in a Bag of Loose Parts

    Science.gov (United States)

    Dillon, Anna

    2018-01-01

    The third annual research symposium at Zakher KG School in Al Ain, United Arab Emirates (UAE), presented an exciting opportunity for the 33 teachers in the school to present their findings from classroom-based action research conducted within their professional learning communities. In this brief article, one attendee describes an unexpected…

  2. Contribution of G.I.S. for the survey and the management of water ...

    African Journals Online (AJOL)

    Contribution of G.I.S. for the survey and the management of water resources in the basin “Benhandjir – Tirkount” (Ain Sefra) – mounts of Ksour - Saharian Atlas ... The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader).

  3. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Mohamed Abass1 El-Hussain A Mohamed1 Aisha S Mayas2 Akram H Ibrahim3. Department of Chemistry, Faculty of Education, Ain Shams University, Roxy, Heliopolis 11757, Cairo, Egypt; Department of Chemistry, Faculty of Education, Sana'a University, Sana'a, Yemen; Curriculum Development Center ...

  4. P-type doping of GaN

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)

    2000-04-01

    After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.

  5. Egyptian Journal of Pediatric Allergy and Immunology (The) - Vol 6 ...

    African Journals Online (AJOL)

    Epidemiological Pattern and Management of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic Data Cairo, Egypt 1995-2004 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Magda Y El-Saify, Malak A Shaheen, Sahar M Sabbour, Ahmed A Basal ...

  6. Egyptian Journal of Pediatric Allergy and Immunology (The): Journal ...

    African Journals Online (AJOL)

    Publisher. Contact: Professor Ihab Z. El-Hakim. Email ihab.elhakim@gmail.com. Phone +201111224974. Fax … +202 33045060. Children's Hospital, Ain Shams University, Ramses Street, Abbassiya, Cairo 11566, Egypt. The Egyptian Society of Pediatric Allergy and Immunology ...

  7. Ahhaa teaduskeskus Tartus = The Ahhaa Science Centre in Tartu

    Index Scriptorium Estoniae

    2012-01-01

    Arhitektide Ain Padriku ja Vilen Künnaou projekteeritud Ahhaa teaduskeskuse (Sadama 1) ekspositsiooni ja sisekujundusest. Sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka), loetletud nende ühiselt tehtud töid. Infograafika: Alar Pikkorainen

  8. Reiljan, Savisaar show who's in charge / Joel Alas

    Index Scriptorium Estoniae

    Alas, Joel

    2006-01-01

    Eestimaa Rahvaliidu esimees Villu Reiljan ja Eesti Keskerakonna esimees Edgar Savisaar otsustavad uue presidendi üle. Villu Reiljan toetab Arnold Rüütlit. Edgar Savisaare, Ene Ergma, Toomas Hendrik Ilvese ja Riigikogu liikme Ain Seppiku väljaütlemised

  9. P38 MAPK / beta-catenin canonical wnt signaling mediated bone formation effects of blueberries

    Science.gov (United States)

    Appropriate nutrition is one of the critical factors that influences bone development. We studied the effects of dietary blueberry supplementation on bone growth in weanling rats. Weanling male and female rats were fed AIN-93G semi-purified diets supplemented with 10% whole blueberry powder for 14 a...

  10. Soy Components Genistein and Lunasin Regulate E-Cadherin and Wnt Signaling in Mammary Epithelial Cells

    Science.gov (United States)

    Enhanced Wnt/beta-catenin signaling and loss of E-cadherin expression are considered hallmarks of tumorigenesis. We previously showed by microarray gene profiling that dietary intake of soy-based AIN-93G diets altered components of Wnt/beta-catenin signaling in rat mammary epithelial cells. To furth...

  11. Wnt/RANKL-mediated bone growth promoting effects of blueberries in weanling rats

    Science.gov (United States)

    We studied the effects of dietary blueberry supplementation on bone growth in weanling rats. Weanling male and female rats were fed AIN-93G semi-purified diets supplemented with 10% whole blueberry powder for 14 and 30 days beginning on PND 21. In both sexes tibial bone mineral density and content a...

  12. Keskerakonna nõrk PR-käik / Aivar Hundimägi

    Index Scriptorium Estoniae

    Hundimägi, Aivar, 1975-

    2008-01-01

    Seoses keskerakondlastest ettevõtjate Richard Siku ja Heldur Undi sattumisega bordelliskandaali on Keskerakonna aukohtu esimees Ain Seppik pöördunud järelpärimisega politseiameti peadirektori Raivo Aegi ja riigi peaprokuröri Norman Aasa poole

  13. Punane moon või kaine mõistus / Ene Läkk

    Index Scriptorium Estoniae

    Läkk, Ene, 1957-

    2001-01-01

    Nukuteatri uue hoone sisekujunduse võistluse I ja II koha töödest. I koha töö autorid Raivo Kotov ja Andrus Kõresaar, II koha töö autorid Ülar Mark, Liina Link, stilist Ain Nurmela ja arvutigraafik Tanel Viks büroost Mark & Tamm Arhitektid

  14. Arupärimine rahandusministrile eurokalkulaatoritest / Jürgen Ligi, Ene Ergma, Helle Kalda...[jt.

    Index Scriptorium Estoniae

    2011-01-01

    Riigikogu liikmete Helle Kalda, Toomas Vareki, Aivar Riisalu, Lauri Laasi, Mailis Repsi, Enn Eesmaa, Kalle Laaneti, Eldar Efendijevi, Nelli Privalova, Vladimir Velmani, Olga Sõtniku, Kalev Kallo, Toivo Tootseni, Arvo Sarapuu, Nikolai Põdramägi Evelyn Sepa, Ain Seppiku ja Valeri Korbi poolt 17. novembril esitatud arupärimine

  15. Koputajate kaitseks! / Ivar Tallo

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2003-01-01

    Politoloog Ivar Tallo arvates võiks Riigikogu välja tulla initsiatiiviga luua ühiskonna esindajate osavõtul vigade ja pettuste paljastajate kaitse seadus. Küsimusele, kust läheb politseiametniku sõnavabaduse piir vastavad Ain Seppik, Tarmo Loodus ja Jaanus Rahumägi. Indrek Sirgi juhtum

  16. Musta pesu pesemine / Ivar Tallo

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2005-01-01

    Valitsuse korruptsioonivastase asjatundjate komisjoni juht aastatel 2002-2003 on seisukohal, et ajakirjandus on ainult üks võimalikest vahenditest tõe tuvastamisel ning lõpliku tõe Edgar Savisaare ja Ain Hanschmidti jt seotud skandaalide kohta peavad selgitama võimuinstitutsioonid

  17. Genome Sequence of Anoxybacillus flavithermus Strain AK1, a Thermophile Isolated from a Hot Spring in Saudi Arabia

    KAUST Repository

    Khalil, Amjad

    2015-06-04

    Anoxybacillus flavithermus strain AK1 was isolated from Al-Ain Alhara, a thermal hot spring located 50 km southeast of the city of Gazan, Saudi Arabia (16°56ʹN, 43°15ʹE). The sequenced and annotated genome is 2,630,664 bp and encodes 2,799 genes.

  18. Tigutorn = The Snail Tower / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tartus Väike-Turu 5 asuva Tigutorni arhitektuursest lahendusest. Maja alumisel korrusel on äriruumid, ülemistel korrustel korterid. Arhitektid Vilen Künnapu, Ain Padrik, kaasautorid Kristiina Hussar, Kerli Koolma (AB Künnapu & Padrik). Üldruumide kujundus: Heli Eensalu, Sulev Vahtra. Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele

  19. Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

    Index Scriptorium Estoniae

    Lehtsaar, Heli, 1976-

    2008-01-01

    Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

  20. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual ...

  1. Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE

  2. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Journal of Genetics. Volume 92 Issue 1 April 2013 pp 81-83 Research Note. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient · Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud.

  3. 4TH Marine Division Operation Plan Number 49-44

    Science.gov (United States)

    1944-12-26

    Interpretation Squadron TWOC Pt GUAM for processing and inter- pretation. To assist in this work, one photographic interpreter each from Commander Amphibious...Annex "Ain to Division administrativo Order Nio, 43-44, (Reviej)) . (4) Repai~, section to provide 2d, 3d and 4th echelon mainteniaince for Engineer

  4. Efeito da casca da berinjela (Solanum melongena) sobre as concentrações plasmáticas de triglicerídeos, colesterol total e frações lipídicas, em cobaias (Cavia porcellus) hiperlipidêmicos ( The effect of the eggplant core on blood lipid concentrations in hypercholesterolemic guinea pigs (Cavia porcellus) )

    NARCIS (Netherlands)

    Cherem, A.D.R.; Tramonte, V.L.C.G.; Fett, R.; Dokkum, W. van

    2007-01-01

    We investigated the effect of the eggplant core on the plasma concentrations of triglycerides, total- LDL- and HDL-cholesterol, in male guinea pigs, randomly assigned into five groups: 1 (N) - normolipidic diet AIN-93G, 2 (NB) - normolipidic diet, supplemented with eggplant core, halfway of the

  5. Eelarveheitlus sai eile riigikogus vihase avastardi / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2004-01-01

    Ilmunud ka: Infopress, 1. okt. 2004, nr. 40, lk. 24. Peaminister Juhan Partsi kõnest Riigikogus 2005. aasta riigieelarve eelnõu üle andes. Riigikogu liikmete hinnanguid eelarve kohta. Diagrammid: Eelarve jõudis riigikokku. Lisa: Riigi tulud tuleval aastal. Kommenteerivad Eiki Nestor, Ain Seppik, Mart Laar

  6. The Psychology of Violent Conflict in Failing States: A Review of the Scientific Literature (Psychologie des Conflits Violents au sein d’etats en Deroute: Analyse de Publications Scientifiques)

    Science.gov (United States)

    2010-12-01

    Sommaire ..... Psychologie des conflits violents au sein d’états en déroute: Analyse de publications scientifiques Donald M. Taylor; Michael J. A...in parenthesis at the end of the title) The Psychology of Violent Conflict in Failing States (U) Psychologie des conflits violents au sein d’états en

  7. Non-traumatic perforation of the small bowel | Eid | African Health ...

    African Journals Online (AJOL)

    ... medical records of four patients who have presented with non-traumatic perforation of the small bowel and were treated at Al-Ain Hospital during the last 5 years were studied retrospectively. Results: The presenting symptoms of all patients were similar. Erect chest X-ray has shown free air under diaphragm in 3 patients.

  8. Analytical calculation of the transition to complete phase ...

    Indian Academy of Sciences (India)

    Ciências e Humanidades, Universidade de S˜ao Paulo, Av. Arlindo Bettio 1000,. 03828-000 S˜ao Paulo, Brazil. 4Department of Physics, Faculty of Science, Ain Shams University, 11566 Cairo, Egypt. 5Department of Physics, Faculty of Education, University of Riyadh for Women,. P.O. Box 21034, 11942 Alkharj, Kingdom of ...

  9. Parts : ministrite minevik olgu avalik / Juhan Parts ; interv. Toomas Sildam

    Index Scriptorium Estoniae

    Parts, Juhan, 1966-

    2003-01-01

    Peaminister Juhan Parts vastab küsimustele, mis on seotud politseinike altkäemaksu andmise avalikuks tulekuga, komissar Indrek Sirgi ametist lahkumisega ja ministrite seadusrikkumiste avalikustamisega. Kommenteerivad: Margus Leivo, Tarmo Loodus, Ain Seppik. Vt. samas: Valik saladuses peetavast teabest

  10. Isehakanud klassikute näitus / Margus Kiis

    Index Scriptorium Estoniae

    Kiis, Margus

    2003-01-01

    Fotonäitusest XXL, mis hõlmab peamiselt 1990-2000 a. fotosid, Tartu Kunstnike Majas. Näituse koostajad Peeter Linnap ja Vello Kalamets. Kirjeldatud DeStudio, Peeter Lauritsa, Toomas Kalve, Tarvo Hanno Varrese, Peeter Linnapi, Meelis Lukki, Ain Protsini, Tõnu Tamme, Malev Toomi, Vello Kalametsa ja Madis Palmi töid

  11. Article

    African Journals Online (AJOL)

    2012-12-04

    Dec 4, 2012 ... postgraduate students) and junior staff. ... Radiation Oncology Department, Ain Shams University Hospital, .... and one providing summary answers to the questions, between 4 - 10 .... no travel or hotel costs. ... more modules or a book with lots of tables and lists (as one ... its determinants in clinical practice.

  12. Teatrid murravad päid ja piike / Dea Martinjonis

    Index Scriptorium Estoniae

    Martinjonis, Dea

    2000-01-01

    Eesti Televisiooni ekraanile jõuab teatriteemaline teleturniir "Bläkkpoks" : stsenarist Villu Kangur : režissöör Ain Prosa : saatejuht Sepo Seeman : toimetaja Anne Tuuling : produtsent Priit Vaher. Ka : Teleleht nr. 50, lk. 36-37

  13. Quixotic coupling between irrigation system and maize-cowpea ...

    African Journals Online (AJOL)

    A study was conducted at the Research and Experimental Station, Faculty of Agriculture, Ain Shams University at Shalakan, Kalubia Governorate, Egypt, to evaluate the effect of two irrigation systems (trickle and modified furrow irrigation) and five maize (M)-cowpea (C) intercropping patterns (sole M-30, sole M-15, ridge ...

  14. The Artisanal fishery in the Sepik-Ramu catchment area, Papua New Guinea

    NARCIS (Netherlands)

    Heijden, van der P.G.M.

    2002-01-01

    A survey in 25 villages in the Sepik-Ramu basin revealed that fishing was practised in all villages surveyed. The participation in catching fish decreased from 42% of the population of villages situated below 200 m altitude to 23.4% of villages al altitudes above 1,000 111, 111ain(v as a result of

  15. 24 April 1971 BOOK REVIEWS BOEKBESPREKINGS

    African Journals Online (AJOL)

    1971-04-24

    Apr 24, 1971 ... and methods of treatment including exchange transfusIOns ~md dialysis. The last chapter deals with public ... have shown how actual cases were treated so that the reader could e:ain confidence by seeing how ... sponse to carcinogens, the biological and biophysical aspects of ageing and the inflammatory ...

  16. Pärnu uus keskus kerkib

    Index Scriptorium Estoniae

    2007-01-01

    2007. a. oktoobris pandi Pärnu kesklinnas nurgakivi uuele linnasüdamele, kuhu kerkib kaubanduskeskus ja 400-kohaline parkimismaja. Aida tänav muudetakse jalakäijate alaks ja tekkiv promenaad kaetakse osaliselt klaaskatusega, promenaadi äärde ehitatakse üle 20000 m2 elamispinda. Keskuse arhitektid: Vilen Künnapu, Ain Padrik. Ehitab Eston Ehitus

  17. Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <

  18. Data of evolutionary structure change: 1WPWB-1XAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1WPWB-1XAAA 1WPW 1XAA B A GFTVALIQGDGIGPEIVSKSKRILAKINELYSLPIEYIE...SDGVAVGMKIITRFASERIAKVGLNFALRRRKKVTCVHKANVMRITDGLFAEACRSVLKG--KVEYSEMYVDAAAANLVRNPQMFDVIVTENVYGDILSDEASQIAGS...LEU CA 502 1XAA A 1XAAA...R CA 306 1XAA A 1XAAA...ain>A 1XAAA KANVL-EVGEF -

  19. Kinnisvaragurude ümarlaud / interv. Jaanika Merilo

    Index Scriptorium Estoniae

    2007-01-01

    Järg. Profit nr. 3 lk. 18-21. Eesti kinnisvaraturu olukorrast, vestlusringis osalevad investeerimisfirma EE-REIT juhatuse liige Ain Kivisaar, Arco Vara Eesti tegevjuht Kaido Kangur, Hansapanga makromajanduse analüütik Maris Lauri ja ASYIT Ehituse kinnisvaraosakonna müügijuht Tõnu Toompark

  20. Tunable magnetic properties by interfacial manipulation of L1(0)-FePt perpendicular ultrathin film with island-like structures.

    Science.gov (United States)

    Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H

    2012-02-01

    Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.