WorldWideScience

Sample records for relaxing component t1rhoh

  1. Rhoh deficiency reduces peripheral T-cell function and attenuates allogenic transplant rejection

    DEFF Research Database (Denmark)

    Porubsky, Stefan; Wang, Shijun; Kiss, Eva

    2011-01-01

    better graft function. This effect was independent of the lower T-cell numbers in Rhoh-deficient recipients, because injection of equal numbers of Rhoh-deficient or control T cells into kidney transplanted mice with SCID led again to a significant 60% reduction of rejection. Mixed lymphocyte reaction...... deficiency in a clinically relevant situation, in which T-cell inhibition is desirable. In murine allogenic kidney transplantation, Rhoh deficiency caused a significant 75% reduction of acute and chronic transplant rejection accompanied by 75% lower alloantigen-specific antibody levels and significantly...

  2. Opposing roles for RhoH GTPase during T-cell migration and activation

    Science.gov (United States)

    Baker, Christina M.; Comrie, William A.; Hyun, Young-Min; Chung, Hung-Li; Fedorchuk, Christine A.; Lim, Kihong; Brakebusch, Cord; McGrath, James L.; Waugh, Richard E.; Meier-Schellersheim, Martin; Kim, Minsoo

    2012-01-01

    T cells spend the majority of their time perusing lymphoid organs in search of cognate antigen presented by antigen presenting cells (APCs) and then quickly recirculate through the bloodstream to another lymph node. Therefore, regulation of a T-cell response is dependent upon the ability of cells to arrive in the correct location following chemokine gradients (“go” signal) as well as to receive appropriate T-cell receptor (TCR) activation signals upon cognate antigen recognition (“stop” signal). However, the mechanisms by which T cells regulate these go and stop signals remain unclear. We found that overexpression of the hematopoietic-specific RhoH protein in the presence of chemokine signals resulted in decreased Rap1–GTP and LFA-1 adhesiveness to ICAM-1, thus impairing T-cell chemotaxis; while in the presence of TCR signals, there were enhanced and sustained Rap1–GTP and LFA-1 activation as well as prolonged T:APC conjugates. RT-PCR analyses of activated CD4+ T cells and live images of T-cell migration and immunological synapse (IS) formation revealed that functions of RhoH took place primarily at the levels of transcription and intracellular distribution. Thus, we conclude that RhoH expression provides a key molecular determinant that allows T cells to switch between sensing chemokine-mediated go signals and TCR-dependent stop signals. PMID:22689994

  3. The small GTPase RhoH is an atypical regulator of haematopoietic cells

    Directory of Open Access Journals (Sweden)

    Kubatzky Katharina F

    2008-09-01

    Full Text Available Abstract Rho GTPases are a distinct subfamily of the superfamily of Ras GTPases. The best-characterised members are RhoA, Rac and Cdc42 that regulate many diverse actions such as actin cytoskeleton reorganisation, adhesion, motility as well as cell proliferation, differentiation and gene transcription. Among the 20 members of that family, only Rac2 and RhoH show an expression restricted to the haematopoietic lineage. RhoH was first discovered in 1995 as a fusion transcript with the transcriptional repressor LAZ3/BCL6. It was therefore initially named translation three four (TTF but later on renamed RhoH due to its close relationship to the Ras/Rho family of GTPases. Since then, RhoH has been implicated in human cancer as the gene is subject to somatic hypermutation and by the detection of RHOH as a translocation partner for LAZ3/BCL6 or other genes in human lymphomas. Underexpression of RhoH is found in hairy cell leukaemia and acute myeloid leukaemia. Some of the amino acids that are crucial for GTPase activity are mutated in RhoH so that the protein is a GTPase-deficient, so-called atypical Rho GTPase. Therefore other mechanisms of regulating RhoH activity have been described. These include regulation at the mRNA level and tyrosine phosphorylation of the protein's unique ITAM-like motif. The C-terminal CaaX box of RhoH is mainly a target for farnesyl-transferase but can also be modified by geranylgeranyl-transferase. Isoprenylation of RhoH and changes in subcellular localisation may be an additional factor to fine-tune signalling. Little is currently known about its signalling, regulation or interaction partners. Recent studies have shown that RhoH negatively influences the proliferation and homing of murine haematopoietic progenitor cells, presumably by acting as an antagonist for Rac1. In leukocytes, RhoH is needed to keep the cells in a resting, non-adhesive state, but the exact mechanism has yet to be elucidated. RhoH has also been

  4. Local NMR relaxation rates T1-1 and T2-1 depending on the d -vector symmetry in the vortex state of chiral and helical p -wave superconductors

    Science.gov (United States)

    Tanaka, Kenta K.; Ichioka, Masanori; Onari, Seiichiro

    2018-04-01

    Local NMR relaxation rates in the vortex state of chiral and helical p -wave superconductors are investigated by the quasiclassical Eilenberger theory. We calculate the spatial and resonance frequency dependences of the local NMR spin-lattice relaxation rate T1-1 and spin-spin relaxation rate T2-1. Depending on the relation between the NMR relaxation direction and the d -vector symmetry, the local T1-1 and T2-1 in the vortex core region show different behaviors. When the NMR relaxation direction is parallel to the d -vector component, the local NMR relaxation rate is anomalously suppressed by the negative coherence effect due to the spin dependence of the odd-frequency s -wave spin-triplet Cooper pairs. The difference between the local T1-1 and T2-1 in the site-selective NMR measurement is expected to be a method to examine the d -vector symmetry of candidate materials for spin-triplet superconductors.

  5. Relaxivity of Ferumoxytol at 1.5 T and 3.0 T.

    Science.gov (United States)

    Knobloch, Gesine; Colgan, Timothy; Wiens, Curtis N; Wang, Xiaoke; Schubert, Tilman; Hernando, Diego; Sharma, Samir D; Reeder, Scott B

    2018-05-01

    The aim of this study was to determine the relaxation properties of ferumoxytol, an off-label alternative to gadolinium-based contrast agents, under physiological conditions at 1.5 T and 3.0 T. Ferumoxytol was diluted in gradually increasing concentrations (0.26-4.2 mM) in saline, human plasma, and human whole blood. Magnetic resonance relaxometry was performed at 37°C at 1.5 T and 3.0 T. Longitudinal and transverse relaxation rate constants (R1, R2, R2*) were measured as a function of ferumoxytol concentration, and relaxivities (r1, r2, r2*) were calculated. A linear dependence of R1, R2, and R2* on ferumoxytol concentration was found in saline and plasma with lower R1 values at 3.0 T and similar R2 and R2* values at 1.5 T and 3.0 T (1.5 T: r1saline = 19.9 ± 2.3 smM; r1plasma = 19.0 ± 1.7 smM; r2saline = 60.8 ± 3.8 smM; r2plasma = 64.9 ± 1.8 smM; r2*saline = 60.4 ± 4.7 smM; r2*plasma = 64.4 ± 2.5 smM; 3.0 T: r1saline = 10.0 ± 0.3 smM; r1plasma = 9.5 ± 0.2 smM; r2saline = 62.3 ± 3.7 smM; r2plasma = 65.2 ± 1.8 smM; r2*saline = 57.0 ± 4.7 smM; r2*plasma = 55.7 ± 4.4 smM). The dependence of relaxation rates on concentration in blood was nonlinear. Formulas from second-order polynomial fittings of the relaxation rates were calculated to characterize the relationship between R1blood and R2 blood with ferumoxytol. Ferumoxytol demonstrates strong longitudinal and transverse relaxivities. Awareness of the nonlinear relaxation behavior of ferumoxytol in blood is important for ferumoxytol-enhanced magnetic resonance imaging applications and for protocol optimization.

  6. T1 and T2 relaxivity of intracellular and extracellular USPIO at 1.5T and 3T clinical MR scanning

    International Nuclear Information System (INIS)

    Simon, Gerhard H.; Bauer, Jan; Saborovski, Olaf; Fu, Yanjun; Wendland, Michael F.; Daldrup-Link, Heike E.; Corot, Claire

    2006-01-01

    In this study we evaluated the effects of intracellular compartmentalization of the ultrasmall superparamagnetic iron oxide (USPIO) ferumoxtran-10 on its proton T1 and T2 relaxivities at 1.5 and 3T. Monocytes were labeled with ferumoxtran-10 by simple incubation. Decreasing quantities of ferumoxtran-10-labeled cells (2.5 x 10 7 -0.3 x 10 7 cells/ml) and decreasing concentrations of free ferumoxtran-10 (without cells) in Ficoll solution were evaluated with 1.5 and 3T clinical magnetic resonance (MR) scanners. Pulse sequences comprised axial spin echo (SE) sequences with multiple TRs and fixed TE and SE sequences with fixed TR and increasing TEs. Signal intensity measurements were used to calculate T1 and T2 relaxation times of all samples, assuming a monoexponential signal decay. The iron content in all samples was determined by inductively coupled plasma atomic emission spectrometry and used for calculating relaxivities. Measurements at 1.5T and 3T showed higher T1 and T2 relaxivity values of free extracellular ferumoxtran-10 as opposed to intracellularly compartmentalized ferumoxtran-10, under the evaluated conditions of homogeneously dispersed contrast agents/cells in Ficoll solution and a cell density of up to 2.5 x 10 7 cells/ml. At 3T, differences in T1-relaxivities between intra- and extracellular USPIO were smaller, while differences in USPIO T2-relaxivities were similar compared with 1.5T. In conclusion, cellular compartmentalization of ferumoxtran-10 changes proton relaxivity. (orig.)

  7. The interplay of T1- and T2-relaxation on T1-weighted MRI of hMSCs induced by Gd-DOTA-peptides.

    Science.gov (United States)

    Cao, Limin; Li, Binbin; Yi, Peiwei; Zhang, Hailu; Dai, Jianwu; Tan, Bo; Deng, Zongwu

    2014-04-01

    Three Gd-DOTA-peptide complexes with different peptide sequence are synthesized and used as T1 contrast agent to label human mesenchymal stem cells (hMSCs) for magnetic resonance imaging study. The peptides include a universal cell penetrating peptide TAT, a linear MSC-specific peptide EM7, and a cyclic MSC-specific peptide CC9. A significant difference in labeling efficacy is observed between the Gd-DOTA-peptides as well as a control Dotarem. All Gd-DOTA-peptides as well as Dotarem induce significant increase in T1 relaxation rate which is in favor of T1-weighted MR imaging. Gd-DOTA-CC9 yields the maximum labeling efficacy but poor T1 contrast enhancement. Gd-DOTA-EM7 yields the minimum labeling efficacy but better T1 contrast enhancement. Gd-DOTA-TAT yields a similar labeling efficacy as Gd-DOTA-CC9 and similar T1 contrast enhancement as Gd-DOTA-EM7. The underlying mechanism that governs T1 contrast enhancement effect is discussed. Our results suggest that T1 contrast enhancement induced by Gd-DOTA-peptides depends not only on the introduced cellular Gd content, but more importantly on the effect that Gd-DOTA-peptides exert on the T1-relaxation and T2-relaxation processes/rates. Both T1 and particularly T2 relaxation rate have to be taken into account to interpret T1 contrast enhancement. In addition, the interpretation has to be based on cellular instead of aqueous longitudinal and transverse relaxivities of Gd-DOTA-peptides. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. NMR relaxation in natural soils: Fast Field Cycling and T1-T2 Determination by IR-MEMS

    Science.gov (United States)

    Haber-Pohlmeier, S.; Pohlmeier, A.; Stapf, S.; van Dusschoten, D.

    2009-04-01

    Soils are natural porous media of highest importance for food production and sustainment of water resources. For these functions, prominent properties are their ability of water retainment and transport, which are mainly controlled by pore size distribution. The latter is related to NMR relaxation times of water molecules, of which the longitudinal relaxation time can be determined non-invasively by fast-field cycling relaxometry (FFC) and both are obtainable by inversion recovery - multi-echo- imaging (IR-MEMS) methods. The advantage of the FFC method is the determination of the field dependent dispersion of the spin-lattice relaxation rate, whereas MRI at high field is capable of yielding spatially resolved T1 and T2 times. Here we present results of T1- relaxation time distributions of water in three natural soils, obtained by the analysis of FFC data by means of the inverse Laplace transformation (CONTIN)1. Kaldenkirchen soil shows relatively broad bimodal distribution functions D(T1) which shift to higher relaxation rates with increasing relaxation field. These data are compared to spatially resolved T1- and T2 distributions, obtained by IR-MEMS. The distribution of T1 corresponds well to that obtained by FFC.

  9. Anomalous NMR Relaxation in Cartilage Matrix Components and Native Cartilage: Fractional-Order Models

    Science.gov (United States)

    Magin, Richard L.; Li, Weiguo; Velasco, M. Pilar; Trujillo, Juan; Reiter, David A.; Morgenstern, Ashley; Spencer, Richard G.

    2011-01-01

    We present a fractional-order extension of the Bloch equations to describe anomalous NMR relaxation phenomena (T1 and T2). The model has solutions in the form of Mittag-Leffler and stretched exponential functions that generalize conventional exponential relaxation. Such functions have been shown by others to be useful for describing dielectric and viscoelastic relaxation in complex, heterogeneous materials. Here, we apply these fractional-order T1 and T2 relaxation models to experiments performed at 9.4 and 11.7 Tesla on type I collagen gels, chondroitin sulfate mixtures, and to bovine nasal cartilage (BNC), a largely isotropic and homogeneous form of cartilage. The results show that the fractional-order analysis captures important features of NMR relaxation that are typically described by multi-exponential decay models. We find that the T2 relaxation of BNC can be described in a unique way by a single fractional-order parameter (α), in contrast to the lack of uniqueness of multi-exponential fits in the realistic setting of a finite signal-to-noise ratio. No anomalous behavior of T1 was observed in BNC. In the single-component gels, for T2 measurements, increasing the concentration of the largest components of cartilage matrix, collagen and chondroitin sulfate, results in a decrease in α, reflecting a more restricted aqueous environment. The quality of the curve fits obtained using Mittag-Leffler and stretched exponential functions are in some cases superior to those obtained using mono- and bi-exponential models. In both gels and BNC, α appears to account for microstructural complexity in the setting of an altered distribution of relaxation times. This work suggests the utility of fractional-order models to describe T2 NMR relaxation processes in biological tissues. PMID:21498095

  10. Temperature dependence of relaxation times in proton components of fatty acids

    International Nuclear Information System (INIS)

    Kuroda, Kagayaki; Iwabuchi, Taku; Saito, Kensuke; Obara, Makoto; Honda, Masatoshi; Imai, Yutaka

    2011-01-01

    We examined the temperature dependence of relaxation times in proton components of fatty acids in various samples in vitro at 11 tesla as a standard calibration data for quantitative temperature imaging of fat. The spin-lattice relaxation time, T 1 , of both the methylene (CH 2 ) chain and terminal methyl (CH 3 ) was linearly related to temperature (r>0.98, P 2 signal for calibration and observed the signal with 18% of CH 3 to estimate temperature. These findings suggested that separating the fatty acid components would significantly improve accuracy in quantitative thermometry for fat. Use of the T 1 of CH 2 seems promising in terms of reliability and reproducibility in measuring temperature of fat. (author)

  11. Effects of pulmonary inhalation on hyperpolarized krypton-83 magnetic resonance T1 relaxation.

    Science.gov (United States)

    Stupic, K F; Elkins, N D; Pavlovskaya, G E; Repine, J E; Meersmann, T

    2011-07-07

    The (83)Kr magnetic resonance (MR) relaxation time T(1) of krypton gas in contact with model surfaces was previously found to be highly sensitive to surface composition, surface-to-volume ratio, and surface temperature. The work presented here explored aspects of pulmonary (83)Kr T(1) relaxation measurements in excised lungs from healthy rats using hyperpolarized (hp) (83)Kr with approximately 4.4% spin polarization. MR spectroscopy without spatial resolution was applied to the ex vivo lungs that actively inhale hp (83)Kr through a custom designed ventilation system. Various inhalation schemes were devised to study the influence of anatomical dead space upon the measured (83)Kr T(1) relaxation times. The longitudinal (83)Kr relaxation times in the distal airways and the respiratory zones were independent of the lung inhalation volume, with T(1) = 1.3 s and T(1) = 1.0 s, depending only on the applied inhalation scheme. The obtained data were highly reproducible between different specimens. Further, the (83)Kr T(1) relaxation times in excised lungs were unaffected by the presence of up to 40% oxygen in the hp gas mixture. The results support the possible importance of (83)Kr as a biomarker for evaluating lung function.

  12. MR spectroscopy of liver in overweight children and adolescents: Investigation of 1H T2 relaxation times at 3 T

    International Nuclear Information System (INIS)

    Chabanova, Elizaveta; Bille, Dorthe S.; Thisted, Ebbe; Holm, Jens-Christian; Thomsen, Henrik S.

    2012-01-01

    Objective: The objective was to investigate T 2 relaxation values and to optimize hepatic fat quantification using proton MR spectroscopy ( 1 H MRS) at 3 T in overweight and obese children and adolescents. Subjects: The study included 123 consecutive children and adolescents with a body mass index above the 97th percentile according to age and sex. 1 H MR spectroscopy was performed at 3.0 T using point resolved spectroscopy sequence with series TE. T 2 relaxation values and hepatic fat content corrected for the T 2 relaxation effects were calculated. Results: T 2 values for water ranged from 22 ms to 42 ms (mean value 28 ms) and T 2 values for fat ranged from 36 ms to 99 ms (mean value 64 ms). Poor correlation was observed: (1) between T 2 relaxation times of fat and T 2 relaxation times of water (correlation coefficient r = 0.038, P = 0.79); (2) between T 2 relaxation times of fat and fat content (r = 0.057, P = 0.69); (3) between T 2 relaxation times of water and fat content (r = 0.160, P = 0.26). Correlation between fat peak content and the T 2 corrected fat content decreased with increasing echo time TE: r = 0.97 for TE = 45, r = 0.93 for TE = 75, r = 0.89 for TE = 105, P 1 H MRS at 3 T is an effective technique for measuring hepatic fat content in overweight and obese children and adolescents. It is necessary to measure T 2 relaxation values and to correct the spectra for the T 2 relaxation effects in order to obtain an accurate estimate of the hepatic fat content.

  13. The application of T1 and T2 relaxation time and magnetization transfer ratios to the early diagnosis of patellar cartilage osteoarthritis

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Weiwu; Qu, Nan; Lu, Zhihua; Yang, Shixun [Shanghai Jiaotong University, Department of Radiology, Shanghai (China)

    2009-11-15

    We compare the T1 and T2 relaxation times and magnetization transfer ratios (MTRs) of normal subjects and patients with osteoarthritis (OA) to evaluate the ability of these techniques to aid in the early diagnosis and treatment of OA. The knee joints in 11 normal volunteers and 40 patients with OA were prospectively evaluated using T1 relaxation times as measured using delayed gadolinium-enhanced MRI of cartilage (dGEMRIC), T2 relaxation times (multiple spin-echo sequence, T2 mapping), and MTRs. The OA patients were further categorized into mild, moderate, and severe OA. The mean T1 relaxation times of the four groups (normal, mild OA, moderate OA, and severe OA) were: 487.3{+-}27.7, 458.0{+-}55.9, 405.9{+-}57.3, and 357.9{+-}36.7 respectively (p<0.001). The mean T2 relaxation times of the four groups were: 37.8{+-}3.3, 44.0{+-}8.5, 50.9{+-}9.5, and 57.4{+-}4.8 respectively (p<0.001). T1 relaxation time decreased and T2 relaxation time increased with worsening degeneration of patellar cartilage. The result of the covariance analysis showed that the covariate age had a significant influence on T2 relaxation time (p<0.001). No significant differences between the normal and OA groups using MTR were noted. T1 and T2 relaxation times are relatively sensitive to early degenerative changes in the patellar cartilage, whereas the MTR may have some limitations with regard to early detection of OA. In addition, The T1 and T2 relaxation times negatively correlate with each other, which is a novel finding. (orig.)

  14. In-vivo measurement of proton relaxation time (T1 and T2) in paediatric brain by MRI

    International Nuclear Information System (INIS)

    Masumura, Michio

    1986-01-01

    The clinical application of MRI led to the detailed imaging of the three-dimentional structure of the brain. Thus, significant information has been obtained with respect to the diagnosis of various diseases, rating severity, evaluation of curative effects, etc. On the other hand, the proportion of the comparative length of the relaxation time to the signal intensity of the images (especially the Spin-Echo image) was not necessarily linear. Consquently, the evaluation of severity was not easy to make. However, if we can obtain T 1 and T 2 precisely as the parameters costituting the images, it will be possible to overcome the above-mentioned difficulties. Further, the usefulness of MRI in activities such as determining the water metabolism of the brain is expected to increase even more. By means of VISTA-MR (0.15 Tesla, resistive magnet ; Picker International Co.) we measured the proton relaxation time (spin-lattice relaxation time (T 1 ) and spin-spin relaxation time (T 2 )) of various intracerebral lesions in paediatric cases. As the control group, 43 children, 4 adolescents and 6 adults were used. The T 1 and T 2 in the normal infantile cases prolonged significantly as compared with adult case. Thereafter, they become shortened by aging. In the age of two or three years, they reach the normal level of adult case. In the cases of degenerative disease, brain tumor, and cerebral contusion, the remarkable prolongation of both T 1 and T 2 , compared with normal value of the same age was observed. In the cases of brain atrophy and epilepsy, T 1 and T 2 were slightly short or within normal value of the same age. In the cases of intracerebral hemorrhage, T 1 was shortened. The in-vivo proton relaxation time obtained by MRI have various limits, but they can be a noninvasive and useful index in evaluation of severity or curative effects in various cerebral diseases. (author)

  15. Prolonged bone marrow T1-relaxation in patients with polycythemia vera

    DEFF Research Database (Denmark)

    Jensen, K E; Grube, T; Thomsen, C

    1988-01-01

    In vitro as well as in vivo studies have shown prolonged T1 relaxation times in patients with acute leukemia. The mechanism behind this finding is not known. In order to evaluate if this was specific for leukemia we examined eight patients with polycythemia vera, representing a condition with a r......In vitro as well as in vivo studies have shown prolonged T1 relaxation times in patients with acute leukemia. The mechanism behind this finding is not known. In order to evaluate if this was specific for leukemia we examined eight patients with polycythemia vera, representing a condition...

  16. T1rho and T2 relaxation times of the normal adult knee meniscus at 3T: analysis of zonal differences.

    Science.gov (United States)

    Takao, Shoichiro; Nguyen, Tan B; Yu, Hon J; Hagiwara, Shigeo; Kaneko, Yasuhito; Nozaki, Taiki; Iwamoto, Seiji; Otomo, Maki; Schwarzkopf, Ran; Yoshioka, Hiroshi

    2017-05-18

    Prior studies describe histological and immunohistochemical differences in collagen and proteoglycan content in different meniscal zones. The aim of this study is to evaluate horizontal and vertical zonal differentiation of T1rho and T2 relaxation times of the entire meniscus from volunteers without symptom and imaging abnormality. Twenty volunteers age between 19 and 38 who have no knee-related clinical symptoms, and no history of prior knee surgeries were enrolled in this study. Two T1rho mapping (b-FFE T1rho and SPGR T1rho) and T2 mapping images were acquired with a 3.0-T MR scanner. Each meniscus was divided manually into superficial and deep zones for horizontal zonal analysis. The anterior and posterior horns of each meniscus were divided manually into white, red-white and red zones for vertical zonal analysis. Zonal differences of average relaxation times among each zone, and both inter- and intra-observer reproducibility were statistically analyzed. In horizontal zonal analysis, T1rho relaxation times of the superficial zone tended to be higher than those of the deep zone, and this difference was statistically significant in the medial meniscal segments (84.3 ms vs 76.0 ms on b-FFE, p meniscus (88.4 ms vs 77.1 ms on b-FFE, p meniscus, p = 0.011). T2 relaxation times of the white zone were significantly higher than those of the red zone in the medial meniscus posterior horn (96.8 ms vs 84.3 ms, p meniscus anterior horn (104.6 ms vs 84.2 ms, p 0.74) or good (0.60-0.74) in all meniscal segments on both horizontal and vertical zonal analysis, except for inter-class correlation coefficients of the lateral meniscus on SPGR. Compared with SPGR T1rho images, b-FFE T1rho images demonstrated more significant zonal differentiation with higher inter- and intra-observer reproducibility. There are zonal differences in T1rho and T2 relaxation times of the normal meniscus.

  17. On aggregation of relaxed T-indistinguishability operators

    Energy Technology Data Exchange (ETDEWEB)

    Fuster-Parra, P.

    2017-07-01

    The notion of T -indistinguishability operator was introduced by E. Trillas in [7] with the aim of fuzzifying the classical (crisp) notion of equivalence relation. Relaxed metrics and indistinguishability operators are closely related. Indeed, in [1] it has been stated that the logical counterpart for relaxed metrics is, in some sense, a generalized indistinguishability operator (relaxed T -indistinguishability operator). Notice that the notion of T -indistinguishability operator is retrieved as a particular case of relaxed T -indistinguishability operator whenever the relaxed T - indistinguishability operator satisfies also the reflexivity. In fact, a relaxed indistinguishability operator is a indistinguishability operator if and only if it holds the reflexivity. The same occurs when we consider T -indistinguishability operator that separates points. Several authors have studied the aggregation of some classes of fuzzy relations (see [3, 4, 5, 6]), where it is stated that transitivity is one of the most important properties of a fuzzy relation. In [5] a study of aggregation of T-indistinguishability operators is presented, motivated by this work the aim of this study is to analyze the case of aggregating relaxed T-indistinguishability operators. (Author)

  18. T2 relaxation time mapping of the cartilage cap of osteochondromas

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hee Kyung; Horn, Paul; Laor, Tal [Cincinnati Children' s Hospital Medical Center, Cincinnati (United States); Daedzinski, Bernard J. [Dept. of Radiology, Children' s Hospital of Philadelphia, University of Pennsylvania, Philadelphia (United States); Kim, Dong Hoon [Dept. of Radiology, Pharmacology, Korea University College of Medicine, Seoul (Korea, Republic of)

    2016-02-15

    Our aim was to evaluate the cartilage cap of osteochondromas using T2 maps and to compare these values to those of normal patellar cartilage, from age and gender matched controls. This study was approved by the Institutional Review Board and request for informed consent was waived. Eleven children (ages 5-17 years) with osteochondromas underwent MR imaging, which included T2-weighted fat suppressed and T2 relaxation time mapping (echo time = 9-99/repetition time = 1500 msec) sequences. Lesion origins were femur (n = 5), tibia (n = 3), fibula (n = 2), and scapula (n = 1). Signal intensity of the cartilage cap, thickness, mean T2 relaxation times, and T2 spatial variation (mean T2 relaxation times as a function of distance) were evaluated. Findings were compared to those of patellar cartilage from a group of age and gender matched subjects. The cartilage caps showed a fluid-like high T2 signal, with mean thickness of 4.8 mm. The mean value of mean T2 relaxation times of the osteochondromas was 264.0 ± 80.4 msec (range, 151.0-366.0 msec). Mean T2 relaxation times were significantly longer than the values from patellar cartilage (39.0 msec) (p < 0.0001). These findings were observed with T2 spatial variation plots across the entire distance of the cartilage cap, with the most pronounced difference in the middle section of the cartilage. Longer T2 relaxation times of the cartilage caps of osteochondromas should be considered as normal, and likely to reflect an increased water content, different microstructure and component.

  19. T2 relaxation time mapping of the cartilage cap of osteochondromas

    International Nuclear Information System (INIS)

    Kim, Hee Kyung; Horn, Paul; Laor, Tal; Daedzinski, Bernard J.; Kim, Dong Hoon

    2016-01-01

    Our aim was to evaluate the cartilage cap of osteochondromas using T2 maps and to compare these values to those of normal patellar cartilage, from age and gender matched controls. This study was approved by the Institutional Review Board and request for informed consent was waived. Eleven children (ages 5-17 years) with osteochondromas underwent MR imaging, which included T2-weighted fat suppressed and T2 relaxation time mapping (echo time = 9-99/repetition time = 1500 msec) sequences. Lesion origins were femur (n = 5), tibia (n = 3), fibula (n = 2), and scapula (n = 1). Signal intensity of the cartilage cap, thickness, mean T2 relaxation times, and T2 spatial variation (mean T2 relaxation times as a function of distance) were evaluated. Findings were compared to those of patellar cartilage from a group of age and gender matched subjects. The cartilage caps showed a fluid-like high T2 signal, with mean thickness of 4.8 mm. The mean value of mean T2 relaxation times of the osteochondromas was 264.0 ± 80.4 msec (range, 151.0-366.0 msec). Mean T2 relaxation times were significantly longer than the values from patellar cartilage (39.0 msec) (p < 0.0001). These findings were observed with T2 spatial variation plots across the entire distance of the cartilage cap, with the most pronounced difference in the middle section of the cartilage. Longer T2 relaxation times of the cartilage caps of osteochondromas should be considered as normal, and likely to reflect an increased water content, different microstructure and component

  20. Multicomponent T2 relaxation studies of the avian egg.

    Science.gov (United States)

    Mitsouras, Dimitris; Mulkern, Robert V; Maier, Stephan E

    2016-05-01

    To investigate the tissue-like multiexponential T2 signal decays in avian eggs. Transverse relaxation studies of raw, soft-boiled and hard-boiled eggs were performed at 3 Tesla using a three-dimensional Carr-Purcell-Meiboom-Gill imaging sequence. Signal decays over a TE range of 11 to 354 ms were fitted assuming single- and multicomponent signal decays with up to three separately decaying components. Fat saturation was used to facilitate spectral assignment of observed decay components. Egg white, yolk and the centrally located latebra all demonstrate nonmonoexponential T2 decays. Specifically, egg white exhibits two-component decays with intermediate and long T2 times. Meanwhile, yolk and latebra are generally best characterized with triexponential decays, with short, intermediate and very long T2 decay times. Fat saturation revealed that the intermediate component of yolk could be attributed to lipids. Cooking of the egg profoundly altered the decay curves. Avian egg T2 decay curves cover a wide range of decay times. Observed T2 components in yolk and latebra as short as 10 ms, may prove valuable for testing clinical sequences designed to measure short T2 components, such as myelin-associated water in the brain. Thus we propose that the egg can be a versatile and widely available MR transverse relaxation phantom. © 2015 Wiley Periodicals, Inc.

  1. Amide proton transfer (APT) imaging of brain tumors at 7 T : The role of tissue water T1 -Relaxation properties

    NARCIS (Netherlands)

    Khlebnikov, V; Polders, Daniel; Hendrikse, J; Robe, Pierre A.; Voormolen, Eduard H; Luijten, Peter R; Klomp, DWJ; Hoogduin, Hans

    PURPOSE: To provide insight into the effect of water T1 relaxation (T1wat ) on amide proton transfer (APT) contrast in tumors. Three different metrics of APT contrast-magnetization transfer ratio (MTRRex ), relaxation-compensated MTRRex (AREX), and traditional asymmetry (MTRasym )-were compared in

  2. TOMROP: a sequence for determining the longitudinal relaxation time T1 in NMR

    International Nuclear Information System (INIS)

    Graumann, R.; Barfuss, H.; Fischer, H.; Hentschel, D.; Oppelt, A.

    1987-01-01

    We developed the pulse sequence TOMROP (T One by Multiple Read Out Pulses) for determining precisely the spatial distribution of the longitudinal relaxation time T 1 in nuclear magnetic resonance (NMR): a series of small-angle selection pulses is used to read out longitudinal magnetization from its initial state till thermal equilibrium. Hence, one measurement will produce several images with different T 1 weightings whose pixel brilliance depends exponentially from read-out time. T 1 can be determined from these independent of initial magnetization and selection pulse angle. The measuring time corresponds to the time needed in multi-echo imaging for the determination of the transversal relaxation time T 2 . We demonstrate this new method using head images of volunteers produced with a 0.23 T test facility. (orig./HP) [de

  3. Low-Field NMR Spectrometry of Chalk and Argillaceous Sandstones: Rock-Fluid Affinity Assessed from T-1/T-2 Ratio

    DEFF Research Database (Denmark)

    Katika, Konstantina; Saidian, Milad; Prasad, Manika

    2017-01-01

    greensand shows different behavior for small and large pores. Small pores (fast-relaxing components) have T-1/T-2 = 2.0 when water saturated, but T-1/T-2 = 3.8 when oil saturated, indicating oil-affinity of chlorite. By contrast, large pores (slow-relaxing components) have significant preference for water...

  4. In vivo measurements of T1 relaxation times of 31P-metabolites in human skeletal muscle

    DEFF Research Database (Denmark)

    Thomsen, C; Jensen, K E; Henriksen, O

    1989-01-01

    The T1 relaxation times were estimated for 31P-metabolites in human skeletal muscle. Five healthy volunteers were examined in a 1.5 Tesla wholebody imaging system using an inversion recovery pulse sequence. The calculated T1 relaxation times ranged from 5.517 sec for phosphocreatine to 3.603 sec...

  5. Relaxation times T1, T2, and T2* of apples, pears, citrus fruits, and potatoes with a comparison to human tissues

    International Nuclear Information System (INIS)

    Werz, Karin; Braun, Hans; Vitha, Dominik; Bruno, Graziano; Martirosian, Petros; Steidle, Guenter; Schick, Fritz

    2011-01-01

    The aim of the project was a systematic assessment of relaxation times of different fruits and vegetables and a comparison to values of human tissues. Results provide an improved basis for selection of plant phantoms for development of new MR techniques and sequences. Vessels filled with agar gel are mostly used for this purpose, preparation of which is effortful and time-consuming. In the presented study apples, (malus, 8 species), pears, (pyrus, 2 species), citrus fruits (citrus, 5 species) and uncooked potatoes (solanum tuberosum, 8 species) from the supermarket were examined which are easily available nearly all-the-year. T1, T2 and T2 * relaxation times of these nature products were measured on a 1.5 Tesla MR system with adapted examination protocols and mono-exponential fitting, and compared to literature data of human parenchyma tissues, fatty tissue and body fluid (cerebrospinal fluid). Resulting values were as follows: apples: T1: 1486 - 1874 ms, T2: 163 - 281 ms, T2 * : 2,3 - 3,2 ms; pears: T1: 1631 - 1969 ms, T2: 119 - 133 ms, T2 * : 10,1 - 10,6 ms, citrus fruits (pulp) T1: 2055 - 2632 ms, T2: 497 - 998 ms, T2 * : 151 - 182 ms; citrus fruits (skin) T1: 561 - 1669 ms, T2: 93 - 119 ms; potatoes: T1: 1011 - 1459 ms, T2: 166 - 210 ms, T2 * : 20 - 30 ms. All T1-values of the examined objects (except for potatoes and skins of citrus fruits) were longer than T1 values of human tissues. Also T2 values (except for pears and skins of citrus fruits) of the fruits and the potatoes tended to be longer. T2 * values of apples, pears and potatoes were shorter than in healthy human tissue. Results show relaxation values of many fruits to be not exactly fitting to human tissue, but with suitable selection of the fruits and optionally with an adaption of measurement parameters one can achieve suitable contrast and signal characteristics for some purposes. (orig.)

  6. Prolonged T1 relaxation of the hemopoietic bone marrow in patients with chronic leukemia

    International Nuclear Information System (INIS)

    Jensen, K.E.; Soerensen, P.G.; Thomsen, C.; Christoffersen, P.; Henriksen, O.; Karle, H.; Hvidovre Hospital; Hvidovre Hospital; Gentofte Hospital

    1990-01-01

    Eleven patients with chronic leukemia (7 with chronic lymphocytic leukemia and 4 with chronic myeloid leukemia) were evaluated with magnetic resonance (MR) imaging and T1 relaxation time measurements by use of a 1.5 tesla whole body MR scanner. Bone marrow biopsies were obtained from the posterior iliac crest (within 72 hours of the MR examination) in order to provide data on bone marrow cellularity and differential counts. The patients with chronic leukemia all showed a significant prolongation of the T1 relaxation times compared with the normal range for hemopoietic bone marrow. (orig.)

  7. Prolonged bone marrow T1-relaxation in acute leukaemia. In vivo tissue characterization by magnetic resonance imaging

    DEFF Research Database (Denmark)

    Thomsen, C; Sørensen, P G; Karle, H

    1987-01-01

    In vivo tissue characterization by measurement of T1- and T2-relaxation processes is one of the greatest potentials of magnetic resonance imaging (MRI). This may be especially useful in the evaluation of bone marrow disorders as the MRI-signal from bone marrow is not influenced by the overlying...... osseous tissue. Nine patients with acute leukaemia, one patient with myelodysplastic syndrome, and ten normal volunteers were included in the study. The T1- and T2-relaxation processes were measured in the lumbar spine bone marrow using a wholebody superconductive MR-scanner operating at 1.5 Tesla.......38-0.60 sec.). No significant difference was seen in the T2-relaxation process. In relation to chemotherapy T1 decreased towards the normal range in the patients who obtained complete remission, whereas T1 remained prolonged in the patients who did not respond successfully to the treatment. The results...

  8. Intraindividual comparison of T1 relaxation times after gadobutrol and Gd-DTPA administration for cardiac late enhancement imaging

    Energy Technology Data Exchange (ETDEWEB)

    Doeblin, Patrick, E-mail: Patrick.doeblin@charite.de [Department of Cardiology, Charité – Universitätsmedizin Berlin, Charité Campus Benjamin Franklin, Berlin (Germany); Schilling, Rene, E-mail: rene.schilling@charite.de [Department of Radiology, Charité – Universitätsmedizin Berlin, Charité Campus Mitte, Berlin (Germany); Wagner, Moritz, E-mail: moritz.wagner@charite.de [Department of Radiology, Charité – Universitätsmedizin Berlin, Charité Campus Mitte, Berlin (Germany); Luhur, Reny, E-mail: renyluhur@yahoo.com [Department of Radiology, Charité – Universitätsmedizin Berlin, Charité Campus Mitte, Berlin (Germany); Huppertz, Alexander, E-mail: alexander.huppertz@charite.de [Department of Radiology, Charité – Universitätsmedizin Berlin, Charité Campus Mitte, Berlin (Germany); Imaging Science Institute, Charité, Berlin (Germany); Hamm, Bernd, E-mail: bernd.hamm@charite.de [Department of Radiology, Charité – Universitätsmedizin Berlin, Charité Campus Mitte, Berlin (Germany); Taupitz, Matthias, E-mail: matthias.taupitz@harite.de [Department of Radiology, Charité – Universitätsmedizin Berlin, Charité Campus Mitte, Berlin (Germany); and others

    2014-04-15

    Purpose: To evaluate T1-relaxation times of chronic myocardial infarction (CMI) using gadobutrol and gadopentetate dimeglumine (Gd-DTPA) over time and to determine the optimal imaging window for late enhancement imaging with both contrast agents. Material and methods: Twelve patients with CMI were prospectively included and examined on a 1.5 T magnetic resonance (MR) system using relaxivity-adjusted doses of gadobutrol (0.15 mmol/kg) and Gd-DTPA (0.2 mmol/kg) in random order. T1-relaxation times of remote myocardium (RM), infarcted myocardium (IM), and left ventricular cavity (LVC) were assessed from short-axis TI scout imaging using the Look–Locker approach and compared intraindividually using a Wilcoxon paired signed-rank test (α < 0.05). Results: Within 3 min of contrast agent administration (CA), IM showed significantly lower T1-relaxation times than RM with both contrast agents, indicating beginning cardiac late enhancement. Differences between gadobutrol and Gd-DTPA in T1-relaxation times of IM and RM were statistically not significant through all time points. However, gadobutrol led to significantly higher T1-relaxation times of LVC than Gd-DTPA from 6 to 9 min (220 ± 15 ms vs. 195 ± 30 ms p < 0.01) onwards, resulting in a significantly greater ΔT1 of IM to LVC at 9–12 min (−20 ± 35 ms vs. 0 ± 35 ms, p < 0.05) and 12–15 min (−25 ± 45 ms vs. −10 ± 60 ms, p < 0.05). Using Gd-DTPA, comparable ΔT1 values were reached only after 25–35 min. Conclusion: This study indicates good delineation of IM to RM with both contrast agents as early as 3 min after administration. However, we found significant differences in T1 relaxation times with greater ΔT1 IM–LVC using 0.15 mmol/kg gadobutrol compared to 0.20 mmol/kg Gd-DTPA after 9–15 min post-CA suggesting earlier differentiability of IM and LVC using gadobutrol.

  9. Electromechanical delay components during skeletal muscle contraction and relaxation in patients with myotonic dystrophy type 1.

    Science.gov (United States)

    Esposito, Fabio; Cè, Emiliano; Rampichini, Susanna; Limonta, Eloisa; Venturelli, Massimo; Monti, Elena; Bet, Luciano; Fossati, Barbara; Meola, Giovanni

    2016-01-01

    The electromechanical delay during muscle contraction and relaxation can be partitioned into mainly electrochemical and mainly mechanical components by an EMG, mechanomyographic, and force combined approach. Component duration and measurement reliability were investigated during contraction and relaxation in a group of patients with myotonic dystrophy type 1 (DM1, n = 13) and in healthy controls (n = 13). EMG, mechanomyogram, and force were recorded in DM1 and in age- and body-matched controls from tibialis anterior (distal muscle) and vastus lateralis (proximal muscle) muscles during maximum voluntary and electrically-evoked isometric contractions. The electrochemical and mechanical components of the electromechanical delay during muscle contraction and relaxation were calculated off-line. Maximum strength was significantly lower in DM1 than in controls under both experimental conditions. All electrochemical and mechanical components were significantly longer in DM1 in both muscles. Measurement reliability was very high in both DM1 and controls. The high reliability of the measurements and the differences between DM1 patients and controls suggest that the EMG, mechanomyographic, and force combined approach could be utilized as a valid tool to assess the level of neuromuscular dysfunction in this pathology, and to follow the efficacy of pharmacological or non-pharmacological interventions. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Changes in T1 relaxation processes in the bone marrow following treatment in children with acute lymphoblastic leukemia

    International Nuclear Information System (INIS)

    Jensen, K.E.; Thomsen, C.; Henriksen, O.; Hertz, H.; Johansen, H.K.; Yssing, M.

    1990-01-01

    Magnetic resonance imaging (MRI) and T 1 relaxation time measurements of the vertebral bone marrow were performed in 11 children with acute lymphoblastic leukemia (ALL) at diagnosis. Nine of the children were re-examined after chemotherapeutic treatment. The results were compared with histological data from bone marrow biopsies obtained in close association to the MR examinations. Ten age matched children were examined as a control group. A 1.5 Tesla whole body scanner was used for the measurements. The pretreatment T 1 relaxation times of the bone marrow were significantly prolonged, compared to the age matched controls. After chemotherapy the T 1 relaxation times of the children with ALL decreased significantly towards or into the normal range. A significant correlation was found between the T 1 relaxation time and the content of malignant blast cells in the bone marrow. (orig.)

  11. Magnetic resonance imaging of the bone marrow in patients with acute leukemia during and after chemotherapy. Changes in T1 relaxation

    DEFF Research Database (Denmark)

    Jensen, K E; Grundtvig Sørensen, P; Thomsen, C

    1990-01-01

    Twenty-seven patients with acute leukemia were examined at the time of diagnosis with MR imaging and in vivo T1 relaxation time measurements of the hemopoietic bone marrow. A 1.5 T whole body magnetic resonance scanner was used. Twenty of the patients had follow-up examinations in relation...... to chemotherapy. Bone marrow biopsies from the posterior iliac crest were obtained within a short time interval of all MR examinations. At the time of diagnosis, T1 relaxation times were increased significantly in all the leukemic patients, compared with 24 age-matched controls. A decrease in T1 relaxation time......, also showed prolongation of T1 relaxation time in relation to leukemic relapse. The results indicate that changes observed in T1 relaxation times of the hemopoietic bone marrow in patients with acute leukemia reflect changes in disease activity, and, that serial measurements of T1 values may provide...

  12. T1 nuclear magnetic relaxation dispersion of hyperpolarized sodium and cesium hydrogencarbonate-13 C.

    Science.gov (United States)

    Martínez-Santiesteban, Francisco M; Dang, Thien Phuoc; Lim, Heeseung; Chen, Albert P; Scholl, Timothy J

    2017-09-01

    In vivo pH mapping in tissue using hyperpolarized hydrogencarbonate- 13 C has been proposed as a method to study tumor growth and treatment and other pathological conditions related to pH changes. The finite spin-lattice relaxation times (T 1 ) of hyperpolarized media are a significant limiting factor for in vivo imaging. Relaxation times can be measured at standard magnetic fields (1.5 T, 3.0 T etc.), but no such data are available at low fields, where T 1 values can be significantly shorter. This information is required to determine the potential loss of polarization as the agent is dispensed and transported from the polarizer to the MRI scanner. The purpose of this study is to measure T 1 dispersion from low to clinical magnetic fields (0.4 mT to 3.0 T) of different hyperpolarized hydrogencarbonate formulations previously proposed in the literature for in vivo pH measurements. 13 C-enriched cesium and sodium hydrogencarbonate preparations were hyperpolarized using dynamic nuclear polarization, and the T 1 values of different samples were measured at different magnetic field strengths using a fast field-cycling relaxometer and a 3.0 T clinical MRI system. The effects of deuterium oxide as a dissolution medium for sodium hydrogencarbonate were also analyzed. This study finds that the cesium formulation has slightly shorter T 1 values compared with the sodium preparation. However, the higher solubility of cesium hydrogencarbonate- 13 C means it can be polarized at greater concentration, using less trityl radical than sodium hydrogencarbonate- 13 C. This study also establishes that the preparation and handling of sodium hydrogencarbonate formulations in relation to cesium hydrogencarbonate is more difficult, due to the higher viscosity and lower achievable concentrations, and that deuterium oxide significantly increases the T 1 of sodium hydrogencarbonate solutions. Finally, this work also investigates the influence of pH on the spin-lattice relaxation of cesium

  13. Instrumentation problems in the measurement of relaxation time T1 in MRI

    International Nuclear Information System (INIS)

    Leroy-Willig, A.; Roucayrol, J.C.; Bittoun, J.; Courtieu, J.

    1986-01-01

    Longitudinal relaxation (T 1 ) of protons is a sensitive though non specific tool of tissue characterization. T 1 measurement from magnetic resonance images is unprecise, due to several phenomena that we review: time intervals shorter than in spectroscopic sequences; flip angle inhomogeneity; slice selection and spin echoes. In vivo the molecular inhomogeneity can prevent to measure a true T 1 ; motion and blood flow are important causes of errors. The relative effects of these factors are examined from in vitro and in vivo images acquired at 1.5 T. From a mono-echo single-slice saturation sequence reliable values of T 1 are obtained in vitro, the measurement time being compatible with clinical imaging. In vivo, problems due to various causes of motions are still unresolved [fr

  14. In vivo measurements of the T1 relaxation processes in the bone marrow in patients with myelodysplastic syndrome

    International Nuclear Information System (INIS)

    Jensen, K.E.; Nielsen, H.; Thomsen, C.; Soerensen, P.G.; Karle, H.; Christoffersen, P.; Henriksen, O.; Hvidovre Hospital, Copenhagen; Hvidovre Hospital, Copenhagen

    1989-01-01

    Nine patients with myelodysplastic syndrome (MDS) were examined with magnetic resonance imaging and in vivo T1 relaxation time measurements of the vertebral bone marrow in a 1.5 tesla whole body scanner. Two patients underwent transformation to acute myeloid leukemia and were evaluated at follow-up examinations. At the time of diagnosis the T1 relaxation times of the vertebral bone marrow were significantly prolonged compared with normal values. The T1 relaxation times of the vertebral bone marrow in patients with MDS showed significantly lower values compared with patients with acute leukemia and did not differ from patients with polycythemia vera. (orig.)

  15. Musculoskeletal MRI at 3.0 T and 7.0 T: A comparison of relaxation times and image contrast

    International Nuclear Information System (INIS)

    Jordan, Caroline D.; Saranathan, Manojkumar; Bangerter, Neal K.; Hargreaves, Brian A.; Gold, Garry E.

    2013-01-01

    Objective: The purpose of this study was to measure and compare the relaxation times of musculoskeletal tissues at 3.0 T and 7.0 T, and to use these measurements to select appropriate parameters for musculoskeletal protocols at 7.0 T. Materials and methods: We measured the T 1 and T 2 relaxation times of cartilage, muscle, synovial fluid, bone marrow and subcutaneous fat at both 3.0 T and 7.0 T in the knees of five healthy volunteers. The T 1 relaxation times were measured using a spin-echo inversion recovery sequence with six inversion times. The T 2 relaxation times were measured using a spin-echo sequence with seven echo times. The accuracy of both the T 1 and T 2 measurement techniques was verified in phantoms at both magnetic field strengths. We used the measured relaxation times to help design 7.0 T musculoskeletal protocols that preserve the favorable contrast characteristics of our 3.0 T protocols, while achieving significantly higher resolution at higher SNR efficiency. Results: The T 1 relaxation times in all tissues at 7.0 T were consistently higher than those measured at 3.0 T, while the T 2 relaxation times at 7.0 T were consistently lower than those measured at 3.0 T. The measured relaxation times were used to help develop high resolution 7.0 T protocols that had similar fluid-to-cartilage contrast to that of the standard clinical 3.0 T protocols for the following sequences: proton-density-weighted fast spin-echo (FSE), T 2 -weighted FSE, and 3D-FSE-Cube. Conclusion: The T 1 and T 2 changes were within the expected ranges. Parameters for musculoskeletal protocols at 7.0 T can be optimized based on these values, yielding improved resolution in musculoskeletal imaging with similar contrast to that of standard 3.0 T clinical protocols

  16. In vivo relaxation time measurements on a murine tumor model--prolongation of T1 after photodynamic therapy.

    Science.gov (United States)

    Liu, Y H; Hawk, R M; Ramaprasad, S

    1995-01-01

    RIF tumors implanted on mice feet were investigated for changes in relaxation times (T1 and T2) after photodynamic therapy (PDT). Photodynamic therapy was performed using Photofrin II as the photosensitizer and laser light at 630 nm. A home-built proton solenoid coil in the balanced configuration was used to accommodate the tumors, and the relaxation times were measured before, immediately after, and up to several hours after therapy. Several control experiments were performed untreated tumors, tumors treated with Photofrin II alone, or tumors treated with laser light alone. Significant increases in T1s of water protons were observed after PDT treatment. In all experiments, 31P spectra were recorded before and after the therapy to study the tumor status and to confirm the onset of PDT. These studies show significant prolongation of T1s after the PDT treatment. The spin-spin relaxation measurements, on the other hand, did not show such prolongation in T2 values after PDT treatment.

  17. Gd-DTPA T1 relaxivity in brain tissue obtained by convection-enhanced delivery, magnetic resonance imaging and emission spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Haar, Peter J [Department of Anatomy and Neurobiology, Virginia Commonwealth University, Richmond, VA (United States); Broaddus, William C; Chen Zhijian; Gillies, George T [Department of Neurosurgery, Virginia Commonwealth University, Richmond, VA (United States); Fatouros, Panos P; Corwin, Frank D, E-mail: wbroaddus@mcvh-vcu.ed [Department of Radiology, Virginia Commonwealth University, Richmond, VA (United States)

    2010-06-21

    A common approach to quantify gadolinium (Gd) contrast agents involves measuring the post-contrast change in T1 rate and then using the constant T1 relaxivity R to determine the contrast agent concentration. Because this method is fast and non-invasive, it could be potentially valuable in many areas of brain research. However, to accurately measure contrast agent concentrations in the brain, the T1 relaxivity R of the specific agent must be accurately known. Furthermore, the macromolecular content and compartmentalization of the brain extracellular space (ECS) are expected to significantly alter R from values measured in aqueous solutions. In this study, the T1 relaxivity R of gadolinium-diethylene-triamine penta-acetic acid (Gd-DTPA) was measured following direct interstitial infusions of three different contrast agent concentrations to the parenchyma of rat brains. Changes in magnetic resonance (MR) T1 values were compared to brain slice concentrations determined with inductively coupled plasma atomic emission spectroscopy (ICP-AES) to determine R in 15 rats. Additionally, samples of cerebrospinal fluid, blood and urine were analyzed to evaluate possible Gd-DTPA clearance from the brain. The T1 relaxivity R of Gd-DTPA in the brain ECS was measured to be 5.35 (mM s){sup -1} in a 2.4 T field. This value is considerably higher than estimations used in studies by other groups. Measurements of brain Gd-DTPA tissue concentrations using MRI and ICP-AES demonstrated a high degree of coincidence. Clearance of Gd-DTPA was minimal at the time point immediately after infusion. These results suggest that the environment of the brain does in fact significantly affect Gd T1 relaxivity, and that MRI can accurately measure contrast agent concentrations when this relaxivity is well characterized.

  18. Gd-DTPA T1 relaxivity in brain tissue obtained by convection-enhanced delivery, magnetic resonance imaging and emission spectroscopy

    Science.gov (United States)

    Haar, Peter J.; Broaddus, William C.; Chen, Zhi-jian; Fatouros, Panos P.; Gillies, George T.; Corwin, Frank D.

    2010-06-01

    A common approach to quantify gadolinium (Gd) contrast agents involves measuring the post-contrast change in T1 rate and then using the constant T1 relaxivity R to determine the contrast agent concentration. Because this method is fast and non-invasive, it could be potentially valuable in many areas of brain research. However, to accurately measure contrast agent concentrations in the brain, the T1 relaxivity R of the specific agent must be accurately known. Furthermore, the macromolecular content and compartmentalization of the brain extracellular space (ECS) are expected to significantly alter R from values measured in aqueous solutions. In this study, the T1 relaxivity R of gadolinium-diethylene-triamine penta-acetic acid (Gd-DTPA) was measured following direct interstitial infusions of three different contrast agent concentrations to the parenchyma of rat brains. Changes in magnetic resonance (MR) T1 values were compared to brain slice concentrations determined with inductively coupled plasma atomic emission spectroscopy (ICP-AES) to determine R in 15 rats. Additionally, samples of cerebrospinal fluid, blood and urine were analyzed to evaluate possible Gd-DTPA clearance from the brain. The T1 relaxivity R of Gd-DTPA in the brain ECS was measured to be 5.35 (mM s)-1 in a 2.4 T field. This value is considerably higher than estimations used in studies by other groups. Measurements of brain Gd-DTPA tissue concentrations using MRI and ICP-AES demonstrated a high degree of coincidence. Clearance of Gd-DTPA was minimal at the time point immediately after infusion. These results suggest that the environment of the brain does in fact significantly affect Gd T1 relaxivity, and that MRI can accurately measure contrast agent concentrations when this relaxivity is well characterized.

  19. Gd-DTPA T1 relaxivity in brain tissue obtained by convection-enhanced delivery, magnetic resonance imaging and emission spectroscopy

    International Nuclear Information System (INIS)

    Haar, Peter J; Broaddus, William C; Chen Zhijian; Gillies, George T; Fatouros, Panos P; Corwin, Frank D

    2010-01-01

    A common approach to quantify gadolinium (Gd) contrast agents involves measuring the post-contrast change in T1 rate and then using the constant T1 relaxivity R to determine the contrast agent concentration. Because this method is fast and non-invasive, it could be potentially valuable in many areas of brain research. However, to accurately measure contrast agent concentrations in the brain, the T1 relaxivity R of the specific agent must be accurately known. Furthermore, the macromolecular content and compartmentalization of the brain extracellular space (ECS) are expected to significantly alter R from values measured in aqueous solutions. In this study, the T1 relaxivity R of gadolinium-diethylene-triamine penta-acetic acid (Gd-DTPA) was measured following direct interstitial infusions of three different contrast agent concentrations to the parenchyma of rat brains. Changes in magnetic resonance (MR) T1 values were compared to brain slice concentrations determined with inductively coupled plasma atomic emission spectroscopy (ICP-AES) to determine R in 15 rats. Additionally, samples of cerebrospinal fluid, blood and urine were analyzed to evaluate possible Gd-DTPA clearance from the brain. The T1 relaxivity R of Gd-DTPA in the brain ECS was measured to be 5.35 (mM s) -1 in a 2.4 T field. This value is considerably higher than estimations used in studies by other groups. Measurements of brain Gd-DTPA tissue concentrations using MRI and ICP-AES demonstrated a high degree of coincidence. Clearance of Gd-DTPA was minimal at the time point immediately after infusion. These results suggest that the environment of the brain does in fact significantly affect Gd T1 relaxivity, and that MRI can accurately measure contrast agent concentrations when this relaxivity is well characterized.

  20. Diagnostic value of T1 and T2 * relaxation times and off-resonance saturation effects in the evaluation of Achilles tendinopathy by MRI at 3T.

    Science.gov (United States)

    Grosse, Ulrich; Syha, Roland; Hein, Tobias; Gatidis, Sergios; Grözinger, Gerd; Schabel, Christoph; Martirosian, Petros; Schick, Fritz; Springer, Fabian

    2015-04-01

    To evaluate and compare the diagnostic value of T1 , T2 * relaxation times and off-resonance saturation ratios (OSR) in healthy controls and patients with different clinical and morphological stages of Achilles tendinopathy. Forty-two healthy Achilles tendons and 34 tendons of 17 patients with symptomatic and asymptomatic tendinopathy were investigated clinically with conventional magnetic resonance imaging (MRI) sequences on a 3T whole-body MR scanner and a dynamic ultrasound examination. In addition, T1 and T2 * relaxation times were assessed using an ultrashort echo time (UTE) imaging sequence with flip angle and echo time variation. For the calculation of OSR values a Gaussian off-resonance saturation pulse (frequency offset: 750-5000 Hz) was used. The diagnostic value of the derived MR values was assessed and compared using receiver operating characteristic (ROC) curves. ROC curves demonstrate the highest overall test performance for OSR values at 2000 Hz off-resonance in differentiating slightly (OSR-2000 [AUC: 0.930] > T2 * [AUC: 0.884] > T1 [AUC: 0.737]) and more severe pathologically altered tendon areas (OSR-2000 [AUC: 0.964] > T2 * [AUC: 0.917] > T1 [AUC: 0.819]) from healthy ones. OSR values at a frequency offset of 2000 Hz demonstrated a better sensitivity and specificity for detecting mild and severe stages of tendinopathy compared to T2 * and particularly when compared to T1 relaxation times. © 2014 Wiley Periodicals, Inc.

  1. Relationship between aging and T1 relaxation time in deep gray matter: A voxel-based analysis.

    Science.gov (United States)

    Okubo, Gosuke; Okada, Tomohisa; Yamamoto, Akira; Fushimi, Yasutaka; Okada, Tsutomu; Murata, Katsutoshi; Togashi, Kaori

    2017-09-01

    To investigate age-related changes in T 1 relaxation time in deep gray matter structures in healthy volunteers using magnetization-prepared 2 rapid acquisition gradient echoes (MP2RAGE). In all, 70 healthy volunteers (aged 20-76, mean age 42.6 years) were scanned at 3T magnetic resonance imaging (MRI). A MP2RAGE sequence was employed to quantify T 1 relaxation times. After the spatial normalization of T 1 maps with the diffeomorphic anatomical registration using the exponentiated Lie algebra algorithm, voxel-based regression analysis was conducted. In addition, linear and quadratic regression analyses of regions of interest (ROIs) were also performed. With aging, voxel-based analysis (VBA) revealed significant T 1 value decreases in the ventral-inferior putamen, nucleus accumbens, and amygdala, whereas T 1 values significantly increased in the thalamus and white matter as well (P time vary by location in deep gray matter. 2 Technical Efficacy: Stage 2 J. MAGN. RESON. IMAGING 2017;46:724-731. © 2017 International Society for Magnetic Resonance in Medicine.

  2. Relaxation times T1, T2, and T2{sup *} of apples, pears, citrus fruits, and potatoes with a comparison to human tissues; T1-, T2- und T2{sup *}-Relaxationswerte von Aepfeln, Birnen, Zitrusfruechten und Kartoffeln im Vergleich zu menschlichen Geweben

    Energy Technology Data Exchange (ETDEWEB)

    Werz, Karin; Braun, Hans; Vitha, Dominik; Bruno, Graziano; Martirosian, Petros; Steidle, Guenter; Schick, Fritz [Tuebingen Univ. (Germany). Sektion fuer Experimentelle Radiologie

    2011-07-01

    The aim of the project was a systematic assessment of relaxation times of different fruits and vegetables and a comparison to values of human tissues. Results provide an improved basis for selection of plant phantoms for development of new MR techniques and sequences. Vessels filled with agar gel are mostly used for this purpose, preparation of which is effortful and time-consuming. In the presented study apples, (malus, 8 species), pears, (pyrus, 2 species), citrus fruits (citrus, 5 species) and uncooked potatoes (solanum tuberosum, 8 species) from the supermarket were examined which are easily available nearly all-the-year. T1, T2 and T2{sup *} relaxation times of these nature products were measured on a 1.5 Tesla MR system with adapted examination protocols and mono-exponential fitting, and compared to literature data of human parenchyma tissues, fatty tissue and body fluid (cerebrospinal fluid). Resulting values were as follows: apples: T1: 1486 - 1874 ms, T2: 163 - 281 ms, T2{sup *}: 2,3 - 3,2 ms; pears: T1: 1631 - 1969 ms, T2: 119 - 133 ms, T2{sup *}: 10,1 - 10,6 ms, citrus fruits (pulp) T1: 2055 - 2632 ms, T2: 497 - 998 ms, T2{sup *}: 151 - 182 ms; citrus fruits (skin) T1: 561 - 1669 ms, T2: 93 - 119 ms; potatoes: T1: 1011 - 1459 ms, T2: 166 - 210 ms, T2{sup *}: 20 - 30 ms. All T1-values of the examined objects (except for potatoes and skins of citrus fruits) were longer than T1 values of human tissues. Also T2 values (except for pears and skins of citrus fruits) of the fruits and the potatoes tended to be longer. T2{sup *} values of apples, pears and potatoes were shorter than in healthy human tissue. Results show relaxation values of many fruits to be not exactly fitting to human tissue, but with suitable selection of the fruits and optionally with an adaption of measurement parameters one can achieve suitable contrast and signal characteristics for some purposes. (orig.)

  3. Surface-NMR measurements of the longitudinal relaxation time T1 in a homogeneous sandy aquifer in Skive, Denmark

    Science.gov (United States)

    Walbrecker, J.; Behroozmand, A.

    2011-12-01

    Efficient groundwater management requires reliable means of characterizing shallow groundwater aquifers. One key parameter in this respect is hydraulic conductivity. Surface nuclear magnetic resonance (NMR) is a geophysical exploration technique that can potentially provide this type of information in a noninvasive, cost-effective way. The technique is based on measuring the precession of nuclear spins of protons in groundwater molecules. It involves large loop antennas deployed on Earth's surface to generate electromagnetic pulses tuned to specifically excite and detect groundwater proton spins. Naturally, the excited state of spins is transitory - once excited, spins relax back to their equilibrium state. This relaxation process is strongly influenced by the spin environment, which, in the case of groundwater, is defined by the aquifer. By employing empirical relations, changes in relaxation behavior can be used to identify changes in aquifer hydraulic conductivity, making the NMR relaxation signal a very important piece of information. Particularly, efforts are made to record the longitudinal relaxation parameter T1, because it is known from laboratory studies that it often reliably correlates with hydraulic conductivity, even in the presence of magnetic species. In surface NMR, T1 data are collected by recording the NMR signal amplitude following two sequential excitation pulses as a function of the delay time τ between the two pulses. In conventional acquisition, the two pulses have a mutual phase shift of π. Based on theoretical arguments it was recently shown that T1 times acquired according to this conventional surface-NMR scheme are systematically biased. It was proposed that the bias can be minimized by cycling the phase of the two pulses between π and zero in subsequent double-pulse experiments, and subtracting the resulting signal amplitudes (phase-cycled pseudosaturation recovery scheme, pcPSR). We present the first surface-NMR T1 data set recorded

  4. Role of Thickness Confinement on Relaxations of the Fast Component in a Miscible A/B Blend

    Energy Technology Data Exchange (ETDEWEB)

    Green, Peter [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sharma, Ravi P. [University of Michigan; Dong, Ban Xuan [University of Michigan

    2018-01-18

    Spatial compositional heterogeneity strongly influences the dynamics of the A and B components of bulk miscible blends. Its effects are especially apparent in mixtures, such as poly(vinyl methyl ether) (PVME)/polystyrene (PS), where there exist significant disparities between the component glass transition temperatures (Tgs) and relaxation times. The relaxation processes characterized by distinct temperature dependencies and relaxation rates manifest different local compositional environments for temperatures above and below the glass transition temperature of the miscible blend. This same behavior is shown to exist in miscible PS/PVME films as thin as 100 nm. Moreover, in thin films, the characteristic segmental relaxation times t of the PVME component of miscible PVME/PS blends confined between aluminum (Al) substrates decrease with increasing molecular weight M of the PS component. These relaxation rates are film thickness dependent, in films up to a few hundred nanometers in thickness. This is in remarkable contrast to homopolymer films, where thickness confinement effects are apparent only on length scales on the order of nanometers. These surprisingly large length scales and M dependence are associated with the preferential interfacial enrichment - wetting layer formation - of the PVME component at the external Al interfaces, which alters the local spatial blend composition within the interior of the film. The implications are that the dynamics of miscible thin film blends are dictated in part by component Tg differences, disparities in component relaxation rates, component-substrate interactions, and chain lengths (entropy of mixing).

  5. Prolonged T1 relaxation of the hemopoietic bone marrow in patients with chronic leukemia

    DEFF Research Database (Denmark)

    Jensen, K E; Sørensen, P G; Thomsen, C

    1990-01-01

    Eleven patients with chronic leukemia (7 with chronic lymphocytic leukemia and 4 with chronic myeloid leukemia) were evaluated with magnetic resonance (MR) imaging and T1 relaxation time measurements by use of a 1.5 tesla whole body MR scanner. Bone marrow biopsies were obtained from the posterior...

  6. T2 relaxation times of irradiated vertebral bone marrow in patients with seminoma.

    Science.gov (United States)

    Argiris, A; Maris, T; Vlahos, L

    1997-01-01

    Our purpose was to demonstrate the effects of localized radiotherapy on lumbar vertebral bone marrow with the use of quantitative MRI with measurements of T2 relaxation times. Ten patients with early stage testicular seminoma with a history of radiation therapy to a "dog-leg" field including the lumbar vertebrae underwent MR imaging of their lumbar spine using a 0.5 Tesla magnet. Five healthy subjects and two nonirradiated patients were imaged as well. The intervals from the beginning of radiotherapy to MRI examination varied from 1.5 to 52 months, and the radiation dose ranged from 3000-4200 cGy. The T2 relaxation times of the lumbar vertebral bone marrow and subcutaneous fat were calculated for each subject. Postirradiation bone marrow in irradiated seminoma patients exhibited significantly longer T2 relaxation times than nonirradiated bone marrow in controls (71.1 vs. 63.6 ms, p = 0.047, t-test). The differences between the T2 relaxation times of bone marrow and subcutaneous fat for each subject allowed for even better differentiation between irradiated patients and controls (10.4 vs. 0.4 ms, p = 0.0004, t-test). Postirradiation bone marrow had significantly longer T2 relaxation times than subcutaneous fat in irradiated patients (N = 10, 71.1 vs. 60.7 ms, p = 0.00009, t-test), while nonirradiated bone marrow had T2 relaxation times not statistically different from subcutaneous fat in nonirradiated subjects (N = 7, 63.6 vs. 63.2 ms). Measurements of T2 relaxation times of bone marrow enabled us to differentiate between irradiated seminoma patients and controls. Postirradiation bone marrow undergoes late radiation effects resulting in longer T2 relaxation times than nonirradiated bone marrow and subcutaneous fat.

  7. Topographical Variation of Human Femoral Articular Cartilage Thickness, T1rho and T2 Relaxation Times Is Related to Local Loading during Walking.

    Science.gov (United States)

    Van Rossom, Sam; Wesseling, Mariska; Van Assche, Dieter; Jonkers, Ilse

    2018-01-01

    Objective Early detection of degenerative changes in the cartilage matrix composition is essential for evaluating early interventions that slow down osteoarthritis (OA) initiation. T1rho and T2 relaxation times were found to be effective for detecting early changes in proteoglycan and collagen content. To use these magnetic resonance imaging (MRI) methods, it is important to document the topographical variation in cartilage thickness, T1rho and T2 relaxation times in a healthy population. As OA is partially mechanically driven, the relation between these MRI-based parameters and localized mechanical loading during walking was investigated. Design MR images were acquired in 14 healthy adults and cartilage thickness and T1rho and T2 relaxation times were determined. Experimental gait data was collected and processed using musculoskeletal modeling to identify weight-bearing zones and estimate the contact force impulse during gait. Variation of the cartilage properties (i.e., thickness, T1rho, and T2) over the femoral cartilage was analyzed and compared between the weight-bearing and non-weight-bearing zone of the medial and lateral condyle as well as the trochlea. Results Medial condyle cartilage thickness was correlated to the contact force impulse ( r = 0.78). Lower T1rho, indicating increased proteoglycan content, was found in the medial weight-bearing zone. T2 was higher in all weight-bearing zones compared with the non-weight-bearing zones, indicating lower relative collagen content. Conclusions The current results suggest that medial condyle cartilage is adapted as a long-term protective response to localized loading during a frequently performed task and that the weight-bearing zone of the medial condyle has superior weight bearing capacities compared with the non-weight-bearing zones.

  8. Temperature Dependence of Logarithmic-like Relaxational Dynamics of Hydrated tRNA.

    Science.gov (United States)

    Chu, Xiang-Qiang; Mamontov, Eugene; O'Neill, Hugh; Zhang, Qiu

    2013-03-21

    The dynamics of RNA within the β-relaxation region of 10 ps to 1 ns is crucial to its biological function. Because of its simpler chemical building blocks and the lack of the side methyl groups, faster relaxational dynamics of RNA compared to proteins can be expected. However, the situation is actually opposite. In this work, the relaxational dynamics of tRNA is measured by quasielastic neutron scattering and analyzed using the mode coupling theory, originally developed for glass-forming liquids. Our results reveal that the dynamics of tRNA follows a log-decay within the β-relaxation region, which is an important trait demonstrated by the dynamics of proteins. The dynamics of hydrated tRNA and lysozyme compared in the time domain further demonstrate that the slower dynamics of tRNA relative to proteins originates from the difference in the folded states of tRNA and proteins, as well as the influence of their hydration water.

  9. Gadolinium-based magnetic resonance contrast agents at 7 Tesla: in vitro T1 relaxivities in human blood plasma.

    Science.gov (United States)

    Noebauer-Huhmann, Iris M; Szomolanyi, Pavol; Juras, Vladimír; Kraff, Oliver; Ladd, Mark E; Trattnig, Siegfried

    2010-09-01

    PURPOSE/INTRODUCTION: The aim of this study was to determine the T1 relaxivities (r1) of 8 gadolinium (Gd)-based MR contrast agents in human blood plasma at 7 Tesla, compared with 3 Tesla. Eight commercially available Gd-based MR contrast agents were diluted in human blood plasma to concentrations of 0, 0.25, 0.5, 1, and 2 mmol/L. In vitro measurements were performed at 37 degrees C, on a 7 Tesla and on a 3 Tesla whole-body magnetic resonance imaging scanner. For the determination of T1 relaxation times, Inversion Recovery Sequences with inversion times from 0 to 3500 ms were used. The relaxivities were calculated. The r1 relaxivities of all agents, diluted in human blood plasma at body temperature, were lower at 7 Tesla than at 3 Tesla. The values at 3 Tesla were comparable to those published earlier. Notably, in some agents, a minor negative correlation of r1 with a concentration of up to 2 mmol/L could be observed. This was most pronounced in the agents with the highest protein-binding capacity. At 7 Tesla, the in vitro r1 relaxivities of Gd-based contrast agents in human blood plasma are lower than those at 3 Tesla. This work may serve as a basis for the application of Gd-based MR contrast agents at 7 Tesla. Further studies are required to optimize the contrast agent dose in vivo.

  10. Biologically aggressive regions within glioblastoma identified by spin-lock contrast T1 relaxation in the rotating frame (T1ρ MRI

    Directory of Open Access Journals (Sweden)

    Ramon Francisco Barajas, Jr., MD

    2017-12-01

    Full Text Available Spin-lattice relaxation in the rotating frame magnetic resonance imaging allows for the quantitative assessment of spin-lock contrast within tissues. We describe the utility of spin-lattice relaxation in the rotating frame metrics in characterizing glioblastoma biological heterogeneity. A 84-year-old man presented to our institution with a right frontal temporal mass. Prior tissue sampling from a peripheral nonenhancing lesion was nondiagnostic. Stereotactic image-guided tissue sampling of the nonenhancing T2-fluid-attenuated inversion recovery hyperintense region involving the anterior cingulate gyrus with elevated spin-lattice relaxation in the rotating frame metrics provided a pathologic diagnosis of glioblastoma. This case illustrates the utility of spin-lattice relaxation in the rotating frame magnetic resonance imaging in identifying biologically aggressive regions within glioblastoma.

  11. Quantum process tomography with informational incomplete data of two J-coupled heterogeneous spins relaxation in a time window much greater than T1

    Science.gov (United States)

    Maciel, Thiago O.; Vianna, Reinaldo O.; Sarthour, Roberto S.; Oliveira, Ivan S.

    2015-11-01

    We reconstruct the time dependent quantum map corresponding to the relaxation process of a two-spin system in liquid-state NMR at room temperature. By means of quantum tomography techniques that handle informational incomplete data, we show how to properly post-process and normalize the measurements data for the simulation of quantum information processing, overcoming the unknown number of molecules prepared in a non-equilibrium magnetization state (Nj) by an initial sequence of radiofrequency pulses. From the reconstructed quantum map, we infer both longitudinal (T1) and transversal (T2) relaxation times, and introduce the J-coupling relaxation times ({T}1J,{T}2J), which are relevant for quantum information processing simulations. We show that the map associated to the relaxation process cannot be assumed approximated unital and trace-preserving for times greater than {T}2J.

  12. In vivo measurements of the T1 relaxation processes in the bone marrow in patients with myelodysplastic syndrome. A magnetic resonance imaging study

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, K.E.; Nielsen, H.; Thomsen, C.; Soerensen, P.G.; Karle, H.; Christoffersen, P.; Henriksen, O. (Hvidovre Hospital, Copenhagen (Denmark). Dept. of Magnetic Resonance; Hvidovre Hospital, Copenhagen (Denmark). Dept. of Hematology; Hvidovre Hospital, Copenhagen (Denmark). Dept. of Pathology)

    Nine patients with myelodysplastic syndrome (MDS) were examined with magnetic resonance imaging and in vivo T1 relaxation time measurements of the vertebral bone marrow in a 1.5 tesla whole body scanner. Two patients underwent transformation to acute myeloid leukemia and were evaluated at follow-up examinations. At the time of diagnosis the T1 relaxation times of the vertebral bone marrow were significantly prolonged compared with normal values. The T1 relaxation times of the vertebral bone marrow in patients with MDS showed significantly lower values compared with patients with acute leukemia and did not differ from patients with polycythemia vera. (orig.).

  13. Relaxation time T/sub 1/ and bound water fraction of muscle by NMR imager

    Energy Technology Data Exchange (ETDEWEB)

    Fukuda, N.; Ikehira, H.; Yamane, T.; Tateno, Y.; Torii, S.; Matsumura, K.

    1986-05-01

    In order to establish the efficacy of NMR-CT in the diagnostic investigation of muscle disorders, proton NMR-CT imaging was performed and muscle longitudinal relaxation (T1) times were measured in 20 Duchenne muscular dystrophy (DMD) patients and normal controls (NC). In addition, the bound water fraction (BWF) was calculated from the measured T1 value in appropriate cases. Results show that in DMD muscle T1 values were above normal in the early clinical stages, declined rapidly with progress of the disease, and reached the same low level as the subcutaneous fat. This decrease of T1 values was not uniform for all muscles, being most prominent in gluteus maximus and least in sartorius and gracilis. In NC muscle BWF increased with maturation under the age of 10 years, and became fixed beyond that. In the early stages of DMD, BWF was below normal.

  14. Spatial characterization of T1 and T2 relaxation times and the water apparent diffusion coefficient in rabbit Achilles tendon subjected to tensile loading.

    Science.gov (United States)

    Wellen, J; Helmer, K G; Grigg, P; Sotak, C H

    2005-03-01

    Tendons exhibit viscoelastic mechanical behavior under tensile loading. The elasticity arises from the collagen chains that form fibrils, while the viscous response arises from the interaction of the water with the solid matrix. Therefore, an understanding of the behavior of water in response to the application of a load is crucial to the understanding of the origin of the viscous response. Three-dimensional MRI mapping of rabbit Achilles tendons was performed at 2.0 T to characterize the response of T(1) and T(2) relaxation times and the apparent diffusion coefficient (ADC) of water to tensile loading. The ADC was measured in directions both parallel (ADC( parallel)) and perpendicular (ADC( perpendicular)) to the long axis of the tendon. At a short diffusion time (5.8 ms) MR parameter maps showed the existence of two regions, here termed "core" and "rim", that exhibited statistically significant differences in T(1), T(2), and ADC( perpendicular) under the baseline loading condition. MR parameter maps were also generated at a second loading condition of approximately 1 MPa. At a diffusion time of 5.8 ms, there was a statistically significant increase in the rim region for both ADC( perpendicular) (57.5%) and ADC( parallel) (20.5%) upon tensile loading. The changes in core ADC(( perpendicular), ( parallel)), as well as the relaxation parameters in both core and rim regions, were not statistically significant. The effect of diffusion time on the ADC(( perpendicular), ( parallel)) values was investigated by creating maps at three additional diffusion times (50.0, 125.0, 250.0 ms) using a diffusion-weighted, stimulated-echo (DW-STE) pulse sequence. At longer diffusion times, ADC(( perpendicular), ( parallel)) values increased rather than approaching a constant value. This observation was attributed to T(1) spin-editing during the DW-STE pulse sequence, which resulted in the loss of short-T(1) components (with correspondingly lower ADCs) at longer diffusion times

  15. Molecular order and T1-relaxation, cross-relaxation in nitroxide spin labels

    Science.gov (United States)

    Marsh, Derek

    2018-05-01

    Interpretation of saturation-recovery EPR experiments on nitroxide spin labels whose angular rotation is restricted by the orienting potential of the environment (e.g., membranes) currently concentrates on the influence of rotational rates and not of molecular order. Here, I consider the dependence on molecular ordering of contributions to the rates of electron spin-lattice relaxation and cross relaxation from modulation of N-hyperfine and Zeeman anisotropies. These are determined by the averages and , where θ is the angle between the nitroxide z-axis and the static magnetic field, which in turn depends on the angles that these two directions make with the director of uniaxial ordering. For saturation-recovery EPR at 9 GHz, the recovery rate constant is predicted to decrease with increasing order for the magnetic field oriented parallel to the director, and to increase slightly for the perpendicular field orientation. The latter situation corresponds to the usual experimental protocol and is consistent with the dependence on chain-labelling position in lipid bilayer membranes. An altered dependence on order parameter is predicted for saturation-recovery EPR at high field (94 GHz) that is not entirely consistent with observation. Comparisons with experiment are complicated by contributions from slow-motional components, and an unexplained background recovery rate that most probably is independent of order parameter. In general, this analysis supports the interpretation that recovery rates are determined principally by rotational diffusion rates, but experiments at other spectral positions/field orientations could increase the sensitivity to order parameter.

  16. Menstrual variation of breast volume and T2 relaxation times in cyclical mastalgia

    International Nuclear Information System (INIS)

    Hussain, Zainab; Brooks, Jonathan; Percy, Dave

    2008-01-01

    Purpose: Hormonal activity causes breast volume to change during the menstrual cycle. One possible cause of this volume change is thought to be due to water retention or oedema within the tissues. We used magnetic resonance imaging (MRI) to study the variation in breast volume and 1 H Magnetic Resonance Spectroscopy (MRS) to measure T 2 relaxation times which are known to increase with increasing tissue water content. We hypothesised that an increase in breast volume will elevate T 2 relaxation due to the presence of an increased water content within the breast. T 2 Relaxation time and volume were studied in fifteen control subjects and in a cohort of eight patients with cyclical mastalgia in order to determine whether changes in breast volume and T 2 relaxation times differed in controls and patients during menses, ovulation and premenses. Method: Breast volume was determined by the Cavalieri method in combination with point counting techniques on MR images and T 2 relaxation times of the water and fat in a voxel of breast tissue were obtained using 1 H Magnetic Resonance Spectroscopy (MRS). Results: Statistical analysis (ANOVA) demonstrated highly significant differences in breast volume between the three stages of the cycle (p 2 of fat or water did not depend on stage of cycle. T-tests demonstrated no significant differences in T 2 of water or fat between patient and control groups. The average T 2 relaxation time of water was lowest in the patient and control groups during ovulation and highest in the patient group during premenses. Conclusion: We have performed the first combined volumetric and spectroscopic study of women with cyclical mastalgia and demonstrated that the global changes in volumes and T 2 were not significantly different from normal menstrual variations

  17. Medial meniscal posterior root/horn radial tears correlate with cartilage degeneration detected by T1ρ relaxation mapping

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, Kenji, E-mail: Kenji-am@nms.ac.jp [Department of Orthopaedic Surgery, Nippon Medical School, 1-1-5 Sendagi, Bunkyo-ku, Tokyo 113-8603 (Japan); Hashimoto, Sanshiro, E-mail: info@msorc.jp [Minami-Shinjuku Orthopaedic Rehabilitation Clinic, 2-16-7 Yoyogi, Shibuya-ku, Tokyo 151-0053 (Japan); Nakamura, Hiroshi, E-mail: nakamura@nms.ac.jp [Department of Orthopaedic Surgery, Nippon Medical School, 1-1-5 Sendagi, Bunkyo-ku, Tokyo 113-8603 (Japan); Mori, Atsushi, E-mail: atsu@nms.ac.jp [Department of Orthopaedic Surgery, Nippon Medical School, 1-1-5 Sendagi, Bunkyo-ku, Tokyo 113-8603 (Japan); Sato, Akiko, E-mail: akiko-sato@nms.ac.jp [Department of Orthopaedic Surgery, Nippon Medical School, 1-1-5 Sendagi, Bunkyo-ku, Tokyo 113-8603 (Japan); Majima, Tokifumi, E-mail: tkmajima@iuhw.ac.jp [Department of Orthopaedic Surgery, International University of Health and Welfare Hospital, 537-3 Iguchi, Nasu-shiobara, Tochigi 329-2763 (Japan); Takai, Shinro, E-mail: takai-snr@nms.ac.jp [Department of Orthopaedic Surgery, Nippon Medical School, 1-1-5 Sendagi, Bunkyo-ku, Tokyo 113-8603 (Japan)

    2015-06-15

    Highlights: • Posterior radial tears in medial meniscus associate T1ρ values of cartilage. • Posterior radial tears relate to cartilage degeneration even in early-stage osteoarthritis. • Abnormalities in meniscus on MRI are useful for screening early-stage osteoarthritis. - Abstract: Objective: This study aimed to identify factors on routine pulse sequence MRI associated with cartilage degeneration observed on T1ρ relaxation mapping. Materials and methods: This study included 137 subjects with knee pain. T1ρ values were measured in the regions of interest on the surface layer of the cartilage on mid-coronal images of the femorotibial joint. Assessment of cartilage, subchondral bone, meniscus and ligaments was performed using routine pulse sequence MRI. Radiographic evaluation for osteoarthritis was also performed. Results: Multiple regression analysis revealed posterior root/horn tears to be independent factors increasing the T1ρ values of the cartilage in the medial compartment of the femorotibial joint. Even when adjusted for radiographically defined early-stage osteoarthritis, medial posterior meniscal radial tears significantly increased the T1ρ values. Conclusions: This study showed that posterior root/horn radial tears in the medial meniscus are particularly important MRI findings associated with cartilage degeneration observed on T1ρ relaxation mapping. Morphological factors of the medial meniscus on MRI provide findings useful for screening early-stage osteoarthritis.

  18. Medial meniscal posterior root/horn radial tears correlate with cartilage degeneration detected by T1ρ relaxation mapping

    International Nuclear Information System (INIS)

    Takahashi, Kenji; Hashimoto, Sanshiro; Nakamura, Hiroshi; Mori, Atsushi; Sato, Akiko; Majima, Tokifumi; Takai, Shinro

    2015-01-01

    Highlights: • Posterior radial tears in medial meniscus associate T1ρ values of cartilage. • Posterior radial tears relate to cartilage degeneration even in early-stage osteoarthritis. • Abnormalities in meniscus on MRI are useful for screening early-stage osteoarthritis. - Abstract: Objective: This study aimed to identify factors on routine pulse sequence MRI associated with cartilage degeneration observed on T1ρ relaxation mapping. Materials and methods: This study included 137 subjects with knee pain. T1ρ values were measured in the regions of interest on the surface layer of the cartilage on mid-coronal images of the femorotibial joint. Assessment of cartilage, subchondral bone, meniscus and ligaments was performed using routine pulse sequence MRI. Radiographic evaluation for osteoarthritis was also performed. Results: Multiple regression analysis revealed posterior root/horn tears to be independent factors increasing the T1ρ values of the cartilage in the medial compartment of the femorotibial joint. Even when adjusted for radiographically defined early-stage osteoarthritis, medial posterior meniscal radial tears significantly increased the T1ρ values. Conclusions: This study showed that posterior root/horn radial tears in the medial meniscus are particularly important MRI findings associated with cartilage degeneration observed on T1ρ relaxation mapping. Morphological factors of the medial meniscus on MRI provide findings useful for screening early-stage osteoarthritis

  19. T1 relaxation time constants, influence of oxygen, and the oxygen transfer function of the human lung at 1.5 T—A meta-analysis

    Energy Technology Data Exchange (ETDEWEB)

    Dietrich, Olaf, E-mail: od@dtrx.net [Josef Lissner Laboratory for Biomedical Imaging, Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Munich (Germany); Gaass, Thomas [Josef Lissner Laboratory for Biomedical Imaging, Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Munich (Germany); Comprehensive Pneumology Center, German Center for Lung Research, Munich (Germany); Reiser, Maximilian F. [Josef Lissner Laboratory for Biomedical Imaging, Institute for Clinical Radiology, Ludwig-Maximilians-University Hospital Munich, Munich (Germany)

    2017-01-15

    Purpose: To pool and summarize published data from magnetic resonance longitudinal relaxation measurements of the human lung at 1.5 T to provide a reliable basis of T{sub 1} relaxation time constants of healthy lung tissue both under respiration of room air and of pure oxygen. In particular, the oxygen-induced shortening of T{sub 1} was evaluated. Materials and methods: The PubMed database was comprehensively searched up to June 2016 for original publications in English containing quantitative T{sub 1} data (at least mean values and standard deviations) of the lung parenchyma of healthy subjects (minimum subject number: 3) at 1.5 T. From all included publications, T{sub 1} values of the lung of healthy subjects were extracted (inhaling room air and, if available, inhaling pure oxygen). Weighted mean values and standard deviations of all extracted data and the oxygen transfer function (OTF) were calculated. Results: 22 publications were included with a total number of 188 examined healthy subjects. 103 of these subjects (from 13 studies) were examined while breathing pure oxygen and room air; 85 subjects were examined only under room-air conditions. The weighted mean value (weighted sample standard deviation) of the room-air T{sub 1} values over all 22 studies was 1196 ms (152 ms). Based on studies with room-air and oxygen results, the mean T{sub 1} value at room-air conditions was 1172 ms (161 ms); breathing pure oxygen, the mean T{sub 1} value was reduced to 1054 ms (138 ms). This corresponds to a mean T{sub 1} reduction by 118 ms (35 ms) or 10.0 % (2.3 %) and to a mean OTF value of 1.22 (0.32) × 10{sup −3} s{sup −1}/(%O{sub 2}). Conclusion: This meta-analysis with data from 188 subjects indicates that the average T{sub 1} relaxation time constant of healthy lung tissue at 1.5 T is distributed around 1200 ms with a standard deviation of about 150 ms; breathing pure oxygen reduces this value significantly by 10 % to about 1050 ms.

  20. Inherited MST1 deficiency underlies susceptibility to EV-HPV infections.

    Directory of Open Access Journals (Sweden)

    Amandine Crequer

    Full Text Available Epidermodysplasia verruciformis (EV is characterized by persistent cutaneous lesions caused by a specific group of related human papillomavirus genotypes (EV-HPVs in otherwise healthy individuals. Autosomal recessive (AR EVER1 and EVER2 deficiencies account for two thirds of known cases of EV. AR RHOH deficiency has recently been described in two siblings with EV-HPV infections as well as other infectious and tumoral manifestations. We report here the whole-exome based discovery of AR MST1 deficiency in a 19-year-old patient with a T-cell deficiency associated with EV-HPV, bacterial and fungal infections. MST1 deficiency has recently been described in seven patients from three unrelated kindreds with profound T-cell deficiency and various viral and bacterial infections. The patient was also homozygous for a rare ERCC3 variation. Our findings broaden the clinical range of infections seen in MST1 deficiency and provide a new genetic etiology of susceptibility to EV-HPV infections. Together with the recent discovery of RHOH deficiency, they suggest that T cells are involved in the control of EV-HPVs, at least in some individuals.

  1. Nuclear magnetic resonance studies on brain edema. Time course of /sup 1/H-NMR relaxation times

    Energy Technology Data Exchange (ETDEWEB)

    Naruse, S; Horikawa, Y; Tanaka, C; Hirakawa, K; Nishikawa, H [Kyoto Prefectural Univ. of Medicine (Japan)

    1981-06-01

    1. The state of water in normal and edematous brain tissue was studied by measurement of proton longitudinal (T/sub 1/) and transverse (T/sub 2/) relaxation times using pulsed nuclear magnetic resonance (NMR) technique. 2. In control rats, T/sub 1/ and T/sub 2/ of water showed one component, which was more fast in white matter. Those values displayed 1.07 - 1.18 sec. of T/sub 1/ and 75 - 76 msec. of T/sub 2/. 3. When rat brain was injured by cold, T/sub 1/ was observed to become longer (1.18 - 1.27 sec.), and T/sub 2/ was observed be separated into two components, the faster T/sub 2/ (45 - 50 msec.) and slower T/sub 2/ (100 - 105 msec.), in both gray and white matter of the injured side. 4. In triethyltin (TET) induced brain edema, elongation of T/sub 1/ (1.2 sec.) and remarkable separation of T/sub 2/, faster T/sub 2/ (75 msec.) and slower T/sub 2/ (400 - 450 msec.), were observed in white matter. 5. In both cold and TET induced edema, slower T/sub 2/ fraction is suggested to be the extracellular space and faster T/sub 2/ fraction, intracellular. 6. T/sub 2/ changes precede the water content changes in cold injury, and parallel in TET induced edema. Those changes of relaxation times are reversible. 7. T/sub 2/ changes of water is more sensitive than the T/sub 1/ for the detection of production and disappearance of brain edema. 8. These results disclose the dynamic movements of water during the course of brain edema and offered significant information of the clinical application of NMR-CT.

  2. Magnetic resonance fingerprinting using echo-planar imaging: Joint quantification of T1 and T2∗ relaxation times.

    Science.gov (United States)

    Rieger, Benedikt; Zimmer, Fabian; Zapp, Jascha; Weingärtner, Sebastian; Schad, Lothar R

    2017-11-01

    To develop an implementation of the magnetic resonance fingerprinting (MRF) paradigm for quantitative imaging using echo-planar imaging (EPI) for simultaneous assessment of T 1 and T2∗. The proposed MRF method (MRF-EPI) is based on the acquisition of 160 gradient-spoiled EPI images with rapid, parallel-imaging accelerated, Cartesian readout and a measurement time of 10 s per slice. Contrast variation is induced using an initial inversion pulse, and varying the flip angles, echo times, and repetition times throughout the sequence. Joint quantification of T 1 and T2∗ is performed using dictionary matching with integrated B1+ correction. The quantification accuracy of the method was validated in phantom scans and in vivo in 6 healthy subjects. Joint T 1 and T2∗ parameter maps acquired with MRF-EPI in phantoms are in good agreement with reference measurements, showing deviations under 5% and 4% for T 1 and T2∗, respectively. In vivo baseline images were visually free of artifacts. In vivo relaxation times are in good agreement with gold-standard techniques (deviation T 1 : 4 ± 2%, T2∗: 4 ± 5%). The visual quality was comparable to the in vivo gold standard, despite substantially shortened scan times. The proposed MRF-EPI method provides fast and accurate T 1 and T2∗ quantification. This approach offers a rapid supplement to the non-Cartesian MRF portfolio, with potentially increased usability and robustness. Magn Reson Med 78:1724-1733, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  3. T(2) relaxation time of hyaline cartilage in presence of different gadolinium-based contrast agents.

    Science.gov (United States)

    Wiener, Edzard; Settles, Marcus; Diederichs, Gerd

    2010-01-01

    The transverse relaxation time, T(2), of native cartilage is used to quantify cartilage degradation. T(2) is frequently measured after contrast administration, assuming that the impact of gadolinium-based contrast agents on cartilage T(2) is negligible. To verify this assumption the depth-dependent variation of T(2) in the presence of gadopentetate dimeglumine, gadobenate dimeglumine and gadoteridol was investigated. Furthermore, the r(2)/r(1) relaxivity ratios were quantified in different cartilage layers to demonstrate differences between T(2) and T(1) relaxation effects. Transverse high-spatial-resolution T(1)- and T(2)-maps were simultaneously acquired on a 1.5 T MR scanner before and after contrast administration in nine bovine patellae using a turbo-mixed sequence. The r(2)/r(1) ratios were calculated for each contrast agent in cartilage. Profiles of T(1), T(2) and r(2)/r(1) across cartilage thickness were generated in the absence and presence of contrast agent. The mean values in different cartilage layers were compared for global variance using the Kruskal-Wallis test and pairwise using the Mann-Whitney U-test. T(2) of unenhanced cartilage was 98 +/- 5 ms at 1 mm and 65 +/- 4 ms at 3 mm depth. Eleven hours after contrast administration significant differences (p cartilage thickness were close to 1.0 (range 0.9-1.3). At 1.5 T, T(2) decreased significantly in the presence of contrast agents, more pronounced in superficial than in deep cartilage. The change in T(2) relaxation rate was similar to the change in T(1). Cartilage T(2) measurements after contrast administration will lead to systematic errors in the quantification of cartilage degradation. 2010 John Wiley & Sons, Ltd.

  4. Sup(1)H n.m.r. relaxation of radiation induced crosslinking in polyester-styrene systems

    International Nuclear Information System (INIS)

    Andreis, M.; Veksli, Z.; Ranogajec, F.; Hedvig, P.

    1989-01-01

    The structure and dynamics of a network formed by radiation induced crosslinking of polyesters based on 1,6-hexane diol and 1,2-propylene glycol and maleic anhydride (HDF and PGF, respectively) with styrene is studied by proton pulsed n.m.r. spectroscopy. The dependence of spin-lattice, T 1 , and spin-spin, T 2 , relaxation times on the structure of polyester chain, molar ratios of styrene to polyester unsaturations and the radiation doses are analysed in terms of network formation and structure, and their effect on molecular motion. Above the gel point, at temperatures above the glass transition, the presence of two T 2 components reflects the heterogeneity of the network structure in both resins. Parallel with the n.m.r. relaxation measurements the crosslink density was determined from the extracted gel phase or double bonds (fumaric and styrene) participating in the crosslinking process. (author)

  5. The influence of temperature, viscosity and pH on the relaxation time T1 in flowing liquids

    International Nuclear Information System (INIS)

    Toczylowska, B.

    1995-01-01

    The designed and constructed at the Institute of Biocybernetics and Biomedical Engineering facility for the relaxation time (T 1 ) measurements of liquids flow has been presented. The influence of temperature, viscosity and pH has been determined for several liquids, especially physiological fluids

  6. Musculoskeletal MRI at 3.0 T and 7.0 T: a comparison of relaxation times and image contrast.

    Science.gov (United States)

    Jordan, Caroline D; Saranathan, Manojkumar; Bangerter, Neal K; Hargreaves, Brian A; Gold, Garry E

    2013-05-01

    The purpose of this study was to measure and compare the relaxation times of musculoskeletal tissues at 3.0 T and 7.0 T, and to use these measurements to select appropriate parameters for musculoskeletal protocols at 7.0 T. We measured the T₁ and T₂ relaxation times of cartilage, muscle, synovial fluid, bone marrow and subcutaneous fat at both 3.0 T and 7.0 T in the knees of five healthy volunteers. The T₁ relaxation times were measured using a spin-echo inversion recovery sequence with six inversion times. The T₂ relaxation times were measured using a spin-echo sequence with seven echo times. The accuracy of both the T₁ and T₂ measurement techniques was verified in phantoms at both magnetic field strengths. We used the measured relaxation times to help design 7.0 T musculoskeletal protocols that preserve the favorable contrast characteristics of our 3.0 T protocols, while achieving significantly higher resolution at higher SNR efficiency. The T₁ relaxation times in all tissues at 7.0 T were consistently higher than those measured at 3.0 T, while the T₂ relaxation times at 7.0 T were consistently lower than those measured at 3.0 T. The measured relaxation times were used to help develop high resolution 7.0 T protocols that had similar fluid-to-cartilage contrast to that of the standard clinical 3.0 T protocols for the following sequences: proton-density-weighted fast spin-echo (FSE), T₂-weighted FSE, and 3D-FSE-Cube. The T₁ and T₂ changes were within the expected ranges. Parameters for musculoskeletal protocols at 7.0 T can be optimized based on these values, yielding improved resolution in musculoskeletal imaging with similar contrast to that of standard 3.0 T clinical protocols. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  7. Quantitative Study of Longitudinal Relaxation (T 1) Contrast Mechanisms in Brain MRI

    Science.gov (United States)

    Jiang, Xu

    Longitudinal relaxation (T1) contrast in MRI is important for studying brain morphology and is widely used in clinical applications. Although MRI only detects signals from water hydrogen ( 1H) protons (WPs), T1 contrast is known to be influenced by other species of 1H protons, including those in macromolecules (MPs), such as lipids and proteins, through magnetization transfer (MT) between WPs and MPs. This complicates the use and quantification of T1 contrast for studying the underlying tissue composition and the physiology of the brain. MT contributes to T1 contrast to an extent that is generally dependent on MT kinetics, as well as the concentration and NMR spectral properties of MPs. However, the MP spectral properties and MT kinetics are both difficult to measure directly, as the signal from MPs is generally invisible to MRI. Therefore, to investigate MT kinetics and further quantify T1 contrast, we first developed a reliable way to indirectly measure the MP fraction and their exchange rate with WPs, with minimal dependence on the spectral properties of MPs. For this purpose, we used brief, highpower radiofrequency (RF) NMR excitation pulses to almost completely saturate the magnetization of MPs. Based on this, both MT kinetics and the contribution of MPs to T1 contrast through MT were studied. The thus obtained knowledge allowed us to subsequently infer the spectral properties of MPs by applying low-power, frequencyselective off-resonance RF pulses and measuring the offset-frequency dependent effect of MPs on the WP MRI signal. A two-pool exchange model was used in both cases to account for direct effects of the RF pulse on WP magnetization. Consistent with earlier works using MRI at low-field and post-mortem analysis of brain tissue, our novel measurement approach found that MPs constitute an up to 27% fraction of the total 1H protons in human brain white matter, and their spectrum follows a super-Lorentzian line with a T2 of 9.6+/-0.6 mus and a resonance

  8. Isotropic morphometry and multicomponent T1 ρ mapping of human knee articular cartilage in vivo at 3T.

    Science.gov (United States)

    Baboli, Rahman; Sharafi, Azadeh; Chang, Gregory; Regatte, Ravinder R

    2018-05-02

    The progressive loss of hyaline articular cartilage due to osteoarthritis (OA) changes the functional and biochemical properties of cartilage. Measuring the T 1 ρ along with the morphological assessment can potentially be used as noninvasive biomarkers in detecting early-stage OA. To correlate the biochemical and morphological data, submillimeter isotropic resolution for both studies is required. To implement a high spatial resolution 3D-isotropic-MRI sequence for simultaneous assessment of morphological and biexponential T 1 ρ relaxometry of human knee cartilage in vivo. Prospective. Ten healthy volunteers with no known inflammation, trauma, or pain in the knee. Standard FLASH sequence and customized Turbo-FLASH sequence to acquire 3D-isotropic-T 1 ρ-weighted images on a 3T MRI scanner. The mean volume and thickness along with mono- and biexponential T 1 ρ relaxations were assessed in the articular cartilage of 10 healthy volunteers. Nonparametric rank-sum tests. Bland-Altman analysis and coefficient of variation. The mean monoexponential T 1 ρ relaxation was 40.7 ± 4.8 msec, while the long and short components were 58.2 ± 3.9 msec and 6.5 ± 0.6 msec, respectively. The mean fractions of long and short T 1 ρ relaxation components were 63.7 ± 5.9% and 36.3 ± 5.9%, respectively. Statistically significant (P ≤ 0.03) differences were observed in the monoexponential and long components between some of the regions of interest (ROIs). No gender differences between biexponential components were observed (P > 0.05). Mean cartilage volume and thickness were 25.9 ± 6.4 cm 3 and 2.2 ± 0.7 mm, respectively. Cartilage volume (P = 0.01) and thickness (P = 0.03) were significantly higher in male than female participants across all ROIs. Bland-Altman analysis showed agreement between two morphological methods with limits of agreement between -1000 mm 3 and +1100 mm 3 for volume, and -0.78 mm and +0.46 mm for

  9. T2 star relaxation times for assessment of articular cartilage at 3 T: a feasibility study

    Energy Technology Data Exchange (ETDEWEB)

    Mamisch, Tallal Charles [University Bern, Department of Orthopedic Surgery, Inselspital, Bern (Switzerland); University Bern, Magnetic Resonance Spectroscopy and Methodology, Department of Clinical Research, Bern (Switzerland); Hughes, Timothy [Siemens Medical Solutions, Erlangen (Germany); Mosher, Timothy J. [Penn State University College of Medicine, Musculoskeletal Imaging and MRI, Department of Radiology, Hershey, PA (United States); Mueller, Christoph [University of Erlangen, Department of Trauma Surgery, Erlangen (Germany); Trattnig, Siegfried [Medical University of Vienna, MR Center - High Field MR, Department of Radiology, Vienna (Austria); Boesch, Chris [University Bern, Magnetic Resonance Spectroscopy and Methodology, Department of Clinical Research, Bern (Switzerland); Welsch, Goetz Hannes [University of Erlangen, Department of Trauma Surgery, Erlangen (Germany); Medical University of Vienna, MR Center - High Field MR, Department of Radiology, Vienna (Austria)

    2012-03-15

    T2 mapping techniques use the relaxation constant as an indirect marker of cartilage structure, and the relaxation constant has also been shown to be a sensitive parameter for cartilage evaluation. As a possible additional robust biomarker, T2* relaxation time is a potential, clinically feasible parameter for the biochemical evaluation of articular cartilage. The knees of 15 healthy volunteers and 15 patients after microfracture therapy (MFX) were evaluated with a multi-echo spin-echo T2 mapping technique and a multi-echo gradient-echo T2* mapping sequence at 3.0 Tesla MRI. Inline maps, using a log-linear least squares fitting method, were assessed with respect to the zonal dependency of T2 and T2* relaxation for the deep and superficial regions of healthy articular cartilage and cartilage repair tissue. There was a statistically significant correlation between T2 and T2* values. Both parameters demonstrated similar spatial dependency, with longer values measured toward the articular surface for healthy articular cartilage. No spatial variation was observed for cartilage repair tissue after MFX. Within this feasibility study, both T2 and T2* relaxation parameters demonstrated a similar response in the assessment of articular cartilage and cartilage repair tissue. The potential advantages of T2*-mapping of cartilage include faster imaging times and the opportunity for 3D acquisitions, thereby providing greater spatial resolution and complete coverage of the articular surface. (orig.)

  10. Menstrual variation of breast volume and T{sub 2} relaxation times in cyclical mastalgia

    Energy Technology Data Exchange (ETDEWEB)

    Hussain, Zainab [Department of Medical Imaging, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom); Magnetic Resonance and Image Analysis Research Centre, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom)], E-mail: zay@liverpool.ac.uk; Brooks, Jonathan [Magnetic Resonance and Image Analysis Research Centre, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom); Department of Human Anatomy and Genetics, University of Oxford, Oxford (United Kingdom); Percy, Dave [Centre for Operational Research and Applied Statistics, University of Salford, Salford, Greater Manchester M5 4WT (United Kingdom)

    2008-02-15

    Purpose: Hormonal activity causes breast volume to change during the menstrual cycle. One possible cause of this volume change is thought to be due to water retention or oedema within the tissues. We used magnetic resonance imaging (MRI) to study the variation in breast volume and {sup 1}H Magnetic Resonance Spectroscopy (MRS) to measure T{sub 2} relaxation times which are known to increase with increasing tissue water content. We hypothesised that an increase in breast volume will elevate T{sub 2} relaxation due to the presence of an increased water content within the breast. T{sub 2} Relaxation time and volume were studied in fifteen control subjects and in a cohort of eight patients with cyclical mastalgia in order to determine whether changes in breast volume and T{sub 2} relaxation times differed in controls and patients during menses, ovulation and premenses. Method: Breast volume was determined by the Cavalieri method in combination with point counting techniques on MR images and T{sub 2} relaxation times of the water and fat in a voxel of breast tissue were obtained using {sup 1}H Magnetic Resonance Spectroscopy (MRS). Results: Statistical analysis (ANOVA) demonstrated highly significant differences in breast volume between the three stages of the cycle (p < 0.0005) with breast volume being greatest premenstrually. Patients did not exhibit an increase in volume premenstrually, significantly above controls. T{sub 2} of fat or water did not depend on stage of cycle. T-tests demonstrated no significant differences in T{sub 2} of water or fat between patient and control groups. The average T{sub 2} relaxation time of water was lowest in the patient and control groups during ovulation and highest in the patient group during premenses. Conclusion: We have performed the first combined volumetric and spectroscopic study of women with cyclical mastalgia and demonstrated that the global changes in volumes and T{sub 2} were not significantly different from normal

  11. Statistical foundation of the Kubo-Tomita theory of magnetic relaxation

    International Nuclear Information System (INIS)

    Yul'met'ev, R.M.

    1974-01-01

    With the aim to give the statistical foundation of the Kubo-Tomita theory the theoretical-functional method of the projection operators is applied to the phenomenon of magnetic relaxation. The exact nonmarkov nonlinear kinetic equations are found for the time correlation functions (TCF) of the longitudinal and transversal components of the spin magnetization of a system including the spin-lattice interaction lambda H' in a general form. The markov kinetic equations of the well-known Bloch-type are derived in the weak coupling Van Hove limits t → infinity, lambda → 0, lambda 2 t=const., and the rate of the spin-lattice (T 1 -1 ) and spin-spin (T 2 -1 ) relaxation is obtained from the relaxation coefficients. It is found that the formulas of the Kubo-Tomita for T 1 -1 and T 2 -1 are correct only in the case of rapid thermal motions when ω 0 tau 0 0 is the resonance frequency and tau 0 is the typical correlation time of the molecular thermal motions). In the other limiting case (ω 0 tau 0 >>1) of slow motion, the effective spectral densities which enter T 1 and T 2 are determined by a set of relaxation times Tsub(β)sup(n) of the spin irreducible operators Vsub(β)sup(n) from the spin-lattice interaction lambda H'. It is found that the time dependence of the transversal component of magnetization had been left out in the collision integral of Kubo-Tomita's theory. Precisely considering this circumstance the frequency dependence of T 2 -1 on the resonance frequency must be changed. (author)

  12. Transverse water relaxation in whole blood and erythrocytes at 3T, 7T, 9.4T, 11.7T and 16.4T; determination of intracellular hemoglobin and extracellular albumin relaxivities.

    Science.gov (United States)

    Grgac, Ksenija; Li, Wenbo; Huang, Alan; Qin, Qin; van Zijl, Peter C M

    2017-05-01

    Blood is a physiological substance with multiple water compartments, which contain water-binding proteins such as hemoglobin in erythrocytes and albumin in plasma. Knowing the water transverse (R 2 ) relaxation rates from these different blood compartments is a prerequisite for quantifying the blood oxygenation level-dependent (BOLD) effect. Here, we report the Carr-Purcell-Meiboom-Gill (CPMG) based transverse (R 2CPMG ) relaxation rates of water in bovine blood samples circulated in a perfusion system at physiological temperature in order to mimic blood perfusion in humans. R 2CPMG values of blood plasma, lysed packed erythrocytes, lysed plasma/erythrocyte mixtures, and whole blood at 3 T, 7 T, 9.4 T, 11.7 T and 16.4 T were measured as a function of hematocrit or hemoglobin concentration, oxygenation, and CPMG inter-echo spacing (τ cp ). R 2CPMG in lysed cells showed a small τ cp dependence, attributed to the water exchange rate between free and hemoglobin-bound water to be much faster than τ cp . This was contrary to the tangential dependence in whole blood, where a much slower exchange between cells and blood plasma applies. Whole blood data were fitted as a function of τ cp using a general tangential correlation time model applicable for exchange as well as diffusion contributions to R 2CPMG , and the intercept R 20blood at infinitely short τ cp was determined. The R 20blood values at different hematocrit and the R 2CPMG values of lysed erythrocyte/plasma mixtures at different hemoglobin concentration were used to determine the relaxivity of hemoglobin inside the erythrocyte (r 2Hb ) and albumin (r 2Alb ) in plasma. The r 2Hb values obtained from lysed erythrocytes and whole blood were comparable at full oxygenation. However, while r 2Hb determined from lysed cells showed a linear dependence on oxygenation, this dependence became quadratic in whole blood. This possibly suggests an additional relaxation effect inside intact cells, perhaps due to hemoglobin

  13. The dielectric α relaxation at a temperature close to T sub(g)

    International Nuclear Information System (INIS)

    Gomez Ribelles, J.L.; Diaz Calleja, R.

    1985-01-01

    It is shown in this work how the dependence of the mean relaxation times of the dielectric α relaxation on temperature deviates from the Williams, Landel and Ferry model at a temperature close to T sub(g). In some cases, an Arrhenius-like relationship for this relaxation can be observed for temperatures below T sub(g)

  14. Preparation of EVA/silica nano composites characterized with solid state nuclear magnetic resonance; Obtencao de nanocomposito de EVA/SILICA e caracterizacao por ressonancia magnetica nuclear no estado solido

    Energy Technology Data Exchange (ETDEWEB)

    Passos, Adriano A; Tavares, Maria I.B.; Neto, Roberto C.P.; Moreira, Leonardo A; Ferreira, Antonio G., E-mail: mibt@ima.ufrj.br [Centro de Tecnologia, Instituto de Macromoleculas Professora Eloisa Mano, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil)

    2011-07-01

    Nano composites of poly(ethylene-co-vinyl acetate)/silica (SiO{sub 2}) with dimensions of ca. 40 nm were prepared via solution intercalation employing chloroform as a solvent. They were mainly characterized with nuclear magnetic resonance spectroscopy (NMR) employing carbon-13 (polymeric matrix), silicon-29 (nanoparticles) and through the determination of the proton spin-lattice relaxation time in the rotating frame (T{sub 1{rho}H}) (polymer matrix). From the NMR results it was inferred that up to 5% of silica in mass a well dispersed nano composite was obtained, owing to a strong interaction between silica and the EVA matrix. (author)

  15. The impact of fibre orientation on T1-relaxation and apparent tissue water content in white matter.

    Science.gov (United States)

    Schyboll, Felix; Jaekel, Uwe; Weber, Bernd; Neeb, Heiko

    2018-02-20

    Recent MRI studies have shown that the orientation of nerve fibres relative to the main magnetic field affects the R 2 *(= 1/T 2 *) relaxation rate in white matter (WM) structures. The underlying physical causes have been discussed in several studies but are still not completely understood. However, understanding these effects in detail is of great importance since this might serve as a basis for the development of new diagnostic tools and/or improve quantitative susceptibility mapping techniques. Therefore, in addition to the known angular dependence of R 2 *, the current study investigates the relationship between fibre orientation and the longitudinal relaxation rate, R 1 (= 1/T 1 ), as well as the apparent water content. For a group of 16 healthy subjects, a series of gradient echo, echo-planar and diffusion weighted images were acquired at 3T from which the decay rates, the apparent water content and the diffusion direction were reconstructed. The diffusion weighted data were used to determine the angle between the principle fibre direction and the main magnetic field to examine the angular dependence of R 1 and apparent water content. The obtained results demonstrate that both parameters depend on the fibre orientation and exhibit a positive correlation with the angle between fibre direction and main magnetic field. These observations could be helpful to improve and/or constrain existing biophysical models of brain microstructure by imposing additional constraints resulting from the observed angular dependence R 1 and apparent water content in white matter.

  16. Hyaline articular cartilage: relaxation times, pulse-sequence parameters and MR appearance at 1.5 T

    Energy Technology Data Exchange (ETDEWEB)

    Chalkias, S.M. [Dept. of Radiology, A.H.E.P.A. General Hospital of the Aristotelian Univ., Thessaloniki (Greece); Pozzi-Mucelli, R.S. [Dept. of Radiology, Univ. of Trieste (Italy); Pozzi-Mucelli, M. [Orthopaedic Clinic, Univ. of Trieste (Italy); Frezza, F. [Dept. of Radiology, Univ. of Trieste (Italy); Longo, R. [Dept. of Radiology, Univ. of Trieste (Italy)

    1994-08-01

    In order to optimize the parameters for the best visualization of the internal architecture of the hyaline articular cartilage a study both ex vivo and in vivo was performed. Accurate T1 and T2 relaxation times of articular cartilage were obtained with a particular mixed sequence and then used for the creation of isocontrast intensity graphs. These graphs subsequently allowed in all pulse sequences (spin echo, SE and gradient echo, GRE) the best combination of repetition time (TR), echo time (TE) and flip angle (FA) for optimization of signal differences between MR cartilage zones. For SE sequences maximum contrast between cartilage zones can be obtained by using a long TR (> 1,500 ms) with a short TE (< 30 ms), whereas for GRE sequences maximum contrast is obtained with the shortest TE (< 15 ms) combined with a relatively long TR (> 400 ms) and an FA greater than 40 . A trilaminar appearance was demonstrated with a superficial and deep hypointense zone in all sequences and an intermediate zone that was moderately hyperintense on SE T1-weighted images, slightly more hyperintense on proton density Rho and SE T2-weighted images and even more hyperintense on GRE images. (orig.)

  17. T2 relaxation time analysis in patients with multiple sclerosis: correlation with magnetization transfer ratio

    International Nuclear Information System (INIS)

    Papanikolaou, Nickolas; Papadaki, Eufrosini; Karampekios, Spyros; Maris, Thomas; Prassopoulos, Panos; Gourtsoyiannis, Nicholas; Spilioti, Martha

    2004-01-01

    The aim of the current study was to perform T2 relaxation time measurements in multiple sclerosis (MS) patients and correlate them with magnetization transfer ratio (MTR) measurements, in order to investigate in more detail the various histopathological changes that occur in lesions and normal-appearing white matter (NAWM). A total number of 291 measurements of MTR and T2 relaxation times were performed in 13 MS patients and 10 age-matched healthy volunteers. Measurements concerned MS plaques (105), NAWM (80), and ''dirty'' white matter (DWM; 30), evenly divided between the MS patients, and normal white matter (NWM; 76) in the healthy volunteers. Biexponential T2 relaxation-time analysis was performed, and also possible linearity between MTR and mean T2 relaxation times was evaluated using linear regression analysis in all subgroups. Biexponential relaxation was more pronounced in ''black-hole'' lesions (16.6%) and homogeneous enhancing plaques (10%), whereas DWM, NAWM, and mildly hypointense lesions presented biexponential behavior with a lower frequency(6.6, 5, and 3.1%, respectively). Non-enhancing isointense lesions and normal white matter did not reveal any biexponentional behavior. Linear regression analysis between monoexponential T2 relaxation time and MTR measurements demonstrated excellent correlation for DWM(r=-0.78, p<0.0001), very good correlation for black-hole lesions(r=-0.71, p=0.002), good correlation for isointense lesions(r=-0.60, p=0.005), moderate correlation for mildly hypointense lesions(r=-0.34, p=0.007), and non-significant correlation for homogeneous enhancing plaques, NAWM, and NWM. Biexponential T2 relaxation-time behavior is seen in only very few lesions (mainly on plaques with high degree of demyelination and axonal loss). A strong correlation between MTR and monoexponential T2 values was found in regions where either inflammation or demyelination predominates; however, when both pathological conditions coexist, this linear

  18. Efficient and robust relaxation procedures for multi-component mixtures including phase transition

    International Nuclear Information System (INIS)

    Han, Ee; Hantke, Maren; Müller, Siegfried

    2017-01-01

    We consider a thermodynamic consistent multi-component model in multi-dimensions that is a generalization of the classical two-phase flow model of Baer and Nunziato. The exchange of mass, momentum and energy between the phases is described by additional source terms. Typically these terms are handled by relaxation procedures. Available relaxation procedures suffer from efficiency and robustness resulting in very costly computations that in general only allow for one-dimensional computations. Therefore we focus on the development of new efficient and robust numerical methods for relaxation processes. We derive exact procedures to determine mechanical and thermal equilibrium states. Further we introduce a novel iterative method to treat the mass transfer for a three component mixture. All new procedures can be extended to an arbitrary number of inert ideal gases. We prove existence, uniqueness and physical admissibility of the resulting states and convergence of our new procedures. Efficiency and robustness of the procedures are verified by means of numerical computations in one and two space dimensions. - Highlights: • We develop novel relaxation procedures for a generalized, thermodynamically consistent Baer–Nunziato type model. • Exact procedures for mechanical and thermal relaxation procedures avoid artificial parameters. • Existence, uniqueness and physical admissibility of the equilibrium states are proven for special mixtures. • A novel iterative method for mass transfer is introduced for a three component mixture providing a unique and admissible equilibrium state.

  19. Evaluation of biexponential relaxation behaviour in the human brain by magnetic resonance imaging

    DEFF Research Database (Denmark)

    Kjaer, L; Thomsen, C; Henriksen, O

    1989-01-01

    Quantitative estimation of individual biologic components in relaxation curves obtained in vivo may increase the specificity of tissue characterization by magnetic resonance imaging. In this study, the potential of biexponential curve analysis was evaluated in T1 and T2 measurements on the human...... brain at 1.5 tesla. Optimal experimental conditions were carefully observed, including the use of long TR values and a very small voxel size. T1 determination was based on a 12-points partial saturation inversion recovery pulse sequence. T2 determination involved a multiple spin echo sequence with 32...... echoes. No genuine biexponentiality was demonstrated in the T1 and T2 relaxation processes of white matter, cortical grey matter, or cerebrospinal fluid. Thus, a monoexponential model seems adequate for description of the relaxation behaviour in these cases. Furthermore, the results suggest...

  20. Longitudinal evaluation of T1ρ and T2 spatial distribution in osteoarthritic and healthy medial knee cartilage.

    Science.gov (United States)

    Schooler, J; Kumar, D; Nardo, L; McCulloch, C; Li, X; Link, T M; Majumdar, S

    2014-01-01

    To investigate longitudinal changes in laminar and spatial distribution of knee articular cartilage magnetic resonance imaging (MRI) T1ρ and T2 relaxation times, in individuals with and without medial compartment cartilage defects. All subjects (at baseline n = 88, >18 years old) underwent 3-Tesla knee MRI at baseline and annually thereafter for 3 years. The MR studies were evaluated for presence of cartilage defects (modified Whole-Organ Magnetic Resonance Imaging Scoring - mWORMS), and quantitative T1ρ and T2 relaxation time maps. Subjects were segregated into those with (mWORMS ≥2) and without (mWORMS ≤1) cartilage lesions at the medial tibia (MT) or medial femur (MF) at each time point. Laminar (bone and articular layer) and spatial (gray level co-occurrence matrix - GLCM) distribution of the T1ρ and T2 relaxation time maps were calculated. Linear regression models (cross-sectional) and Generalized Estimating Equations (GEEs) (longitudinal) were used. Global T1ρ, global T2 and articular layer T2 relaxation times at the MF, and global and articular layer T2 relaxation times at the MT, were higher in subjects with cartilage lesions compared to those without lesions. At the MT global T1ρ relaxation times were higher at each time point in subjects with lesions. MT T1ρ and T2 became progressively more heterogeneous than control compartments over the course of the study. Spatial distribution of T1ρ and T2 relaxation time maps in medial knee OA using GLCM technique may be a sensitive indicator of cartilage deterioration, in addition to whole-compartment relaxation time data. Copyright © 2013 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  1. Simultaneous acquisition for T2 -T2 Exchange and T1 -T2 correlation NMR experiments

    Science.gov (United States)

    Montrazi, Elton T.; Lucas-Oliveira, Everton; Araujo-Ferreira, Arthur G.; Barsi-Andreeta, Mariane; Bonagamba, Tito J.

    2018-04-01

    The NMR measurements of longitudinal and transverse relaxation times and its multidimensional correlations provide useful information about molecular dynamics. However, these experiments are very time-consuming, and many researchers proposed faster experiments to reduce this issue. This paper presents a new way to simultaneously perform T2 -T2 Exchange and T1 -T2 correlation experiments by taking the advantage of the storage time and the two steps phase cycling used for running the relaxation exchange experiment. The data corresponding to each step is either summed or subtracted to produce the T2 -T2 and T1 -T2 data, enhancing the information obtained while maintaining the experiment duration. Comparing the results from this technique with traditional NMR experiments it was possible to validate the method.

  2. The immediate effect of long-distance running on T2 and T2* relaxation times of articular cartilage of the knee in young healthy adults at 3.0 T MR imaging.

    Science.gov (United States)

    Behzadi, Cyrus; Welsch, Goetz H; Laqmani, Azien; Henes, Frank O; Kaul, Michael G; Schoen, Gerhard; Adam, Gerhard; Regier, Marc

    2016-08-01

    To quantitatively assess the immediate effect of long-distance running on T2 and T2* relaxation times of the articular cartilage of the knee at 3.0 T in young healthy adults. 30 healthy male adults (18-31 years) who perform sports at an amateur level underwent an initial MRI at 3.0 T with T2 weighted [16 echo times (TEs): 9.7-154.6 ms] and T2* weighted (24 TEs: 4.6-53.6 ms) relaxation measurements. Thereafter, all participants performed a 45-min run. After the run, all individuals were immediately re-examined. Data sets were post-processed using dedicated software (ImageJ; National Institute of Health, Bethesda, MD). 22 regions of interest were manually drawn in segmented areas of the femoral, tibial and patellar cartilage. For statistical evaluation, Pearson product-moment correlation coefficients and confidence intervals were computed. Mean initial values were 35.7 ms for T2 and 25.1 ms for T2*. After the run, a significant decrease in the mean T2 and T2* relaxation times was observed for all segments in all participants. A mean decrease of relaxation time was observed for T2 with 4.6 ms (±3.6 ms) and for T2* with 3.6 ms (±5.1 ms) after running. A significant decrease could be observed in all cartilage segments for both biomarkers. Both quantitative techniques, T2 and T2*, seem to be valuable parameters in the evaluation of immediate changes in the cartilage ultrastructure after running. This is the first direct comparison of immediate changes in T2 and T2* relaxation times after running in healthy adults.

  3. Microwave Amplitude Modulation Technique to Measure Spin-Lattice (T 1) and Spin-Spin (T 2) Relaxation Times

    Science.gov (United States)

    Misra, Sushil K.

    The measurement of very short spin-lattice, or longitudinal, relaxation (SLR) times (i.e., 10-10 Misra, 1998), and polymer resins doped with rare-earth ions (Pescia et al., 1999a; Pescia et al. 1999b). The ability to measure such fast SLR data on amorphous Si and copper-chromium-tin spinel led to an understanding of the role of exchange interaction in affecting spin-lattice relaxation, while the data on polymer resins doped with rare-earth ions provided evidence of spin-fracton relaxation (Pescia et al., 1999a, b). But such fast SLR times are not measurable by the most commonly used techniques of saturation- and inversion-recovery (Poole, 1982; Alger, 1968), which only measure spin-lattice relaxation times longer than 10-6 s. A summary of relevant experimental data is presented in Table 1.

  4. Enhancement effects and relaxivities of gadolinium-DTPA at 1.5 versus 3 tesla. A phantom study

    International Nuclear Information System (INIS)

    Sasaki, Makoto; Shibata, Eri; Kanbara, Yoshiyuki; Ehara, Shigeru

    2005-01-01

    The purpose of this study was to investigate the difference in enhancement effects and relaxivities of the gadolinium chelate at 1.5 and 3 Tesla (T) and to elucidate the contribution of the high magnetic field to contrast enhancement in spin-echo (SE) and gradient-echo (GRE) images. Phantoms containing water with or without gadopentetate dimeglumine (Gd-DTPA) at different concentrations were scanned using 1.5T and 3T MRI scanners of the same manufacturer and under the same temperature conditions and scanning parameters. Relaxivities of gadolinium, R 1 and R 2 , were estimated from serial T 1 and T 2 values of the phantoms using linear regression. Contrast enhancement ratios in SE and GRE T 1 -weighted images were compared at 1.5 and 3T. The R 1 and R 2 of Gd-DTPA at 1.5 and 3T were 4.79 and 5.14, and 4.50 and 5.09, respectively. Although the relaxivities at 3T were slightly lower than those at 1.5T, the contrast enhancement ratio improved in both SE and GRE images as a result of T 1 prolongation of the water at 3T. The decrease in relaxivities of the Gd-DTPA at 3T appears to be so small that T 1 prolongation of the water improves contrast enhancement, suggesting a potential clinical advantage in administration of Gd-DTPA at high field strength. (author)

  5. A suite of Mathematica notebooks for the analysis of protein main chain 15N NMR relaxation data

    International Nuclear Information System (INIS)

    Spyracopoulos, Leo

    2006-01-01

    A suite of Mathematica notebooks has been designed to ease the analysis of protein main chain 15 N NMR relaxation data collected at a single magnetic field strength. Individual notebooks were developed to perform the following tasks: nonlinear fitting of 15 N-T 1 and -T 2 relaxation decays to a two parameter exponential decay, calculation of the principal components of the inertia tensor from protein structural coordinates, nonlinear optimization of the principal components and orientation of the axially symmetric rotational diffusion tensor, model-free analysis of 15 N-T 1 , -T 2 , and { 1 H}- 15 N NOE data, and reduced spectral density analysis of the relaxation data. The principle features of the notebooks include use of a minimal number of input files, integrated notebook data management, ease of use, cross-platform compatibility, automatic visualization of results and generation of high-quality graphics, and output of analyses in text format

  6. The effect of control of diabetes mellitus on plasma T4, T3, rT3 levels and half muscle relaxation period

    International Nuclear Information System (INIS)

    Ismail, A.A.; Hafiez, A.A.; Sayed, S.N.; Abbas, E.Z.; Halawa, F.A.; Youssef, M.M.

    1984-01-01

    25 diabetics of the maturity onset type who showed no clinical evidence of either peripheral neruropathy or diabetic amyotrophy were selected for this study. All patients were subjected to the following investigations: estimation of half muscle relaxation period of the quadriceps muscle knee-jerk, measurement of plasma levels of thyroxine (T 4 ), triiodothyronine (T 3 ) and reverse triiodothronine (rT 3 ), determination of fasting and two hours postprandial blood sugar levels. The quadriceps muscle relaxation period in uncontrolled diabetics was significantly longer than in normals. Control of diabetes by glibenclamide or gliclazide did not cause a significant change in muscle relaxation period. There was also no significant difference between the effects of the two drugs. (author)

  7. TU-EF-BRA-02: Longitudinal Proton Spin Relaxation and T1-Imaging

    International Nuclear Information System (INIS)

    Lemen, L.

    2015-01-01

    NMR, and Proton Density MRI of the 1D Patient - Anthony Wolbarst Net Voxel Magnetization, m(x,t). T1-MRI; The MRI Device - Lisa Lemen ‘Classical’ NMR; FID Imaging in 1D via k-Space - Nathan Yanasak Spin-Echo; S-E/Spin Warp in a 2D Slice - Ronald Price Magnetic resonance imaging not only reveals the structural, anatomic details of the body, as does CT, but also it can provide information on the physiological status and pathologies of its tissues, like nuclear medicine. It can display high-quality slice and 3D images of organs and vessels viewed from any perspective, with resolution better than 1 mm. MRI is perhaps most extraordinary and notable for the plethora of ways in which it can create unique forms of image contrast, reflective of fundamentally different biophysical phenomena. As with ultrasound, there is no risk from ionizing radiation to the patient or staff, since no X-rays or radioactive nuclei are involved. Instead, MRI harnesses magnetic fields and radio waves to probe the stable nuclei of the ordinary hydrogen atoms (isolated protons) occurring in water and lipid molecules within and around cells. MRI consists, in essence, of creating spatial maps of the electromagnetic environments around these hydrogen nuclei. Spatial variations in the proton milieus can be related to clinical differences in the biochemical and physiological properties and conditions of the associated tissues. Imaging of proton density (PD), and of the tissue proton spin relaxation times known as T1 and T2, all can reveal important clinical information, but they do so with approaches so dissimilar from one another that each is chosen for only certain clinical situations. T1 and T2 in a voxel are determined by different aspects of the rotations and other motions of the water and lipid molecules involved, as constrained by the local biophysical surroundings within and between its cells – and they, in turn, depend on the type of tissue and its state of health. Three other common

  8. TU-EF-BRA-02: Longitudinal Proton Spin Relaxation and T1-Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lemen, L. [Univ Cincinnati (United States)

    2015-06-15

    NMR, and Proton Density MRI of the 1D Patient - Anthony Wolbarst Net Voxel Magnetization, m(x,t). T1-MRI; The MRI Device - Lisa Lemen ‘Classical’ NMR; FID Imaging in 1D via k-Space - Nathan Yanasak Spin-Echo; S-E/Spin Warp in a 2D Slice - Ronald Price Magnetic resonance imaging not only reveals the structural, anatomic details of the body, as does CT, but also it can provide information on the physiological status and pathologies of its tissues, like nuclear medicine. It can display high-quality slice and 3D images of organs and vessels viewed from any perspective, with resolution better than 1 mm. MRI is perhaps most extraordinary and notable for the plethora of ways in which it can create unique forms of image contrast, reflective of fundamentally different biophysical phenomena. As with ultrasound, there is no risk from ionizing radiation to the patient or staff, since no X-rays or radioactive nuclei are involved. Instead, MRI harnesses magnetic fields and radio waves to probe the stable nuclei of the ordinary hydrogen atoms (isolated protons) occurring in water and lipid molecules within and around cells. MRI consists, in essence, of creating spatial maps of the electromagnetic environments around these hydrogen nuclei. Spatial variations in the proton milieus can be related to clinical differences in the biochemical and physiological properties and conditions of the associated tissues. Imaging of proton density (PD), and of the tissue proton spin relaxation times known as T1 and T2, all can reveal important clinical information, but they do so with approaches so dissimilar from one another that each is chosen for only certain clinical situations. T1 and T2 in a voxel are determined by different aspects of the rotations and other motions of the water and lipid molecules involved, as constrained by the local biophysical surroundings within and between its cells – and they, in turn, depend on the type of tissue and its state of health. Three other common

  9. T2 relaxation time in MR imaging of normal and abnormal lung parenchyma

    International Nuclear Information System (INIS)

    Mayo, J.R.; McKay, A.; Mueller, N.L.

    1990-01-01

    To measure the T2 relaxation times of normal and abnormal lung parenchyma and to evaluate the influence of field strength and lung inflation on T2. Five healthy volunteers and five patients with diffuse lung disease were imaged at 0.15 and 1.5 T. Excised normal pig lung was imaged at 0.15 and 1.5 T and analyzed in a spectrometer at 2.0 T. Single-echo (Hahn) pulse sequences (TR, 2,000 msec; TE, 20, 40, 60, 80, and 100 msec) were compared with multiecho trains (Carr-Purcell-Meiboom-Gill [CPMG] at 0.15 T (TR, 2,000 msec; TE, 20-40-60... 240 msec) and 2.0 T (TR, 2,000 msec; TE, 1, 2, 3,..., 10msec). T2 relaxation times calculated from single-echo sequences showed considerable variation between 0.15 and 2.0 T. T2 also changed with lung inflation. However, the T2 measurements on CPMG sequences did not change significantly (P > .05) with field strength and were only minimally affected by lung inflation. The mean ± SD T2 values for normal lung were 99 ± 8 and for abnormal lung were 84 ± 17. Lung parenchyma T2 measurements obtained with the use of conventional single-echo pulse sequences are variable and inaccurate because of inflation and field strength dependent magnetic susceptibility effects that lead to rapid nonrecoverable dephasing. The results indicate that multiecho sequences with appropriately short echo spacings yield more reproducible determinations of T2, which are independent of field strength and less dependent on lung inflation

  10. Temperature dependence of 1H NMR relaxation time, T2, for intact and neoplastic plant tissues

    Science.gov (United States)

    Lewa, Czesław J.; Lewa, Maria

    Temperature dependences of the spin-spin proton relaxation time, T2, have been shown for normal and tumorous tissues collected from kalus culture Nicotiana tabacum and from the plant Kalanchoe daigremontiana. For neoplastic plant tissues, time T2 was increased compared to that for intact plants, a finding similar to that for animal and human tissues. The temperature dependences obtained were compared to analogous relations observed with animal tissues.

  11. A general model to calculate the spin-lattice (T1) relaxation time of blood, accounting for haematocrit, oxygen saturation and magnetic field strength.

    Science.gov (United States)

    Hales, Patrick W; Kirkham, Fenella J; Clark, Christopher A

    2016-02-01

    Many MRI techniques require prior knowledge of the T1-relaxation time of blood (T1bl). An assumed/fixed value is often used; however, T1bl is sensitive to magnetic field (B0), haematocrit (Hct), and oxygen saturation (Y). We aimed to combine data from previous in vitro measurements into a mathematical model, to estimate T1bl as a function of B0, Hct, and Y. The model was shown to predict T1bl from in vivo studies with a good accuracy (± 87 ms). This model allows for improved estimation of T1bl between 1.5-7.0 T while accounting for variations in Hct and Y, leading to improved accuracy of MRI-derived perfusion measurements. © The Author(s) 2015.

  12. Rapid parametric mapping of the longitudinal relaxation time T1 using two-dimensional variable flip angle magnetic resonance imaging at 1.5 Tesla, 3 Tesla, and 7 Tesla.

    Science.gov (United States)

    Dieringer, Matthias A; Deimling, Michael; Santoro, Davide; Wuerfel, Jens; Madai, Vince I; Sobesky, Jan; von Knobelsdorff-Brenkenhoff, Florian; Schulz-Menger, Jeanette; Niendorf, Thoralf

    2014-01-01

    Visual but subjective reading of longitudinal relaxation time (T1) weighted magnetic resonance images is commonly used for the detection of brain pathologies. For this non-quantitative measure, diagnostic quality depends on hardware configuration, imaging parameters, radio frequency transmission field (B1+) uniformity, as well as observer experience. Parametric quantification of the tissue T1 relaxation parameter offsets the propensity for these effects, but is typically time consuming. For this reason, this study examines the feasibility of rapid 2D T1 quantification using a variable flip angles (VFA) approach at magnetic field strengths of 1.5 Tesla, 3 Tesla, and 7 Tesla. These efforts include validation in phantom experiments and application for brain T1 mapping. T1 quantification included simulations of the Bloch equations to correct for slice profile imperfections, and a correction for B1+. Fast gradient echo acquisitions were conducted using three adjusted flip angles for the proposed T1 quantification approach that was benchmarked against slice profile uncorrected 2D VFA and an inversion-recovery spin-echo based reference method. Brain T1 mapping was performed in six healthy subjects, one multiple sclerosis patient, and one stroke patient. Phantom experiments showed a mean T1 estimation error of (-63±1.5)% for slice profile uncorrected 2D VFA and (0.2±1.4)% for the proposed approach compared to the reference method. Scan time for single slice T1 mapping including B1+ mapping could be reduced to 5 seconds using an in-plane resolution of (2×2) mm2, which equals a scan time reduction of more than 99% compared to the reference method. Our results demonstrate that rapid 2D T1 quantification using a variable flip angle approach is feasible at 1.5T/3T/7T. It represents a valuable alternative for rapid T1 mapping due to the gain in speed versus conventional approaches. This progress may serve to enhance the capabilities of parametric MR based lesion detection and

  13. Real T1 relaxation time measurement and diurnal variation analysis of intervertebral discs in a healthy population of 50 volunteers

    International Nuclear Information System (INIS)

    Galley, J.; Maestretti, G.; Koch, G.; Hoogewoud, H-M.

    2017-01-01

    Purpose: To measure the real T1 relaxation time of the lumbar intervertebral discs in a young and healthy population, using different inversion recovery times, and assess diurnal variation. Material and methods: Intervertebral discs from D12 to S1 of 50 healthy volunteers from 18 to 25 years old were evaluated twice the same day, in the morning and in the late afternoon. Dedicated MRI sequences with different inversion recovery times (from 100 to 2500 ms) were used to calculate the real T1 relaxation time. Three regions of interest (ROIs) were defined in each disc, the middle representing the nucleus pulposus (NP) and the outer parts the annulus fibrosus (AF) anterior and posterior. Diurnal variation and differences between each disc level were analyzed. Results: T1 mean values in the NP were 1142 ± 12 ms in the morning and 1085 ± 13 ms in the afternoon, showing a highly significant decrease of 57 ms (p < 0.001). A highly significant difference between the levels of the spine was found. The mean T1 of the anterior part of the AF was 577 ± 9 ms in the morning and 554 ± 8 ms in the afternoon. For the posterior part, the mean values were 633 ± 8 ms in the morning and 581 ± 7 ms in the evening. It shows a highly significant decrease of 23 ms for the anterior part and 51 ms for the posterior part (all p < 0.001). Conclusion: T1 mapping is a promising method of intervertebral disc evaluation. Significant diurnal variation and difference between levels of the lumbar spine were demonstrated. A potential use for longitudinal study in post-operative follow up or sport medicine needs to be evaluated.

  14. Real T1 relaxation time measurement and diurnal variation analysis of intervertebral discs in a healthy population of 50 volunteers

    Energy Technology Data Exchange (ETDEWEB)

    Galley, J., E-mail: galleyjulien@gmail.com [Department of Radiology, HFR Fribourg, Hôpital Cantonal (Switzerland); Maestretti, G. [Department of Orthopedic Surgery, HFR Fribourg, Hôpital Cantonal (Switzerland); Koch, G.; Hoogewoud, H-M. [Department of Radiology, HFR Fribourg, Hôpital Cantonal (Switzerland)

    2017-02-15

    Purpose: To measure the real T1 relaxation time of the lumbar intervertebral discs in a young and healthy population, using different inversion recovery times, and assess diurnal variation. Material and methods: Intervertebral discs from D12 to S1 of 50 healthy volunteers from 18 to 25 years old were evaluated twice the same day, in the morning and in the late afternoon. Dedicated MRI sequences with different inversion recovery times (from 100 to 2500 ms) were used to calculate the real T1 relaxation time. Three regions of interest (ROIs) were defined in each disc, the middle representing the nucleus pulposus (NP) and the outer parts the annulus fibrosus (AF) anterior and posterior. Diurnal variation and differences between each disc level were analyzed. Results: T1 mean values in the NP were 1142 ± 12 ms in the morning and 1085 ± 13 ms in the afternoon, showing a highly significant decrease of 57 ms (p < 0.001). A highly significant difference between the levels of the spine was found. The mean T1 of the anterior part of the AF was 577 ± 9 ms in the morning and 554 ± 8 ms in the afternoon. For the posterior part, the mean values were 633 ± 8 ms in the morning and 581 ± 7 ms in the evening. It shows a highly significant decrease of 23 ms for the anterior part and 51 ms for the posterior part (all p < 0.001). Conclusion: T1 mapping is a promising method of intervertebral disc evaluation. Significant diurnal variation and difference between levels of the lumbar spine were demonstrated. A potential use for longitudinal study in post-operative follow up or sport medicine needs to be evaluated.

  15. Magnetization transfer and spin lock MR imaging of patellar cartilage degeneration at 0.1 T

    International Nuclear Information System (INIS)

    Koskinen, S.K.; Ylae-Outinen, H.; Komu, M.E.S.; Aho, H.J.

    1997-01-01

    Purpose: To investigate magnetization transfer (MT) parameters and rotating frame relaxation time T1ρ in patellar cartilage at different levels of degeneration. Material and Methods: Thirty cadaveric patellae were examined at 0.1 T using the time-dependent saturation-transfer MT technique and the spin lock (SL) technique. In an SL experiment, nuclear spins are locked with a radiofrequency (RF) field, and the locked nuclear magnetization relaxes along the magnetic component of the locking RF field. The specimens were divided into three groups according to the level of cartilage degeneration. MT parameters and T1ρ were measured. Results: The MT effect was greater in degenerated cartilage than in normal cartilage. T1ρ was longer in advanced cartilage degeneration than in intermediate cartilage degeneration. Conculsion: The results suggest that more studies are needed to fully establish the value of SL imaging in cartilage degeneration. (orig.)

  16. Non-invasive evaluation of blood oxygen saturation and hematocrit from T1 and T2 relaxation times: In-vitro validation in fetal blood.

    Science.gov (United States)

    Portnoy, Sharon; Seed, Mike; Sled, John G; Macgowan, Christopher K

    2017-12-01

    We propose an analytical method for calculating blood hematocrit (Hct) and oxygen saturation (sO 2 ) from measurements of its T 1 and T 2 relaxation times. Through algebraic substitution, established two-compartment relationships describing R1=T1-1 and R2=T2-1 as a function of hematocrit and oxygen saturation were rearranged to solve for Hct and sO 2 in terms of R 1 and R 2 . Resulting solutions for Hct and sO 2 are the roots of cubic polynomials. Feasibility of the method was established by comparison of Hct and sO 2 estimates obtained from relaxometry measurements (at 1.5 Tesla) in cord blood specimens to ground-truth values obtained by blood gas analysis. Monte Carlo simulations were also conducted to assess the effect of T 1 , T 2 measurement uncertainty on precision of Hct and sO 2 estimates. Good agreement was observed between estimated and ground-truth blood properties (bias = 0.01; 95% limits of agreement = ±0.13 for Hct and sO 2 ). Considering the combined effects of biological variability and random measurement noise, we estimate a typical uncertainty of ±0.1 for Hct, sO 2 estimates. Results demonstrate accurate quantification of Hct and sO 2 from T 1 and T 2 . This method is applicable to noninvasive fetal vessel oximetry-an application where existing oximetry devices are unusable or require risky blood-sampling procedures. Magn Reson Med 78:2352-2359, 2017. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  17. Electronic relaxation processes in polyatomic molecules. Progress report, October 1, 1975--September 30, 1976

    International Nuclear Information System (INIS)

    Lim, E.C.

    1976-09-01

    Excitation energy dependence of radiationless decay rate under collision-free conditions was utilized as a probe of intramolecular vibrational relaxation in tetracene and pentacene. The results give evidence of vibrational relaxation which competes with electronic relaxation. The substitution dependence of T 1 (nπ*) → S 0 radiationless transition in monocyclic diazines and the temperature dependence of S 1 non-radiative decay rate in alcoholic solutions of polycyclic monoazines indicate that the vibronic interaction between the lowest energy nπ* and ππ* states leads to a rapid radiationless deactivation of the lower of the two electronic states. Finally, a photon-counting spectrofluorometer of very high sensitivity was constructed, and it was used to record T 2 → T 1 fluorescence in bromoanthracenes and S 2 → S 1 fluorescence in azulene. These spectra represent the first bona-fide, or the most convincing, observation of fluorescence between excited electronic states

  18. Characterizing the microstructural basis of “unidentified bright objects” in neurofibromatosis type 1 : A combined in vivo multicomponent T2 relaxation and multi-shell diffusion MRI analysis

    NARCIS (Netherlands)

    Billiet, T.; Mädler, B.; D'Arco, F.; Deprez, S.; Plasschaert, E.; Leemans, A.; Zhang, H.; Van Den Bergh, B.R.H.; Vandenbulcke, M.; Legius, E.; Sunaert, S.; Emsell, L.

    2014-01-01

    Introduction The histopathological basis of “unidentified bright objects” (UBOs) (hyperintense regions seen on T2-weighted magnetic resonance (MR) brain scans in neurofibromatosis-1 (NF1)) remains unclear. New in vivo MRI-based techniques (multi-exponential T2 relaxation (MET2) and diffusion MR

  19. Changes in T1 relaxation processes in the bone marrow following treatment in children with acute lymphoblastic leukemia. A magnetic resonance imaging study

    DEFF Research Database (Denmark)

    Jensen, K E; Thomsen, C; Henriksen, O

    1990-01-01

    data from bone marrow biopsies obtained in close association to the MR examinations. Ten age matched children were examined as a control group. A 1.5 Tesla whole body scanner was used for the measurements. The pretreatment T1 relaxation times of the bone marrow were significantly prolonged, compared...

  20. 7 Tesla quantitative hip MRI: T1, T2 and T2* mapping of hip cartilage in healthy volunteers

    Energy Technology Data Exchange (ETDEWEB)

    Lazik, Andrea; Theysohn, Jens M.; Geis, Christina [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Johst, Soeren; Kraff, Oliver [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); Ladd, Mark E. [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); German Cancer Research Center (DKFZ), Medical Physics in Radiology, Heidelberg (Germany); Quick, Harald H. [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); University Hospital Essen, High Field and Hybrid MR Imaging, Essen (Germany)

    2016-05-15

    To evaluate the technical feasibility and applicability of quantitative MR techniques (delayed gadolinium-enhanced MRI of cartilage (dGEMRIC), T2 mapping, T2* mapping) at 7 T MRI for assessing hip cartilage. Hips of 11 healthy volunteers were examined at 7 T MRI with an 8-channel radiofrequency transmit/receive body coil using multi-echo sequences for T2 and T2* mapping and a dual flip angle gradient-echo sequence before (T1{sub 0}) and after intravenous contrast agent administration (T1{sub Gd}; 0.2 mmol/kg Gd-DTPA{sup 2-} followed by 0.5 h of walking and 0.5 h of rest) for dGEMRIC. Relaxation times of cartilage were measured manually in 10 regions of interest. Pearson's correlations between R1{sub delta} = 1/T1{sub Gd} - 1/T1{sub 0} and T1{sub Gd} and between T2 and T2* were calculated. Image quality and the delineation of acetabular and femoral cartilage in the relaxation time maps were evaluated using discrete rating scales. High correlations were found between R1{sub delta} and T1{sub Gd} and between T2 and T2* relaxation times (all p < 0.01). All techniques delivered diagnostic image quality, with best delineation of femoral and acetabular cartilage in the T2* maps (mean 3.2 out of a maximum of 4 points). T1, T2 and T2* mapping of hip cartilage with diagnostic image quality is feasible at 7 T. To perform dGEMRIC at 7 T, pre-contrast T1 mapping can be omitted. (orig.)

  1. Relaxation phenomena in the high temperature S-1 spheromak

    International Nuclear Information System (INIS)

    Ono, Y.; Ellis, R.A. Jr.; Janos, A.C.; Levinton, F.M.; Mayo, R.M.; Motley, R.W.; Ueda, Y.; Yamada, M.

    1988-06-01

    Operation of the S-1 device in a high current density (j/n/sub e/ ≥ 2 /times/ 10 -14 A/center dot/m) regime has created high electron temperature spheromaks (50eV ≤ T/sub e/ ≤ 130eV). The mechanisms and causes of the periodic relaxation events often observed in these hotter spheromak plasmas were made clear. Also, a relationship between the MHD relaxation cycle and confinement characteristics was revealed for the first time. Resistive loss at the outer edge of the plasma causes a departure from the initial force-free minimum-energy Taylor state to a MHD profile unstable to low-n ideal MHD modes; a relaxation event then returns the configuration to nearly a Taylor state. 11 refs., 5 figs

  2. In vivo measurements of the T1 relaxation processes in the bone marrow in patients with myelodysplastic syndrome. A magnetic resonance imaging study

    DEFF Research Database (Denmark)

    Jensen, K E; Nielsen, H; Thomsen, C

    1989-01-01

    Nine patients with myelodysplastic syndrome (MDS) were examined with magnetic resonance imaging and in vivo T1 relaxation time measurements of the vertebral bone marrow in a 1.5 tesla whole body scanner. Two patients underwent transformation to acute myeloid leukemia and were evaluated at follow-...... not differ from patients with polycythemia vera....

  3. Estimation of T2 relaxation time of breast cancer: Correlation with clinical, imaging and pathological features

    Energy Technology Data Exchange (ETDEWEB)

    Seo, Mirinae; Sohn, Yu Mee [Dept. of Radiology, Kyung Hee University Hospital, College of Medicine, Kyung Hee University, Seoul (Korea, Republic of); Ryu, Jung Kyu; Jahng, Geon Ho; Rhee, Sun Jung; Oh, Jang Hoon; Won, Kyu Yeoun [Kyung Hee University Hospital at Gangdong, College of Medicine, Kyung Hee University, Seoul (Korea, Republic of)

    2017-01-15

    The purpose of this study was to estimate the T2* relaxation time in breast cancer, and to evaluate the association between the T2* value with clinical-imaging-pathological features of breast cancer. Between January 2011 and July 2013, 107 consecutive women with 107 breast cancers underwent multi-echo T2*-weighted imaging on a 3T clinical magnetic resonance imaging system. The Student's t test and one-way analysis of variance were used to compare the T2* values of cancer for different groups, based on the clinical-imaging-pathological features. In addition, multiple linear regression analysis was performed to find independent predictive factors associated with the T2* values. Of the 107 breast cancers, 92 were invasive and 15 were ductal carcinoma in situ (DCIS). The mean T2* value of invasive cancers was significantly longer than that of DCIS (p = 0.029). Signal intensity on T2-weighted imaging (T2WI) and histologic grade of invasive breast cancers showed significant correlation with T2* relaxation time in univariate and multivariate analysis. Breast cancer groups with higher signal intensity on T2WI showed longer T2* relaxation time (p = 0.005). Cancer groups with higher histologic grade showed longer T2* relaxation time (p = 0.017). The T2* value is significantly longer in invasive cancer than in DCIS. In invasive cancers, T2* relaxation time is significantly longer in higher histologic grades and high signal intensity on T2WI. Based on these preliminary data, quantitative T2* mapping has the potential to be useful in the characterization of breast cancer.

  4. Evaluation of iron deposits in the reticuloendothelial system using T2-relaxation rate of MRI. Relation with serum ferritin and Fe concentration

    International Nuclear Information System (INIS)

    Ootsuka, Kae; Togami, Izumi; Kitagawa, Takahiro

    1996-01-01

    MR imaging is a useful non-invasive technique to detect iron deposits in many organs, but it is difficult to evaluate quantitatively. This study was performed to determine the possibility whether T2 relaxation rate (1/T2) could quantify iron deposits in the reticuloendothelial system (liver, spleen and bone marrow) of 11 patients and four normal volunteers. A moderate correlation was obtained between T2-relaxation rate and the serum ferritin level. These results suggest that T2-relaxation rate may provide useful information for the repeated quantitative evaluation of patients with iron-overload-syndromes. (author)

  5. Multiscale approach to mechanical behavior of polymeric nanocomposites: an application of T1.rho.(13C) relaxation experiments at variable spin-locking fields

    Czech Academy of Sciences Publication Activity Database

    Kotek, Jiří; Brus, Jiří

    2014-01-01

    Roč. 59, č. 9 (2014), s. 662-666 ISSN 0032-2725 R&D Projects: GA ČR(CZ) GA13-29009S Institutional support: RVO:61389013 Keywords : polyamide 6 * nanocomposite * T1ρ(13C) relaxation Subject RIV: JI - Composite Materials Impact factor: 0.633, year: 2014

  6. Variable setpoint as a relaxing component in physiological control.

    Science.gov (United States)

    Risvoll, Geir B; Thorsen, Kristian; Ruoff, Peter; Drengstig, Tormod

    2017-09-01

    Setpoints in physiology have been a puzzle for decades, and especially the notion of fixed or variable setpoints have received much attention. In this paper, we show how previously presented homeostatic controller motifs, extended with saturable signaling kinetics, can be described as variable setpoint controllers. The benefit of a variable setpoint controller is that an observed change in the concentration of the regulated biochemical species (the controlled variable) is fully characterized, and is not considered a deviation from a fixed setpoint. The variation in this biochemical species originate from variation in the disturbances (the perturbation), and thereby in the biochemical species representing the controller (the manipulated variable). Thus, we define an operational space which is spanned out by the combined high and low levels of the variations in (1) the controlled variable, (2) the manipulated variable, and (3) the perturbation. From this operational space, we investigate whether and how it imposes constraints on the different motif parameters, in order for the motif to represent a mathematical model of the regulatory system. Further analysis of the controller's ability to compensate for disturbances reveals that a variable setpoint represents a relaxing component for the controller, in that the necessary control action is reduced compared to that of a fixed setpoint controller. Such a relaxing component might serve as an important property from an evolutionary point of view. Finally, we illustrate the principles using the renal sodium and aldosterone regulatory system, where we model the variation in plasma sodium as a function of salt intake. We show that the experimentally observed variations in plasma sodium can be interpreted as a variable setpoint regulatory system. © 2017 The Authors. Physiological Reports published by Wiley Periodicals, Inc. on behalf of The Physiological Society and the American Physiological Society.

  7. Rapid simultaneous high-resolution mapping of myelin water fraction and relaxation times in human brain using BMC-mcDESPOT.

    Science.gov (United States)

    Bouhrara, Mustapha; Spencer, Richard G

    2017-02-15

    A number of central nervous system (CNS) diseases exhibit changes in myelin content and magnetic resonance longitudinal, T 1 , and transverse, T 2 , relaxation times, which therefore represent important biomarkers of CNS pathology. Among the methods applied for measurement of myelin water fraction (MWF) and relaxation times, the multicomponent driven equilibrium single pulse observation of T 1 and T 2 (mcDESPOT) approach is of particular interest. mcDESPOT permits whole brain mapping of multicomponent T 1 and T 2 , with data acquisition accomplished within a clinically realistic acquisition time. Unfortunately, previous studies have indicated the limited performance of mcDESPOT in the setting of the modest signal-to-noise range of high-resolution mapping, required for the depiction of small structures and to reduce partial volume effects. Recently, we showed that a new Bayesian Monte Carlo (BMC) analysis substantially improved determination of MWF from mcDESPOT imaging data. However, our previous study was limited in that it did not discuss determination of relaxation times. Here, we extend the BMC analysis to the simultaneous determination of whole-brain MWF and relaxation times using the two-component mcDESPOT signal model. Simulation analyses and in-vivo human brain studies indicate the overall greater performance of this approach compared to the stochastic region contraction (SRC) algorithm, conventionally used to derive parameter estimates from mcDESPOT data. SRC estimates of the transverse relaxation time of the long T 2 fraction, T 2,l , and the longitudinal relaxation time of the short T 1 fraction, T 1,s , clustered towards the lower and upper parameter search space limits, respectively, indicating failure of the fitting procedure. We demonstrate that this effect is absent in the BMC analysis. Our results also showed improved parameter estimation for BMC as compared to SRC for high-resolution mapping. Overall we find that the combination of BMC analysis

  8. Coaxial helicity injection and n=1 relaxation activity in the HIST spherical torus

    International Nuclear Information System (INIS)

    Nagata, M.

    2002-01-01

    Coaxial Helicity Injection (CHI) has demonstrated non-inductive current generation of spherical tokamak (ST) and spheromak plasmas on several devices. In order to understand comprehensively the role of the n=1 instability and relaxation on current generation processes in helicity-driven spherical systems, we have investigated dynamics of ST plasmas produced in the HIST device (major radius R=0.30 m, minor radius a=0.24 m, aspect ratio A=1.25, toroidal field B t t <150 kA and discharge time t<5 ms in the ST configuration) by decreasing the external toroidal field (TF) and reversing its sign in time. In results, we have discovered that the ST relaxes towards flipped ST configurations through formation of reversed-field pinches (RFPs)-like magnetic field profiles. Surprisingly, it has been observed that not only toroidal flux but also poloidal flux reverses sign spontaneously during the relaxation process. This self-reversal of the poloidal field is thought to be evidence for 'global helicity conservation'. Furthermore, we have first demonstrated that a flipped ST plasma can be successfully sustained by CHI. (author)

  9. Discuss the value of T2 relaxation time in the research of femorotibial joint biological tissue

    International Nuclear Information System (INIS)

    Zhong Jinglian; Song Lingling; Liang Biling; Ye Ruixin; Yun Wenjuan

    2009-01-01

    Objective: To discuss the value of T 2 relaxation time in the research of the biomechanics and function of cartilage of knee joint. Methods: Knees of 20 healthy adults and 19 osteoarthritis patients were examined with sagittal 8-echo sequence. The T 2 value of cartilage was calculated. The T 2 values in the superficial and deeper cartilage of femoral and tibial joint were compared, so did between the osteoarthritis patients and healthy adults. Results: The T 2 values in the superficial and the deeper tibital cartilage were (48.8±6.3) ms, (44.3±5.7) ms, respectively. The T 2 values in the superficial and deeper femoral cartilage were (52.1±5.7) ms, (47.7±5.3) ms, respectively. There was a significant difference between superficial and deeper femoral cartilage (t=3.148 and t=3.384, P 2 value in the tibial cartilage of osteoarthritis patients was (56.0±9.1) ms and was higher than that of healthy adults. There was a significant difference between osteoarthritis patients and healthy adults (t=-3.446, P 2 relaxation time can be used in the research of the biomechanics and function of cartilage and has a application value in clinical diagnosis. (authors)

  10. A study of spin-lattice relaxation rates of glucose, fructose, sucrose and cherries using high-T c SQUID-based NMR in ultralow magnetic fields

    Science.gov (United States)

    Liao, Shu-Hsien; Wu, Pei-Che

    2017-08-01

    We study the concentration dependence of spin-lattice relaxation rates, T 1 -1, of glucose, fructose, sucrose and cherries by using high-T c SQUID-based NMR at magnetic fields of ˜97 μT. The detected NMR signal, Sy (T Bp), is fitted to [1 - exp(-T Bp/T 1)] to derive T 1 -1, where Sy (T Bp) is the strength of the NMR signal, T Bp is the duration of pre-polarization and T 1 -1 is the spin-lattice relaxation rate. It was found that T 1 -1 increases as the sugar concentrations increase. The increased T 1 -1 is due to the presence of more molecules in the surroundings, which increases the spin-lattice interaction and in turn enhances T 1 -1. The T 1 -1 versus degrees Brix curve provides a basis for determining unknown Brix values for cherries as well as other fruits.

  11. Nuclear magnetic relaxation induced by exchange-mediated orientational randomization: longitudinal relaxation dispersion for a dipole-coupled spin-1/2 pair.

    Science.gov (United States)

    Chang, Zhiwei; Halle, Bertil

    2013-10-14

    In complex biological or colloidal samples, magnetic relaxation dispersion (MRD) experiments using the field-cycling technique can characterize molecular motions on time scales ranging from nanoseconds to microseconds, provided that a rigorous theory of nuclear spin relaxation is available. In gels, cross-linked proteins, and biological tissues, where an immobilized macromolecular component coexists with a mobile solvent phase, nuclear spins residing in solvent (or cosolvent) species relax predominantly via exchange-mediated orientational randomization (EMOR) of anisotropic nuclear (electric quadrupole or magnetic dipole) couplings. The physical or chemical exchange processes that dominate the MRD typically occur on a time scale of microseconds or longer, where the conventional perturbation theory of spin relaxation breaks down. There is thus a need for a more general relaxation theory. Such a theory, based on the stochastic Liouville equation (SLE) for the EMOR mechanism, is available for a single quadrupolar spin I = 1. Here, we present the corresponding theory for a dipole-coupled spin-1/2 pair. To our knowledge, this is the first treatment of dipolar MRD outside the motional-narrowing regime. Based on an analytical solution of the spatial part of the SLE, we show how the integral longitudinal relaxation rate can be computed efficiently. Both like and unlike spins, with selective or non-selective excitation, are treated. For the experimentally important dilute regime, where only a small fraction of the spin pairs are immobilized, we obtain simple analytical expressions for the auto-relaxation and cross-relaxation rates which generalize the well-known Solomon equations. These generalized results will be useful in biophysical studies, e.g., of intermittent protein dynamics. In addition, they represent a first step towards a rigorous theory of water (1)H relaxation in biological tissues, which is a prerequisite for unravelling the molecular basis of soft

  12. Thermodynamic scaling of α-relaxation time and viscosity stems from the Johari-Goldstein β-relaxation or the primitive relaxation of the coupling model.

    Science.gov (United States)

    Ngai, K L; Habasaki, J; Prevosto, D; Capaccioli, S; Paluch, Marian

    2012-07-21

    By now it is well established that the structural α-relaxation time, τ(α), of non-associated small molecular and polymeric glass-formers obey thermodynamic scaling. In other words, τ(α) is a function Φ of the product variable, ρ(γ)/T, where ρ is the density and T the temperature. The constant γ as well as the function, τ(α) = Φ(ρ(γ)/T), is material dependent. Actually this dependence of τ(α) on ρ(γ)/T originates from the dependence on the same product variable of the Johari-Goldstein β-relaxation time, τ(β), or the primitive relaxation time, τ(0), of the coupling model. To support this assertion, we give evidences from various sources itemized as follows. (1) The invariance of the relation between τ(α) and τ(β) or τ(0) to widely different combinations of pressure and temperature. (2) Experimental dielectric and viscosity data of glass-forming van der Waals liquids and polymer. (3) Molecular dynamics simulations of binary Lennard-Jones (LJ) models, the Lewis-Wahnström model of ortho-terphenyl, 1,4 polybutadiene, a room temperature ionic liquid, 1-ethyl-3-methylimidazolium nitrate, and a molten salt 2Ca(NO(3))(2)·3KNO(3) (CKN). (4) Both diffusivity and structural relaxation time, as well as the breakdown of Stokes-Einstein relation in CKN obey thermodynamic scaling by ρ(γ)/T with the same γ. (5) In polymers, the chain normal mode relaxation time, τ(N), is another function of ρ(γ)/T with the same γ as segmental relaxation time τ(α). (6) While the data of τ(α) from simulations for the full LJ binary mixture obey very well the thermodynamic scaling, it is strongly violated when the LJ interaction potential is truncated beyond typical inter-particle distance, although in both cases the repulsive pair potentials coincide for some distances.

  13. Off-resonance R1ρ relaxation outside of the fast exchange limit: An experimental study of a cavity mutant of T4 lysozyme

    International Nuclear Information System (INIS)

    Korzhnev, Dmitry M.; Orekhov, Vladislav Yu.; Dahlquist, Frederick W.; Kay, Lewis E.

    2003-01-01

    An 15 N off-resonance R 1ρ spin relaxation study of an L99A point mutant of T4 lysozyme is presented. Previous CPMG-based relaxation dispersion studies of exchange in this protein have established that the molecule interconverts between a populated ground state and an excited state (3.4%) with an exchange rate constant of 1450 s -1 at 25 deg. C. It is shown that for the majority of residues in this protein the offset dependence of the R 1ρ relaxation rates cannot be well fit using models which are only valid in the fast exchange regime. In contrast, a recently derived expression by Trott and Palmer (J. Magn. Reson., 154, 157-160, 2002) which is valid over a wider window of exchange than other relations, is shown to fit the data well. Values of (signed) chemical shift differences between exchanging sites have been extracted and are in reasonable agreement with shift differences measured using CPMG methods. A set of simulations is presented which help establish the exchange regimes that are best suited to analysis by off-resonance R 1ρ techniques

  14. T2 relaxation time is related to liver fibrosis severity

    Science.gov (United States)

    Siqueira, Luiz; Uppal, Ritika; Alford, Jamu; Fuchs, Bryan C.; Yamada, Suguru; Tanabe, Kenneth; Chung, Raymond T.; Lauwers, Gregory; Chew, Michael L.; Boland, Giles W.; Sahani, Duhyant V.; Vangel, Mark; Hahn, Peter F.; Caravan, Peter

    2016-01-01

    Background The grading of liver fibrosis relies on liver biopsy. Imaging techniques, including elastography and relaxometric, techniques have had varying success in diagnosing moderate fibrosis. The goal of this study was to determine if there is a relationship between the T2-relaxation time of hepatic parenchyma and the histologic grade of liver fibrosis in patients with hepatitis C undergoing both routine, liver MRI and liver biopsy, and to validate our methodology with phantoms and in a rat model of liver fibrosis. Methods This study is composed of three parts: (I) 123 patients who underwent both routine, clinical liver MRI and biopsy within a 6-month period, between July 1999 and January 2010 were enrolled in a retrospective study. MR imaging was performed at 1.5 T using dual-echo turbo-spin echo equivalent pulse sequence. T2 relaxation time of liver parenchyma in patients was calculated by mono-exponential fit of a region of interest (ROI) within the right lobe correlating to histopathologic grading (Ishak 0–6) and routine serum liver inflammation [aspartate aminotransferase (AST) and alanine aminotransferase (ALT)]. Statistical comparison was performed using ordinary logistic and ordinal logistic regression and ANOVA comparing T2 to Ishak fibrosis without and using AST and ALT as covariates; (II) a phantom was prepared using serial dilutions of dextran coated magnetic iron oxide nanoparticles. T2 weighed imaging was performed by comparing a dual echo fast spin echo sequence to a Carr-Purcell-Meigboom-Gill (CPMG) multi-echo sequence at 1.5 T. Statistical comparison was performed using a paired t-test; (III) male Wistar rats receiving weekly intraperitoneal injections of phosphate buffer solution (PBS) control (n=4 rats); diethylnitrosamine (DEN) for either 5 (n=5 rats) or 8 weeks (n=4 rats) were MR imaged on a Bruker Pharmascan 4.7 T magnet with a home-built bird-cage coil. T2 was quantified by using a mono-exponential fitting algorithm on multi-slice multi

  15. Novel spin dynamics in ferrimagnetic molecular chains from {sup 1}H NMR and {mu}SR spin-lattice relaxation measurements

    Energy Technology Data Exchange (ETDEWEB)

    Micotti, E. E-mail: micotti@fisicavolta.unipv.it; Lascialfari, A.; Rigamonti, A.; Aldrovandi, S.; Caneschi, A.; Gatteschi, D.; Bogani, L

    2004-05-01

    The spin dynamics in the helical chain Co(hfac){sub 2}NITPhOMe has been investigated by {sup 1}H NMR and {mu}SR relaxation. In the temperature range 15<T<60 K, the results are consistent with the relaxation of the homogeneous magnetization. For T{<=}15 K, NMR and {mu}SR evidence a second spin relaxation mechanism, undetected by the magnetization measurements. From the analysis of these data, insights on this novel relaxation process are derived.

  16. Opposing roles for RhoH GTPase during T-cell migration and activation

    DEFF Research Database (Denmark)

    Baker, Christina M; Comrie, William A; Hyun, Young-Min

    2012-01-01

    T cells spend the majority of their time perusing lymphoid organs in search of cognate antigen presented by antigen presenting cells (APCs) and then quickly recirculate through the bloodstream to another lymph node. Therefore, regulation of a T-cell response is dependent upon the ability of cells...

  17. Relaxation dispersion in MRI induced by fictitious magnetic fields.

    Science.gov (United States)

    Liimatainen, Timo; Mangia, Silvia; Ling, Wen; Ellermann, Jutta; Sorce, Dennis J; Garwood, Michael; Michaeli, Shalom

    2011-04-01

    A new method entitled Relaxation Along a Fictitious Field (RAFF) was recently introduced for investigating relaxations in rotating frames of rank ≥ 2. RAFF generates a fictitious field (E) by applying frequency-swept pulses with sine and cosine amplitude and frequency modulation operating in a sub-adiabatic regime. In the present work, MRI contrast is created by varying the orientation of E, i.e. the angle ε between E and the z″ axis of the second rotating frame. When ε > 45°, the amplitude of the fictitious field E generated during RAFF is significantly larger than the RF field amplitude used for transmitting the sine/cosine pulses. Relaxation during RAFF was investigated using an invariant-trajectory approach and the Bloch-McConnell formalism. Dipole-dipole interactions between identical (like) spins and anisochronous exchange (e.g., exchange between spins with different chemical shifts) in the fast exchange regime were considered. Experimental verifications were performed in vivo in human and mouse brain. Theoretical and experimental results demonstrated that changes in ε induced a dispersion of the relaxation rate constants. The fastest relaxation was achieved at ε ≈ 56°, where the averaged contributions from transverse components during the pulse are maximal and the contribution from longitudinal components are minimal. RAFF relaxation dispersion was compared with the relaxation dispersion achieved with off-resonance spin lock T(₁ρ) experiments. As compared with the off-resonance spin lock T(₁ρ) method, a slower rotating frame relaxation rate was observed with RAFF, which under certain experimental conditions is desirable. Copyright © 2011 Elsevier Inc. All rights reserved.

  18. Rapid T1 quantification based on 3D phase sensitive inversion recovery

    Directory of Open Access Journals (Sweden)

    Warntjes Marcel JB

    2010-08-01

    Full Text Available Abstract Background In Contrast Enhanced Magnetic Resonance Imaging fibrotic myocardium can be distinguished from healthy tissue using the difference in the longitudinal T1 relaxation after administration of Gadolinium, the so-called Late Gd Enhancement. The purpose of this work was to measure the myocardial absolute T1 post-Gd from a single breath-hold 3D Phase Sensitivity Inversion Recovery sequence (PSIR. Equations were derived to take the acquisition and saturation effects on the magnetization into account. Methods The accuracy of the method was investigated on phantoms and using simulations. The method was applied to a group of patients with suspected myocardial infarction where the absolute difference in relaxation of healthy and fibrotic myocardium was measured at about 15 minutes post-contrast. The evolution of the absolute R1 relaxation rate (1/T1 over time after contrast injection was followed for one patient and compared to T1 mapping using Look-Locker. Based on the T1 maps synthetic LGE images were reconstructed and compared to the conventional LGE images. Results The fitting algorithm is robust against variation in acquisition flip angle, the inversion delay time and cardiac arrhythmia. The observed relaxation rate of the myocardium is 1.2 s-1, increasing to 6 - 7 s-1 after contrast injection and decreasing to 2 - 2.5 s-1 for healthy myocardium and to 3.5 - 4 s-1 for fibrotic myocardium. Synthesized images based on the T1 maps correspond very well to actual LGE images. Conclusions The method provides a robust quantification of post-Gd T1 relaxation for a complete cardiac volume within a single breath-hold.

  19. Gd-EOB-DTPA-Enhanced MR Imaging of the Liver: The Effect on T2 Relaxation Times and Apparent Diffusion Coefficient (ADC)

    International Nuclear Information System (INIS)

    Cieszanowski, Andrzej; Podgórska, Joanna; Rosiak, Grzegorz; Maj, Edyta; Grudziński, Ireneusz P.; Kaczyński, Bartosz; Szeszkowski, Wojciech; Milczarek, Krzysztof; Rowiński, Olgierd

    2016-01-01

    To investigate the effect of gadoxetic acid disodium (Gd-EOB-DTPA) on T2 relaxation times and apparent diffusion coefficient (ADC) values of the liver and focal liver lesions on a 1.5-T system. Magnetic resonance (MR) studies of 50 patients with 35 liver lesions were retrospectively analyzed. All examinations were performed at 1.5T and included T2-weighted turbo spin-echo (TSE) and diffusion-weighted (DW) images acquired before and after intravenous administration of Gd-EOB-DTPA. To assess the effect of this hepatobiliary contrast agent on T2-weighted TSE images and DW images T2 relaxation times and ADC values of the liver and FLLs were calculated and compared pre- and post-injection. The mean T2 relaxation times of the liver and focal hepatic lesions were lower on enhanced than on unenhanced T2-weighted TSE images (decrease of 2.7% and 3.6% respectively), although these differences were not statistically significant. The mean ADC values of the liver showed statistically significant decrease (of 4.6%) on contrast-enhanced DW images, compared to unenhanced images (P>0.05). The mean ADC value of liver lesions was lower on enhanced than on unenhanced DW images, but this difference (of 2.9%) did not reach statistical significance. The mean T2 relaxation times of the liver and focal liver lesions as well as the mean ADC values of liver lesions were not significantly different before and after administration of Gd-EOB-DTPA. Therefore, acquisition of T2-weighted and DW images between the dynamic contrast-enhanced examination and hepatobiliary phase is feasible and time-saving

  20. Effect of extender oils on the stress relaxation behavior of thermoplastic vulcanizates

    Directory of Open Access Journals (Sweden)

    2008-11-01

    Full Text Available The long term mechanical behavior of oil extended thermoplastic vulcanizates (TPV based on polypropylene (PP and acrylonitrile-butadiene rubber (NBR has been characterized by means of stress relaxation experiments. The morphology of TPV and the phase specific oil distribution which depend on the content and type of oil as well as on the mixing regime have been characterized by means of Atomic Force Microscopy (AFM, Dynamic Mechanical Thermal Analysis (DMTA and Differential Scanning Calorimetrie (DSC. The discussion of the stress relaxation behavior was carried out using the two-component model, which allows splitting the initial stress into two components: a thermal activated stress component and an athermal one. A master curve was created by shifting the relaxation curves vertically and horizontally towards the reference curve. The vertical shift factor bT is a function of the temperature dependence of the athermal stress components. It was found that the oil distribution strongly affects the athermal stress component which is related to the contribution of the structural changes, e.g. crystallinity of the PP phase and the average molecular weight between the crosslinks of the NBR phase. From the temperature dependence of the horizontal shift factor aT the main viscoelastic relaxation process was determined as the α-relaxation process of the crystalline PP phase. It is not dependent on the polarity and content of the oil as well as the mixing regime.

  1. Magnetic Resonance Fingerprinting with short relaxation intervals.

    Science.gov (United States)

    Amthor, Thomas; Doneva, Mariya; Koken, Peter; Sommer, Karsten; Meineke, Jakob; Börnert, Peter

    2017-09-01

    The aim of this study was to investigate a technique for improving the performance of Magnetic Resonance Fingerprinting (MRF) in repetitive sampling schemes, in particular for 3D MRF acquisition, by shortening relaxation intervals between MRF pulse train repetitions. A calculation method for MRF dictionaries adapted to short relaxation intervals and non-relaxed initial spin states is presented, based on the concept of stationary fingerprints. The method is applicable to many different k-space sampling schemes in 2D and 3D. For accuracy analysis, T 1 and T 2 values of a phantom are determined by single-slice Cartesian MRF for different relaxation intervals and are compared with quantitative reference measurements. The relevance of slice profile effects is also investigated in this case. To further illustrate the capabilities of the method, an application to in-vivo spiral 3D MRF measurements is demonstrated. The proposed computation method enables accurate parameter estimation even for the shortest relaxation intervals, as investigated for different sampling patterns in 2D and 3D. In 2D Cartesian measurements, we achieved a scan acceleration of more than a factor of two, while maintaining acceptable accuracy: The largest T 1 values of a sample set deviated from their reference values by 0.3% (longest relaxation interval) and 2.4% (shortest relaxation interval). The largest T 2 values showed systematic deviations of up to 10% for all relaxation intervals, which is discussed. The influence of slice profile effects for multislice acquisition is shown to become increasingly relevant for short relaxation intervals. In 3D spiral measurements, a scan time reduction of 36% was achieved, maintaining the quality of in-vivo T1 and T2 maps. Reducing the relaxation interval between MRF sequence repetitions using stationary fingerprint dictionaries is a feasible method to improve the scan efficiency of MRF sequences. The method enables fast implementations of 3D spatially

  2. T2 Relaxation Time Mapping of the Cartilage Cap of Osteochondromas

    OpenAIRE

    Kim, Hee Kyung; Horn, Paul; Dardzinski, Bernard J.; Kim, Dong Hoon; Laor, Tal

    2016-01-01

    Objective Our aim was to evaluate the cartilage cap of osteochondromas using T2 maps and to compare these values to those of normal patellar cartilage, from age and gender matched controls. Materials and Methods This study was approved by the Institutional Review Board and request for informed consent was waived. Eleven children (ages 5-17 years) with osteochondromas underwent MR imaging, which included T2-weighted fat suppressed and T2 relaxation time mapping (echo time = 9-99/repetition tim...

  3. T2 relaxation time in patellar cartilage - global and regional reproducibility at 1.5 Tesla and 3 Tesla

    International Nuclear Information System (INIS)

    Glaser, C.; Horng, A.; Mendlik, T.; Weckbach, S.; Hoffmann, R.T.; Wagner, S.; Raya, J.G.; Reiser, M.; Horger, W.

    2007-01-01

    Purpose: Evaluation of the global and regional reproducibility of T2 relaxation time in patellar cartilage at 1.5 T and 3 T. Materials and Methods: 6 left patellae of 6 healthy volunteers (aged 25-30, 3 female, 3 male) were examined using a fat-saturated multiecho sequence and a T1-w 3D-FLASH sequence with water excitation at 1.5 Tesla and 3 Tesla. Three consecutive data sets were acquired within one MRI session with the examined knee being repositioned in the coil and scanner between each data set. The segmented cartilage (FLASH sequence) was overlaid on the multiecho data and T2 values were calculated for the total cartilage, 3 horizontal layers consisting of a superficial, intermedial and deep layer, 3 facets consisting of a medial, median (ridge) and lateral facet (global T2 values) and 27 ROIs/MRI slices (regional T2 value). The reproducibility (precision error) was calculated as the root mean square average of the individual standard deviations [ms] and coefficients of variation (COV) [%]. Results: The mean global reproducibility error for T2 was 3.53% (±0.38%) at 1.5 Tesla and 3.25% (±0.61%) at 3 Tesla. The mean regional reproducibility error for T2 was 8.62% (±2.61%) at 1.5 Tesla and 9.66% (±3.37%) at 3 Tesla. There was no significant difference with respect to absolute reproducibility errors between 1.5 Tesla and 3 Tesla at a constant spatial resolution. However, different reproducibility errors were found between the cartilage layers. One third of the data variability could be attributed to the influence of the different cartilage layers, and another 10% to the influence of the separate MRI slices. Conclusion: Our data provides an estimation of the global and regional reproducibility errors of T2 in healthy cartilage. In the analysis of small subregions, an increase in the regional reproducibility error must be accepted. The data may serve as a basis for sample size calculations of study populations and may contribute to the decision regarding the

  4. Cerebral abnormalities: use of calculated T1 and T2 magnetic resonance images for diagnosis

    International Nuclear Information System (INIS)

    Mills, C.M.; Crooks, L.E.; Kaufman, L.; Brant-Zawadzki, M.

    1984-01-01

    The potential clinical importance of T1 and T2 relaxation times in distinguishing normal and pathologic tissue with magnetic resonance (MR) is discussed and clinical examples of cerebral abnormalities are given. Five patients with cerebral infarction, 15 with multiple sclerosis, two with Wilson disease, and four with tumors were imaged. Hemorrhagic and ischemic cerebrovascular accidents were distinguished using the spin echo technique. In the patients with multiple sclerosis, lesions had prolonged T1 and T2 times, but the definition of plaque was limited by spatial resolution. No abnormalities in signal intensity were seen in the patient with Wilson disease who was no longer severly disabled; abnormal increased signal intensity in the basal ganglia was found in the second patient with Wilson disease. Four tumors produced abnormal T1 and T2 relaxation times but these values alone were not sufficient for tumor characterization

  5. Relaxation of fibrils in blends with one viscoelastic component: Bulk and confined conditions

    NARCIS (Netherlands)

    Cardinaels, R.M.; Moldenaers, P.

    2010-01-01

    Using a counter rotating parallel plate shear flow cell, shape relaxation of fibrils in a quiescent matrix is studied microscopically. Both the effects of geometrical confinement and component viscoelasticity are systematically explored. By applying a supercritical shear flow for varying amounts of

  6. In vivo estimation of transverse relaxation time constant (T2 ) of 17 human brain metabolites at 3T.

    Science.gov (United States)

    Wyss, Patrik O; Bianchini, Claudio; Scheidegger, Milan; Giapitzakis, Ioannis A; Hock, Andreas; Fuchs, Alexander; Henning, Anke

    2018-08-01

    The transverse relaxation times T 2 of 17 metabolites in vivo at 3T is reported and region specific differences are addressed. An echo-time series protocol was applied to one, two, or three volumes of interest with different fraction of white and gray matter including a total number of 106 healthy volunteers and acquiring a total number of 128 spectra. The data were fitted with the 2D fitting tool ProFit2, which included individual line shape modeling for all metabolites and allowed the T 2 calculation of 28 moieties of 17 metabolites. The T 2 of 10 metabolites and their moieties have been reported for the first time. Region specific T 2 differences in white and gray matter enriched tissue occur in 16 of 17 metabolites examined including single resonance lines and coupled spin systems. The relaxation time T 2 is regions specific and has to be considered when applying tissue composition correction for internal water referencing. Magn Reson Med 80:452-461, 2018. © 2018 International Society for Magnetic Resonance in Medicine. © 2018 International Society for Magnetic Resonance in Medicine.

  7. Measurement of alveolar oxygen partial pressure in the rat lung using Carr-Purcell-Meiboom-Gill spin-spin relaxation times of hyperpolarized 3He and 129Xe at 74 mT.

    Science.gov (United States)

    Kraayvanger, Ryan J; Bidinosti, Christopher P; Dominguez-Viqueira, William; Parra-Robles, Juan; Fox, Matthew; Lam, Wilfred W; Santyr, Giles E

    2010-11-01

    Regional measurement of alveolar oxygen partial pressure can be obtained from the relaxation rates of hyperpolarized noble gases, (3) He and (129) Xe, in the lungs. Recently, it has been demonstrated that measurements of alveolar oxygen partial pressure can be obtained using the spin-spin relaxation rate (R(2) ) of (3) He at low magnetic field strengths (oxygen partial pressure measurements based on Carr-Purcell-Meiboom-Gill R(2) values of hyperpolarized (3) He and (129) Xe in vitro and in vivo in the rat lung at low magnetic field strength (74 mT) are presented. In vitro spin-spin relaxivity constants for (3) He and (129) Xe were determined to be (5.2 ± 0.6) × 10(-6) Pa(-1) sec(-1) and (7.3 ± 0.4) × 10(-6) Pa(-1) s(-1) compared with spin-lattice relaxivity constants of (4.0 ± 0.4) × 10(-6) Pa(-1) s(-1) and (4.3 ± 1.3) × 10(-6) Pa(-1) s(-1), respectively. In vivo experimental measurements of alveolar oxygen partial pressure using (3) He in whole rat lung show good agreement (r(2) = 0.973) with predictions based on lung volumes and ventilation parameters. For (129) Xe, multicomponent relaxation was observed with one component exhibiting an increase in R(2) with decreasing alveolar oxygen partial pressure. Copyright © 2010 Wiley-Liss, Inc.

  8. Local spin dynamics at low temperature in the slowly relaxing molecular chain [Dy(hfac)3(NIT(C6H4OPh))]: A μ+ spin relaxation study

    International Nuclear Information System (INIS)

    Arosio, Paolo; Orsini, Francesco; Corti, Maurizio; Mariani, Manuel; Bogani, Lapo; Caneschi, Andrea; Lago, Jorge; Lascialfari, Alessandro

    2015-01-01

    The spin dynamics of the molecular magnetic chain [Dy(hfac) 3 (NIT(C 6 H 4 OPh))] were investigated by means of the Muon Spin Relaxation (μ + SR) technique. This system consists of a magnetic lattice of alternating Dy(III) ions and radical spins, and exhibits single-chain-magnet behavior. The magnetic properties of [Dy(hfac) 3 (NIT(C 6 H 4 OPh))] have been studied by measuring the magnetization vs. temperature at different applied magnetic fields (H = 5, 3500, and 16500 Oe) and by performing μ + SR experiments vs. temperature in zero field and in a longitudinal applied magnetic field H = 3500 Oe. The muon asymmetry P(t) was fitted by the sum of three components, two stretched-exponential decays with fast and intermediate relaxation times, and a third slow exponential decay. The temperature dependence of the spin dynamics has been determined by analyzing the muon longitudinal relaxation rate λ interm (T), associated with the intermediate relaxing component. The experimental λ interm (T) data were fitted with a corrected phenomenological Bloembergen-Purcell-Pound law by using a distribution of thermally activated correlation times, which average to τ = τ 0 exp(Δ/k B T), corresponding to a distribution of energy barriers Δ. The correlation times can be associated with the spin freezing that occurs when the system condenses in the ground state

  9. Rotational dynamics of benzene and water in an ionic liquid explored via molecular dynamics simulations and NMR T1 measurements.

    Science.gov (United States)

    Yasaka, Yoshiro; Klein, Michael L; Nakahara, Masaru; Matubayasi, Nobuyuki

    2012-02-21

    The rotational dynamics of benzene and water in the ionic liquid (IL) 1-butyl-3-methylimidazolium chloride are studied using molecular dynamics (MD) simulation and NMR T(1) measurements. MD trajectories based on an effective potential are used to calculate the (2)H NMR relaxation time, T(1) via Fourier transform of the relevant rotational time correlation function, C(2R)(t). To compensate for the lack of polarization in the standard fixed-charge modeling of the IL, an effective ionic charge, which is smaller than the elementary charge is employed. The simulation results are in closest agreement with NMR experiments with respect to the temperature and Larmor frequency dependencies of T(1) when an effective charge of ±0.5e is used for the anion and the cation, respectively. The computed C(2R)(t) of both solutes shows a bi-modal nature, comprised of an initial non-diffusive ps relaxation plus a long-time ns tail extending to the diffusive regime. Due to the latter component, the solute dynamics is not under the motional narrowing condition with respect to the prevalent Larmor frequency. It is shown that the diffusive tail of the C(2R)(t) is most important to understand frequency and temperature dependencies of T(1) in ILs. On the other hand, the effect of the initial ps relaxation is an increase of T(1) by a constant factor. This is equivalent to an "effective" reduction of the quadrupolar coupling constant (QCC). Thus, in the NMR T(1) analysis, the rotational time correlation function can be modeled analytically in the form of aexp (-t/τ) (Lipari-Szabo model), where the constant a, the Lipari-Szabo factor, contains the integrated contribution of the short-time relaxation and τ represents the relaxation time of the exponential (diffusive) tail. The Debye model is a special case of the Lipari-Szabo model with a = 1, and turns out to be inappropriate to represent benzene and water dynamics in ILs since a is as small as 0.1. The use of the Debye model would result in

  10. Articular Cartilage of the Human Knee Joint: In Vivo Multicomponent T2 Analysis at 3.0 T

    Science.gov (United States)

    Choi, Kwang Won; Samsonov, Alexey; Spencer, Richard G.; Wilson, John J.; Block, Walter F.; Kijowski, Richard

    2015-01-01

    Purpose To compare multicomponent T2 parameters of the articular cartilage of the knee joint measured by using multicomponent driven equilibrium single-shot observation of T1 and T2 (mcDESPOT) in asymptomatic volunteers and patients with osteoarthritis. Materials and Methods This prospective study was performed with institutional review board approval and with written informed consent from all subjects. The mcDESPOT sequence was performed in the knee joint of 13 asymptomatic volunteers and 14 patients with osteoarthritis of the knee. Single-component T2 (T2Single), T2 of the fast-relaxing water component (T2F) and of the slow-relaxing water component (T2S), and the fraction of the fast-relaxing water component (FF) of cartilage were measured. Wilcoxon rank-sum tests and multivariate linear regression models were used to compare mcDESPOT parameters between volunteers and patients with osteoarthritis. Receiver operating characteristic analysis was used to assess diagnostic performance with mcDESPOT parameters for distinguishing morphologically normal cartilage from morphologically degenerative cartilage identified at magnetic resonance imaging in eight cartilage subsections of the knee joint. Results Higher cartilage T2Single (P cartilage FF (P cartilage T2F (P = .079) and T2S (P = .124) values were seen in patients with osteoarthritis compared with those in asymptomatic volunteers. Differences in T2Single and FF remained significant (P cartilage (P cartilage T2Single and significantly lower cartilage FF than did asymptomatic volunteers, and receiver operating characteristic analysis results suggested that FF may allow greater diagnostic performance than that with T2Single for distinguishing between normal and degenerative cartilage. © RSNA, 2015 Online supplemental material is available for this article. PMID:26024307

  11. Synthesis of Tumor-avid Photosensitizer-Gd(III)DTPA conjugates: impact of the number of gadolinium units in T1/T2 relaxivity, intracellular localization, and photosensitizing efficacy.

    Science.gov (United States)

    Goswami, Lalit N; White, William H; Spernyak, Joseph A; Ethirajan, Manivannan; Chen, Yihui; Missert, Joseph R; Morgan, Janet; Mazurchuk, Richard; Pandey, Ravindra K

    2010-05-19

    To develop novel bifunctional agents for tumor imaging (MR) and photodynamic therapy (PDT), certain tumor-avid photosensitizers derived from chlorophyll-a were conjugated with variable number of Gd(III)aminobenzyl DTPA moieties. All the conjugates containing three or six gadolinium units showed significant T(1) and T(2) relaxivities. However, as a bifunctional agent, the 3-(1'-hexyloxyethyl)pyropheophorbide-a (HPPH) containing 3Gd(III) aminophenyl DTPA was most promising with possible applications in tumor-imaging and PDT. Compared to HPPH, the corresponding 3- and 6Gd(III)aminobenzyl DTPA conjugates exhibited similar electronic absorption characteristics with a slightly decreased intensity of the absorption band at 660 nm. However, compared to HPPH, the excitation of the broad "Soret" band (near 400 nm) of the corresponding 3Gd(III)aminobenzyl-DTPA analogues showed a significant decrease in the fluorescence intensity at 667 nm.

  12. Osteosarcoma: correlation of T1 map and histology map

    International Nuclear Information System (INIS)

    Suh, Jin Suck; Yun, Mi Jin; Jeong, Eun Kee; Shin, Kyoo Ho; Yang, Woo Ick

    1999-01-01

    To determine whether T1 mapping shows regional differences between viable and necrotic regions of osteosarcomas after anticancer chemotherapy and to assess whether this mapping is able to express the characteristics of various intramural tissue components. Eleven of 20 osteosarcomas were included in this study, while the remaining nine were excluded because the tumor site was inappropriate for comparison of T1 map and tumor macrosection. All patients underwent MR imaging for the purpose of T1 mapping, followed by pre-operative chemotherapy and subsequent limb-salvage surgery. Spin echo pulse sequencing was used with varying TR (100, 200, 400, 800, 1600, and 2400 msec) and a constant TE of 20 msec. Using a C-language software program, T1 relaxation time was calculated on a pixel-by-pixel basis and then a T1 map was generated by using a post-processing program, NIH Image. We attempted correlation of the T1 map and histologic findings, particularly in regions of interest(ROI) if certain areas were different from other regions on either the T1 or histologic map. Value was expressed as an average of the ratio of T1 of ROI and T1 of fat tissue, and this was used as an internal reference for normalization of the measurement. Tumor necrosis was 100 %(Grade IV) in six specimens, and over 90 % (Grade III) in five. Viable tumor cells were found mostly in regions with chondroid matrix and seldom in regions with osteoid matrix. Regardless of cell viability, values ranged from 0.9 to 9.87(mean, 4.02) in tumor necrotic area with osteoid matrices, and from 3.04 to 3.9(mean, 3.55) in areas with chondroid matrices. Other regions with fibrous tissue proliferation, hemorrhage, and fatty necrosis showed values of 2.92-9.83(mean, 7.20), 2.65-5.96(mean,3.59), and 1.43-3.11(mean, 2.68) respectively. The values of various tissues overlapped. No statistically significant difference was found between regions in which tumors were viable and those with tumor necrosis. Although we hypothesized

  13. NMR relaxation times of natural rubber latex

    International Nuclear Information System (INIS)

    Harun, S.; Aziz, H.; Basir, Z.

    1994-01-01

    NMR relaxation times T sub 1 and T sub 2 of natural rubber latex have been measured at 25 degree C on a pulsed NMR spectrometer. The work focuses on the variation of the relaxation times with the amount of water content from 0% to 50%. The water content was adjusted by centrifuging and removing a certain amount of water from the sample. The data were analysed using a biexponential fitting procedure which yields simultaneously either T sub 1a and T sub 1b or T sub 2a and T sub 2b. The amount of solid was compared with the known amount of dry rubber content

  14. Novel spin dynamics in ferrimagnetic molecular chains from 1H NMR and μSR spin-lattice relaxation measurements

    International Nuclear Information System (INIS)

    Micotti, E.; Lascialfari, A.; Rigamonti, A.; Aldrovandi, S.; Caneschi, A.; Gatteschi, D.; Bogani, L.

    2004-01-01

    The spin dynamics in the helical chain Co(hfac) 2 NITPhOMe has been investigated by 1 H NMR and μSR relaxation. In the temperature range 15< T<60 K, the results are consistent with the relaxation of the homogeneous magnetization. For T≤15 K, NMR and μSR evidence a second spin relaxation mechanism, undetected by the magnetization measurements. From the analysis of these data, insights on this novel relaxation process are derived

  15. Novel spin dynamics in ferrimagnetic molecular chains from 1H NMR and μSR spin-lattice relaxation measurements

    Science.gov (United States)

    Micotti, E.; Lascialfari, A.; Rigamonti, A.; Aldrovandi, S.; Caneschi, A.; Gatteschi, D.; Bogani, L.

    2004-05-01

    The spin dynamics in the helical chain Co(hfac) 2NITPhOMe has been investigated by 1H NMR and μSR relaxation. In the temperature range 15<T<60 K, the results are consistent with the relaxation of the homogeneous magnetization. For T⩽15 K, NMR and μSR evidence a second spin relaxation mechanism, undetected by the magnetization measurements. From the analysis of these data, insights on this novel relaxation process are derived.

  16. Acrolein relaxes mouse isolated tracheal smooth muscle via a TRPA1-dependent mechanism.

    Science.gov (United States)

    Cheah, Esther Y; Burcham, Philip C; Mann, Tracy S; Henry, Peter J

    2014-05-01

    Airway sensory C-fibres express TRPA1 channels which have recently been identified as a key chemosensory receptor for acrolein, a toxic and highly prevalent component of smoke. TRPA1 likely plays an intermediary role in eliciting a range of effects induced by acrolein including cough and neurogenic inflammation. Currently, it is not known whether acrolein-induced activation of TRPA1 produces other airway effects including relaxation of mouse airway smooth muscle. The aims of this study were to examine the effects of acrolein on airway smooth muscle tone in mouse isolated trachea, and to characterise the cellular and molecular mechanisms underpinning the effects of acrolein. Isometric tension recording studies were conducted on mouse isolated tracheal segments to characterise acrolein-induced relaxation responses. Release of the relaxant PGE₂ was measured by EIA to examine its role in the response. Use of selective antagonists/inhibitors permitted pharmacological characterisation of the molecular and cellular mechanisms underlying this relaxation response. Acrolein induced dose-dependent relaxation responses in mouse isolated tracheal segments. Importantly, these relaxation responses were significantly inhibited by the TRPA1 antagonists AP-18 and HC-030031, an NK₁ receptor antagonist RP-67580, and the EP₂ receptor antagonist PF-04418948, whilst completely abolished by the non-selective COX inhibitor indomethacin. Acrolein also caused rapid PGE₂ release which was suppressed by HC-030031. In summary, acrolein induced a novel bronchodilator response in mouse airways. Pharmacologic studies indicate that acrolein-induced relaxation likely involves interplay between TRPA1-expressing airway sensory C-fibres, NK₁ receptor-expressing epithelial cells, and EP₂-receptor expressing airway smooth muscle cells. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Ultrashort Echo Time Magnetic Resonance Imaging of the Lung Using a High-Relaxivity T1 Blood-Pool Contrast Agent

    Directory of Open Access Journals (Sweden)

    Joris Tchouala Nofiele

    2014-10-01

    Full Text Available The lung remains one of the most challenging organs to image using magnetic resonance imaging (MRI due to intrinsic rapid signal decay. However, unlike conventional modalities such as computed tomography, MRI does not involve radiation and can provide functional and morphologic information on a regional basis. Here we demonstrate proof of concept for a new MRI approach to achieve substantial gains in a signal to noise ratio (SNR in the lung parenchyma: contrast-enhanced ultrashort echo time (UTE imaging following intravenous injection of a high-relaxivity blood-pool manganese porphyrin T1 contrast agent. The new contrast agent increased relative enhancement of the lung parenchyma by over 10-fold compared to gadolinium diethylene triamine pentaacetic acid (Gd-DTPA, and the use of UTE boosted the SNR by a factor of 4 over conventional T1-weighted gradient echo acquisitions. The new agent also maintains steady enhancement over at least 60 minutes, thus providing a long time window for obtaining high-resolution, high-quality images and the ability to measure a number of physiologic parameters.

  18. A study on magnetic relaxation times of various organs and body fluids using superconducting magnetic resonance imaging system part I: measurement of relative signal intensity and T2 relaxation time in various portions of brain and cerebrospinal fluid

    International Nuclear Information System (INIS)

    Chang, Kee Hyun; Lee, Ghi Jai; Han, Moon Hee; Kim, Jae Ho; Han, Man Chang; Kim, Chu Wan

    1988-01-01

    This study was undertake to determine if routine clinical magnetic resonance imaging sequences using only two different repetition times (TRs) and with only two sequential echo times (TEs) can be used to measure reproducible relative signal intensity and T2 relaxation time for normal brain tissues and cerebrospinal fluid using a 2.0T superconducting system. In 47 patients 6 different anatomic sites were measured. For each anatomic location, the mean and standard deviation of these values were determined. On T1-weighted (SE 500msec/30msec) images, in globus pallidus and thalamus, of the CSF, cortical gray matter and retrobulbar fat tissue varied more, with a standard deviation of 11-14% on T1-weighted images. On T2-weighted (SE 3000msec/30msec and 3000msec/80msec) images, the relative signal intensity of all anatomic regions varied more than on T1-weighted images. The standard deviation of T2 relaxation times also varied from 10% (fat tissue) to 18% (CSF). These variations might be due to partial volume averaging, signal alteration of CSF secondary to CSF pulsatile motion, etc. Knowing that relative signal intensity and T2 relaxation times calculated from routine imaging sequences are reproducible in only limited area, these normal ranges can be used to investigate changes occurring in disease states of the limited regions.

  19. Evaluation of biexponential relaxation processes by magnetic resonance imaging. A phantom study

    DEFF Research Database (Denmark)

    Kjaer, L; Thomsen, C; Larsson, H B

    1988-01-01

    Despite the complexity of biologic tissues, a monoexponential behaviour is usually assumed when estimating relaxation processes in vivo by magnetic resonance imaging (MRI). This study was designed to evaluate the potential of biexponential decomposition of T1 and T2 relaxation curves obtained at 1...... echoes. Applying biexponential curve analysis, a significant deviation from a monoexponential behaviour was recognized at a ratio of corresponding relaxation rates of about 3 and 2, estimating T1 and T2 relaxation, respectively (p less than 0.01, F-test). Requiring an SD less than or equal to 10 per cent...

  20. Sodium and T1rho MRI for molecular and diagnostic imaging of articular cartilage.

    Science.gov (United States)

    Borthakur, Arijitt; Mellon, Eric; Niyogi, Sampreet; Witschey, Walter; Kneeland, J Bruce; Reddy, Ravinder

    2006-11-01

    In this article, both sodium magnetic resonance (MR) and T1rho relaxation mapping aimed at measuring molecular changes in cartilage for the diagnostic imaging of osteoarthritis are reviewed. First, an introduction to structure of cartilage, its degeneration in osteoarthritis (OA) and an outline of diagnostic imaging methods in quantifying molecular changes and early diagnostic aspects of cartilage degeneration are described. The sodium MRI section begins with a brief overview of the theory of sodium NMR of biological tissues and is followed by a section on multiple quantum filters that can be used to quantify both bi-exponential relaxation and residual quadrupolar interaction. Specifically, (i) the rationale behind the use of sodium MRI in quantifying proteoglycan (PG) changes, (ii) validation studies using biochemical assays, (iii) studies on human OA specimens, (iv) results on animal models and (v) clinical imaging protocols are reviewed. Results demonstrating the feasibility of quantifying PG in OA patients and comparison with that in healthy subjects are also presented. The section concludes with the discussion of advantages and potential issues with sodium MRI and the impact of new technological advancements (e.g. ultra-high field scanners and parallel imaging methods). In the theory section on T1rho, a brief description of (i) principles of measuring T1rho relaxation, (ii) pulse sequences for computing T1rho relaxation maps, (iii) issues regarding radio frequency power deposition, (iv) mechanisms that contribute to T1rho in biological tissues and (v) effects of exchange and dipolar interaction on T1rho dispersion are discussed. Correlation of T1rho relaxation rate with macromolecular content and biomechanical properties in cartilage specimens subjected to trypsin and cytokine-induced glycosaminoglycan depletion and validation against biochemical assay and histopathology are presented. Experimental T1rho data from osteoarthritic specimens, animal models

  1. Evaluation of MR imaging with T1 and T2* mapping for the determination of hepatic iron overload.

    Science.gov (United States)

    Henninger, B; Kremser, C; Rauch, S; Eder, R; Zoller, H; Finkenstedt, A; Michaely, H J; Schocke, M

    2012-11-01

    To evaluate MRI using T1 and T2* mapping sequences in patients with suspected hepatic iron overload (HIO). Twenty-five consecutive patients with clinically suspected HIO were retrospectively studied. All underwent MRI and liver biopsy. For the quantification of liver T2* values we used a fat-saturated multi-echo gradient echo sequence with 12 echoes (TR = 200 ms, TE = 0.99 ms +  n × 1.41 ms, flip angle 20°). T1 values were obtained using a fast T1 mapping sequence based on an inversion recovery snapshot FLASH sequence. Parameter maps were analysed using regions of interest. ROC analysis calculated cut-off points at 10.07 ms and 15.47 ms for T2* in the determination of HIO with accuracy 88 %/88 %, sensitivity 84 %/89.5 % and specificity 100 %/83 %. MRI correctly classified 20 patients (80 %). All patients with HIO only had decreased T1 and T2* relaxation times. There was a significant difference in T1 between patients with HIO only and patients with HIO and steatohepatitis (P = 0.018). MRI-based T2* relaxation diagnoses HIO very accurately, even at low iron concentrations. Important additional information may be obtained by the combination of T1 and T2* mapping. It is a rapid, non-invasive, accurate and reproducible technique for validating the evidence of even low hepatic iron concentrations. • Hepatic iron overload causes fibrosis, cirrhosis and increases hepatocellular carcinoma risk. • MRI detects iron because of the field heterogeneity generated by haemosiderin. • T2* relaxation is very accurate in diagnosing hepatic iron overload. • Additional information may be obtained by T1 and T2* mapping.

  2. T1-T2 dual-modal MRI of brain gliomas using PEGylated Gd-doped iron oxide nanoparticles.

    Science.gov (United States)

    Xiao, Ning; Gu, Wei; Wang, Hao; Deng, Yunlong; Shi, Xin; Ye, Ling

    2014-03-01

    To overcome the negative contrast limitations of iron oxide-based contrast agents and to improve the biocompatibility of Gd-chelate contrast agents, PEGylated Gd-doped iron oxide (PEG-GdIO) NPs as a T1-T2 dual-modal contrast agent were synthesized by the polyol method. The transverse relaxivity (r2) and longitudinal relaxivity (r1) of PEG-GdIO were determined to be 66.9 and 65.9 mM(-1) s(-1), respectively. The high r1 value and low r2/r1 ratio make PEG-GdIO NPs suitable as a T1-T2 dual-modal contrast agent. The in vivo MRI demonstrated a brighter contrast enhancement in T1-weighted image and a simultaneous darken effect in T2-weighted MR image compared to the pre-contrast image in the region of glioma. Furthermore, the biocompatibility of PEG-GdIO NPs was confirmed by the in vitro MTT cytotoxicity and in vivo histological analyses (H&E). Therefore, PEG-GdIO NPs hold great potential in T1-T2 dual-modal imaging for the diagnosis of brain glioma. Copyright © 2013 Elsevier Inc. All rights reserved.

  3. Local spin dynamics at low temperature in the slowly relaxing molecular chain [Dy(hfac)3{NIT(C6H4OPh)}]: A μ+ spin relaxation study

    Science.gov (United States)

    Arosio, Paolo; Corti, Maurizio; Mariani, Manuel; Orsini, Francesco; Bogani, Lapo; Caneschi, Andrea; Lago, Jorge; Lascialfari, Alessandro

    2015-05-01

    The spin dynamics of the molecular magnetic chain [Dy(hfac)3{NIT(C6H4OPh)}] were investigated by means of the Muon Spin Relaxation (μ+SR) technique. This system consists of a magnetic lattice of alternating Dy(III) ions and radical spins, and exhibits single-chain-magnet behavior. The magnetic properties of [Dy(hfac)3{NIT(C6H4OPh)}] have been studied by measuring the magnetization vs. temperature at different applied magnetic fields (H = 5, 3500, and 16500 Oe) and by performing μ+SR experiments vs. temperature in zero field and in a longitudinal applied magnetic field H = 3500 Oe. The muon asymmetry P(t) was fitted by the sum of three components, two stretched-exponential decays with fast and intermediate relaxation times, and a third slow exponential decay. The temperature dependence of the spin dynamics has been determined by analyzing the muon longitudinal relaxation rate λinterm(T), associated with the intermediate relaxing component. The experimental λinterm(T) data were fitted with a corrected phenomenological Bloembergen-Purcell-Pound law by using a distribution of thermally activated correlation times, which average to τ = τ0 exp(Δ/kBT), corresponding to a distribution of energy barriers Δ. The correlation times can be associated with the spin freezing that occurs when the system condenses in the ground state.

  4. Local spin dynamics at low temperature in the slowly relaxing molecular chain [Dy(hfac)3(NIT(C6H4OPh))]: A μ{sup +} spin relaxation study

    Energy Technology Data Exchange (ETDEWEB)

    Arosio, Paolo, E-mail: paolo.arosio@guest.unimi.it; Orsini, Francesco [Department of Physics, Università degli Studi di Milano, and INSTM, Milano (Italy); Corti, Maurizio [Department of Physics, Università degli Studi di Pavia and INSTM, Pavia (Italy); Mariani, Manuel [Department of Physics and Astronomy, Università degli Studi di Bologna, Bologna (Italy); Bogani, Lapo [Physikalisches Institut, Universität Stuttgart, Stuttgart (Germany); Caneschi, Andrea [INSTM and Department of Chemistry, University of Florence, Firenze (Italy); Lago, Jorge [Departamento de Quimica Inorganica, Universidad del Pais Vasco, Bilbao (Spain); Lascialfari, Alessandro [Department of Physics, Università degli Studi di Milano, and INSTM, Milano (Italy); Centro S3, Istituto Nanoscienze - CNR, Modena (Italy)

    2015-05-07

    The spin dynamics of the molecular magnetic chain [Dy(hfac){sub 3}(NIT(C{sub 6}H{sub 4}OPh))] were investigated by means of the Muon Spin Relaxation (μ{sup +}SR) technique. This system consists of a magnetic lattice of alternating Dy(III) ions and radical spins, and exhibits single-chain-magnet behavior. The magnetic properties of [Dy(hfac){sub 3}(NIT(C{sub 6}H{sub 4}OPh))] have been studied by measuring the magnetization vs. temperature at different applied magnetic fields (H = 5, 3500, and 16500 Oe) and by performing μ{sup +}SR experiments vs. temperature in zero field and in a longitudinal applied magnetic field H = 3500 Oe. The muon asymmetry P(t) was fitted by the sum of three components, two stretched-exponential decays with fast and intermediate relaxation times, and a third slow exponential decay. The temperature dependence of the spin dynamics has been determined by analyzing the muon longitudinal relaxation rate λ{sub interm}(T), associated with the intermediate relaxing component. The experimental λ{sub interm}(T) data were fitted with a corrected phenomenological Bloembergen-Purcell-Pound law by using a distribution of thermally activated correlation times, which average to τ = τ{sub 0} exp(Δ/k{sub B}T), corresponding to a distribution of energy barriers Δ. The correlation times can be associated with the spin freezing that occurs when the system condenses in the ground state.

  5. Proton NMR relaxation in hydrous melts

    International Nuclear Information System (INIS)

    Braunstein, J.; Bacarella, A.L.; Benjamin, B.M.; Brown, L.L.; Girard, C.

    1976-01-01

    Pulse and continuous wave NMR measurements are reported for protons in hydrous melts of calcium nitrate at temperatures between -4 and 120 0 C. Although measured in different temperature ranges, spin-lattice (T 1 ) and spin-spin (T 2 ) relaxation times appear to be nearly equal to each other and proportional to the self-diffusion coefficients of solute metal cations such as Cd 2+ . At temperatures near 50 0 C, mean Arrhenius coefficients Δ H/sub T 1 / (kcal/mol) are 7.9, 7.3, and 4.8, respectively, for melts containing 2.8, 4.0, and 8.0 moles of water per mole of calcium nitrate, compared to 4.6 kcal/mol for pure water. Temperature dependence of T 1 and T 2 in Ca(NO 3 ) 2 -2.8 H 2 O between -4 and 120 0 C are non-Arrhenius and can be represented by a Fulcher-type equation with a ''zero mobility temperature'' (T 0 ) of 225 0 K, close to the value of T 0 for solute diffusion, electrical conductance and viscosity. Resolution of the relaxation rates into correlation times for intramolecular (rotational) and intermolecular (translational) diffusional motion is discussed in terms of the Bloembergen-Purcell-Pound and more recent models for dipolar relaxation

  6. The freezing of water bonded in the wheat (Triticum aestivum L.) grain studied by means protons magnetic relaxation method

    International Nuclear Information System (INIS)

    Haranczyk, H.; Jasinski, G.; Strzalka, K.

    1994-01-01

    Some biological aspects of water freezing in the wheat grain have been studied using NMR methods. Measuring of the relaxation times for freezing and liquid water shown absence of T 2 ∼100 μs and T 2 ∼1 ms separated components what pointed for some different way of water bonding

  7. Solid state {sup 1}H spin-lattice relaxation and isolated-molecule and cluster electronic structure calculations in organic molecular solids: The relationship between structure and methyl group and t-butyl group rotation

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xianlong, E-mail: WangXianlong@uestc.edu.cn, E-mail: pbeckman@brynmawr.edu [Key Laboratory for NeuroInformation of Ministry of Education, School of Life Science and Technology, University of Electronic Science and Technology of China, 4 North Jianshe Rd., 2nd Section, Chengdu 610054 (China); Mallory, Frank B. [Department of Chemistry, Bryn Mawr College, 101 North Merion Ave., Bryn Mawr, Pennsylvania 19010-2899 (United States); Mallory, Clelia W. [Department of Chemistry, Bryn Mawr College, 101 North Merion Ave., Bryn Mawr, Pennsylvania 19010-2899 (United States); Department of Chemistry, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6323 (United States); Odhner, Hosanna R.; Beckmann, Peter A., E-mail: WangXianlong@uestc.edu.cn, E-mail: pbeckman@brynmawr.edu [Department of Physics, Bryn Mawr College, 101 North Merion Ave., Bryn Mawr, Pennsylvania 19010-2899 (United States)

    2014-05-21

    We report ab initio density functional theory electronic structure calculations of rotational barriers for t-butyl groups and their constituent methyl groups both in the isolated molecules and in central molecules in clusters built from the X-ray structure in four t-butyl aromatic compounds. The X-ray structures have been reported previously. We also report and interpret the temperature dependence of the solid state {sup 1}H nuclear magnetic resonance spin-lattice relaxation rate at 8.50, 22.5, and 53.0 MHz in one of the four compounds. Such experiments for the other three have been reported previously. We compare the computed barriers for methyl group and t-butyl group rotation in a central target molecule in the cluster with the activation energies determined from fitting the {sup 1}H NMR spin-lattice relaxation data. We formulate a dynamical model for the superposition of t-butyl group rotation and the rotation of the t-butyl group's constituent methyl groups. The four compounds are 2,7-di-t-butylpyrene, 1,4-di-t-butylbenzene, 2,6-di-t-butylnaphthalene, and 3-t-butylchrysene. We comment on the unusual ground state orientation of the t-butyl groups in the crystal of the pyrene and we comment on the unusually high rotational barrier of these t-butyl groups.

  8. Strain relaxation of germanium-tin (GeSn) fins

    Science.gov (United States)

    Kang, Yuye; Huang, Yi-Chiau; Lee, Kwang Hong; Bao, Shuyu; Wang, Wei; Lei, Dian; Masudy-Panah, Saeid; Dong, Yuan; Wu, Ying; Xu, Shengqiang; Tan, Chuan Seng; Gong, Xiao; Yeo, Yee-Chia

    2018-02-01

    Strain relaxation of biaxially strained Ge1-xSnx layer when it is patterned into Ge1-xSnx fin structures is studied. Ge1-xSnx-on-insulator (GeSnOI) substrate was realized using a direct wafer bonding (DWB) technique and Ge1-xSnx fin structures were formed by electron beam lithography (EBL) patterning and dry etching. The strain in the Ge1-xSnx fins having fin widths (WFin) ranging from 1 μm down to 80 nm was characterized using micro-Raman spectroscopy. Raman measurements show that the strain relaxation increases with decreasing WFin. Finite element (FE) simulation shows that the strain component in the transverse direction relaxes with decreasing WFin, while the strain component along the fin direction remains unchanged. For various Ge1-xSnx fin widths, transverse strain relaxation was further extracted using micro-Raman spectroscopy, which is consistent with the simulation results.

  9. A novel approach to modelling non-exponential spin glass relaxation

    Energy Technology Data Exchange (ETDEWEB)

    Pickup, R.M. [School of Physics and Astronomy, University of Leeds, Leeds LS2 9JT (United Kingdom)]. E-mail: r.cywinski@leeds.ac.uk; Cywinski, R. [School of Physics and Astronomy, University of Leeds, Leeds LS2 9JT (United Kingdom); Pappas, C. [Hahn-Meitner Institut, Glienicker Strasse 100, 14109 Berlin (Germany)

    2007-07-15

    A probabilistic cluster model, originally proposed by Weron to explain the universal power law of dielectric relaxation, is shown to account for the non-exponential relaxation in spin glasses above T {sub g}. Neutron spin echo spectra measured for the cluster glass compound Co{sub 55}Ga{sub 45} are well described by the Weron relaxation function, {phi}(t)={phi} {sub o}(1+k(t/{tau}) {sup {beta}}){sup -1/k}, with the interaction parameter k scaling linearly with the non-Curie-Weiss susceptibility.

  10. Relaxation cracking in the process industry, an underestimated problem

    Energy Technology Data Exchange (ETDEWEB)

    Wortel, J.C. van [TNO Institute of Industrial Technology, Apeldoorn (Netherlands)

    1999-12-31

    Austenitic components, operating between 500 and 750 deg C, can fail within 1 year service while the ordinary mechanical properties after failure are still within the code requirements. The intergranular brittle failures are situated in the welded or cold deformed areas. This type of cracking has many names, showing the uncertainty concerning the mechanism for the (catastrophical) failures. A just finished investigation showed that it is a relaxation crack problem, introduced by manufacturing processes, especially welding and cold rolling. Cracking/failures can be expected after only 0.1- 0.2 % relaxation strain. These low strain values can already be generated during relaxation of the welding stresses. Especially coarse grained `age hardening` materials are susceptible. Stabilising and Postweld Heat Treatments are very effective to avoid relaxation crack problems during operation. After these heat treatments the components can withstand more than 2 % relaxation strain. At temperatures between 500 and 750 deg C relaxation cracking is the predominant factor for the safety and lifetime of welded austenitic components. (orig.) 12 refs.

  11. Relaxation cracking in the process industry, an underestimated problem

    Energy Technology Data Exchange (ETDEWEB)

    Wortel, J.C. van [TNO Institute of Industrial Technology, Apeldoorn (Netherlands)

    1998-12-31

    Austenitic components, operating between 500 and 750 deg C, can fail within 1 year service while the ordinary mechanical properties after failure are still within the code requirements. The intergranular brittle failures are situated in the welded or cold deformed areas. This type of cracking has many names, showing the uncertainty concerning the mechanism for the (catastrophical) failures. A just finished investigation showed that it is a relaxation crack problem, introduced by manufacturing processes, especially welding and cold rolling. Cracking/failures can be expected after only 0.1- 0.2 % relaxation strain. These low strain values can already be generated during relaxation of the welding stresses. Especially coarse grained `age hardening` materials are susceptible. Stabilising and Postweld Heat Treatments are very effective to avoid relaxation crack problems during operation. After these heat treatments the components can withstand more than 2 % relaxation strain. At temperatures between 500 and 750 deg C relaxation cracking is the predominant factor for the safety and lifetime of welded austenitic components. (orig.) 12 refs.

  12. Usefulness of T1 mapping on Gd-EOB-DTPA-enhanced MR imaging in assessment of non-alcoholic fatty liver disease

    International Nuclear Information System (INIS)

    Ding, Ying; Rao, Sheng-Xiang; Meng, Tao; Chen, Caizhong; Li, Renchen; Zeng, Meng-Su

    2014-01-01

    This study evaluates the value of Gd-EOB-DTPA-enhanced MRI for diagnosis and staging of non-alcoholic fatty liver disease (NAFLD) in an animal model by T 1 relaxation time measurement. Thirty-four rabbits were divided into the control group (n = 10) and NAFLD group, which was split into four groups (n = 6) with a high-fat diet for an interval of 3 weeks. A dual flip angle was performed before and at the hepatobiliary phase (HBP). T 1 relaxation times of the liver parenchyma and the decrease rate (∇%) were calculated. Histological findings according to semi-quantitative scoring of steatosis, activity and fibrosis were the standard of reference. HBP and ∇% T 1 relaxation time measurement showed significant differences between normal and NAFLD groups, between non-alcoholic steatohepatitis (NASH) and NAFLD without NASH (p = 0.000-0.049), between fibrosis groups (p = 0.000-0.019), but no difference between F1 and F2 (p = 0.834). The areas under the receiver operating characteristic curves (AUCs) of T 1 relaxation time for HBP and ∇% were 0.86-0.93 for the selection of NASH and activity score ≥2, and 0.86-0.95 for the selection of F ≥ 1, 2, 3. No significant difference was found for diagnostic performance between HBP and ∇% T 1 relaxation time. HBP T 1 relaxation time measurement of Gd-EOB-DTPA-enhanced MRI was useful to evaluate NAFLD according to the SAF score. HBP T 1 relaxation time measurement was as accurate as ∇% T 1 relaxation time. (orig.)

  13. Human whole-blood (1)H2O longitudinal relaxation with normal and high-relaxivity contrast reagents: influence of trans-cell-membrane water exchange.

    Science.gov (United States)

    Wilson, Gregory J; Woods, Mark; Springer, Charles S; Bastawrous, Sarah; Bhargava, Puneet; Maki, Jeffrey H

    2014-12-01

    Accurate characterization of contrast reagent (CR) longitudinal relaxivity in whole blood is required to predict arterial signal intensity in contrast-enhanced MR angiography (CE-MRA). This study measured the longitudinal relaxation rate constants (R1 ) over a concentration range for non-protein-binding and protein-binding CRs in ex vivo whole blood and plasma at 1.5 and 3.0 Tesla (T) under physiologic arterial conditions. Relaxivities of gadoteridol, gadobutrol, gadobenate, and gadofosveset were measured for [CR] from 0 to 18 mM [mmol(CR)/L(blood)]: the latter being the upper limit of what may be expected in CE-MRA. In plasma, the (1) H2 O R1 [CR]-dependence was nonlinear for gadobenate and gadofosveset secondary to CR interactions with the serum macromolecule albumin, and was well described by an analytical expression for effective 1:1 binding stoichiometry. In whole blood, the (1) H2 O R1 [CR]-dependence was markedly non-linear for all CRs, and was well-predicted by an expression for equilibrium exchange of water molecules between plasma and intracellular spaces using a priori parameter values only. In whole blood, (1) H2 O R1 exhibits a nonlinear relationship with [CR] over 0 to 18 mM CR. The nonlinearity is well described by exchange of water between erythrocyte and plasma compartments, and is particularly evident for high relaxivity CRs. © 2013 Wiley Periodicals, Inc.

  14. Proton T2 relaxation effect of superparamagnetic iron oxide. Comparison between fast spin echo and conventional spin echo sequence

    International Nuclear Information System (INIS)

    Tanimoto, Akihiro; Satoh, Yoshinori; Higuchi, Nobuya; Izutsu, Mutsumu; Yuasa, Yuji; Hiramatsu, Kyoichi

    1995-01-01

    Superparamagnetic iron oxide (SPIO) particles have been known to show a great T 2 relaxation effect in the liver, which contributes to significant liver signal decrease and detection of hepatic neoplasms. Recently, fast spin echo (FSE) sequence with less scanning time than conventional spin echo (SE) sequence has been rapidly introduced in clinical MR imaging. To investigate whether SPIO would show decreased T 2 relaxation effect on FSE, we obtained T 2 relaxivity (R2) of SPIO in vitro and liver signal decrease caused by SPIO in vivo. SPIO showed 20% less R2 on Carr-Purcell-Meiboom-Gill (CPMG) sequence than on SE. Relative liver signal-to-noise ratio (SNR) decrease caused by SPIO was significantly smaller (p 2 relaxation effect on FSE than on SE. However, further studies will be required to assess the diagnostic capability of SPIO on FSE, in the detection of hepatic neoplasms. (author)

  15. Determination of the longitudinal relaxation time (T{sub 1}) of the carbon for the caura-16-E N-19-oic acid; Determinacao do tempo de relaxacao longitudinal (T{sub 1}) do carbono para derivados do acido-caura-16-en-19-oico

    Energy Technology Data Exchange (ETDEWEB)

    Pinheiro, J A; Rodrigues, A S [Ceara Univ., Fortaleza, CE (Brazil). Dept. de Quimica Organica e Inorganica

    1992-12-31

    In this work, we analyse, through the {sup 13} C longitudinal relaxation time (T{sub 1}), the solute-solute and solute-solvent interactions in some molecules of the c aura-16-en-19-oic acid such as: c aura-16-en-19-oic acid (I), c aura-15-acetoxy-16-en-19-oic acid (II), methyl esther of the c aura-16-en-19-oic acid (III) and c aura-16-en-19-ol (IV) 5 refs., 1 fig., 1 tab.

  16. Measurement of solute proton spin-lattice relaxation times in water using the 1,3,3,1 sequence

    International Nuclear Information System (INIS)

    Sankar, S.S.; Mole, P.A.; Coulson, R.L.

    1986-01-01

    1 H NMR spin-lattice relaxation times (T1) of the N-CH3 proton resonances of phosphocreatine (PCr) and creatine (Cr) in water solutions were obtained using the 1,3,3,1 pulse sequence. These T1 values were equivalent to those obtained in D 2 O and water using either the conventional inversion-recovery experiment or the 1,3,3,1 pulse sequence. Thus, the 1,3,3,1 sequence of proton NMR can provide an independent means along with phosphorous NMR for assess PCr and for the study of the creatine kinase reaction (PCr + ADP in equilibrium ATP + Cr) in aqueous solutions and perhaps in biological preparations

  17. [A study on Korean concepts of relaxation].

    Science.gov (United States)

    Park, J S

    1992-01-01

    Relaxation technique is an independent nursing intervention used in various stressful situations. The concept of relaxation must be explored for the meaning given by the people in their traditional thought and philosophy. Korean relaxation technique, wanting to become culturally acceptable and effective, is learning to recognize and develop Korean concepts, experiences, and musics of relaxation. This study was aimed at discovering Korean concepts, experiences and musics of relaxation and contributing the development of the relaxation technique for Korean people. The subjects were 59 nursing students, 39 hospitalized patients, 61 housewives, 21 rural residents and 16 researchers. Data were collected from September 4th to October 24th, 1991 by interviews or questionnaires. The data analysis was done by qualitative research method, and validity assured by conformation of the concept and category by 2 nursing scientists who had written a Master's thesis on the relaxation technique. The results of the study were summarized as follows; 1. The meaning of the relaxation concept; From 298 statements, 107 concepts were extracted and then 5 categories "Physical domain", "Psychological domain", "Complex domain", "Situation", and "environment" were organized. 'Don't have discomforts, 'don't have muscle tension', 'don't have energy (him in Korean)', 'don't have activities' subcategories were included in "Physical domain". 'Don't have anxiety', 'feel good', 'emotional stability', 'don't have wordly thoughts', 'feel one's brain muddled', 'loss of desire' subcategories were included in "physical domain" 'Comfort body and mind', 'don't have tension of body and mind', 'be sagged' 'liveliness of thoughts' subcategories were included in "Complex domain". 'Rest', 'sleep', 'others' subcategories were included in "Situation domain". And 'quite environment' & 'comfortable environment' subcategories were included in "Environmental domain". 2. The experiences of the relaxation; From 151

  18. Usefulness of T1 mapping on Gd-EOB-DTPA-enhanced MR imaging in assessment of non-alcoholic fatty liver disease

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Ying; Rao, Sheng-Xiang; Meng, Tao; Chen, Caizhong; Li, Renchen; Zeng, Meng-Su [Zhongshan/Hospital of Fudan University, Department of Radiology, Shanghai (China)

    2014-04-15

    This study evaluates the value of Gd-EOB-DTPA-enhanced MRI for diagnosis and staging of non-alcoholic fatty liver disease (NAFLD) in an animal model by T{sub 1} relaxation time measurement. Thirty-four rabbits were divided into the control group (n = 10) and NAFLD group, which was split into four groups (n = 6) with a high-fat diet for an interval of 3 weeks. A dual flip angle was performed before and at the hepatobiliary phase (HBP). T{sub 1} relaxation times of the liver parenchyma and the decrease rate (∇%) were calculated. Histological findings according to semi-quantitative scoring of steatosis, activity and fibrosis were the standard of reference. HBP and ∇% T{sub 1} relaxation time measurement showed significant differences between normal and NAFLD groups, between non-alcoholic steatohepatitis (NASH) and NAFLD without NASH (p = 0.000-0.049), between fibrosis groups (p = 0.000-0.019), but no difference between F1 and F2 (p = 0.834). The areas under the receiver operating characteristic curves (AUCs) of T{sub 1} relaxation time for HBP and ∇% were 0.86-0.93 for the selection of NASH and activity score ≥2, and 0.86-0.95 for the selection of F ≥ 1, 2, 3. No significant difference was found for diagnostic performance between HBP and ∇% T{sub 1} relaxation time. HBP T{sub 1} relaxation time measurement of Gd-EOB-DTPA-enhanced MRI was useful to evaluate NAFLD according to the SAF score. HBP T{sub 1} relaxation time measurement was as accurate as ∇% T{sub 1} relaxation time. (orig.)

  19. Over-relaxation phenomena during the set-up of RFP plasmas

    International Nuclear Information System (INIS)

    Nordlund, P.; Mazur, S.

    1995-03-01

    Experiments on the Extrap T1 reversed field pinch have shown that the formation of the RFP configuration is quite sensitive to the relative programming of the toroidal field and ohmic heating circuits. In this paper, new measurements of the evolution of the current density profile and of the spectral structure of the fluctuations during the set-up phase of RFP plasmas in the T1 experiment are presented. These measurements improve the understanding of the role of different spectral components in the dynamics of RFP formation. Under unfavourable (slow) set-up conditions, comparatively high energy is accumulated in m = 1 internal kinks prior to reversal of the edge toroidal fields. At reversal, nonlinearly driven m = 0 modes trigger a rapid broadening of the m = 1 spectrum. This behaviour is associated with a violent suppression of the current density in the core leading to an over-relaxation of the discharge involving a hollowing of the parallel current density profile. The over-relaxation phenomenon increases the volt-second consumption and plasma/wall interaction during RFP set-up, and degrades the flat-top discharge performance. 15 refs, 5 figs, 1 tab

  20. Over-relaxation phenomena during the set-up of RFP plasmas

    Energy Technology Data Exchange (ETDEWEB)

    Nordlund, P.; Mazur, S.

    1995-03-01

    Experiments on the Extrap T1 reversed field pinch have shown that the formation of the RFP configuration is quite sensitive to the relative programming of the toroidal field and ohmic heating circuits. In this paper, new measurements of the evolution of the current density profile and of the spectral structure of the fluctuations during the set-up phase of RFP plasmas in the T1 experiment are presented. These measurements improve the understanding of the role of different spectral components in the dynamics of RFP formation. Under unfavourable (slow) set-up conditions, comparatively high energy is accumulated in m = 1 internal kinks prior to reversal of the edge toroidal fields. At reversal, nonlinearly driven m = 0 modes trigger a rapid broadening of the m = 1 spectrum. This behaviour is associated with a violent suppression of the current density in the core leading to an over-relaxation of the discharge involving a hollowing of the parallel current density profile. The over-relaxation phenomenon increases the volt-second consumption and plasma/wall interaction during RFP set-up, and degrades the flat-top discharge performance. 15 refs, 5 figs, 1 tab.

  1. Non-polymeric asymmetric binary glass-formers. II. Secondary relaxation studied by dielectric, 2H NMR, and 31P NMR spectroscopy

    Science.gov (United States)

    Pötzschner, B.; Mohamed, F.; Bächer, C.; Wagner, E.; Lichtinger, A.; Bock, D.; Kreger, K.; Schmidt, H.-W.; Rössler, E. A.

    2017-04-01

    We investigate the secondary (β-) relaxations of an asymmetric binary glass former consisting of a spirobichroman derivative (SBC; Tg = 356 K) as the high-Tg component and the low-Tg component tripropyl phosphate (TPP; Tg = 134 K). The main relaxations are studied in Paper I [B. Pötzschner et al., J. Chem. Phys. 146, 164503 (2017)]. A high Tg contrast of ΔTg = 222 K is put into effect in a non-polymeric system. Component-selective studies are carried out by combining results from dielectric spectroscopy (DS) for mass concentrations cTPP ≥ 60% and those from different methods of 2H and 31P NMR spectroscopy. In the case of NMR, the full concentration range (10% ≤ cTPP ≤ 100%) is covered. The neat components exhibit a β-relaxation1 (SBC) and β2 (TPP)). The latter is rediscovered by DS in the mixtures for all concentrations with unchanged time constants. NMR spectroscopy identifies the β-relaxations as being alike to those in neat glasses. A spatially highly restricted motion with angular displacement below ±10° encompassing all molecules is involved. In the low temperature range, where TPP shows the typical 31P NMR echo spectra of the β2-process, very similar spectral features are observed for the (deuterated) SBC component by 2H NMR, in addition to its "own" β1-process observed at high temperatures. Apparently, the small TPP molecules enslave the large SBC molecules to perform a common hindered reorientation. The temperature dependence of the spin-lattice relaxation time of both components is the same and reveals an angular displacement of the SBC molecules somewhat smaller than that of TPP, though the time constants τβ2 are the same. Furthermore, T1(T) of TPP in the temperature region of the β2-process is absolutely the same as in the mixture TPP/polystyrene investigated previously. It appears that the manifestations of the β-process introduced by one component are essentially independent of the second component. Finally, at cTPP ≤ 20% one

  2. Volumetric B1 (+) mapping of the brain at 7T using DREAM.

    Science.gov (United States)

    Nehrke, Kay; Versluis, Maarten J; Webb, Andrew; Börnert, Peter

    2014-01-01

    To tailor and optimize the Dual Refocusing Echo Acquisition Mode (DREAM) approach for volumetric B1 (+) mapping of the brain at 7T. A new DREAM echo timing scheme based on the virtual stimulated echo was derived to minimize potential effects of transverse relaxation. Furthermore, the DREAM B1 (+) mapping performance was investigated in simulations and experimentally in phantoms and volunteers for volumetric applications, studying and optimizing the accuracy of the sequence with respect to saturation effects, slice profile imperfections, and T1 and T2 relaxation. Volumetric brain protocols were compiled for different isotropic resolutions (5-2.5 mm) and SENSE factors, and were studied in vivo for different RF drive modes (circular/linear polarization) and the application of dielectric pads. Volumetric B1 (+) maps with good SNR at 2.5 mm isotropic resolution were acquired in about 20 s or less. The specific absorption rate was well below the safety limits for all scans. Mild flow artefacts were observed in the large vessels. Moreover, a slight contrast in the ventricle was observed in the B1 (+) maps, which could be attributed to T1 and T2 relaxation effects. DREAM enables safe, very fast, and robust volumetric B1 (+) mapping of the brain at ultrahigh fields. Copyright © 2013 Wiley Periodicals, Inc.

  3. Spin dynamics of the itinerant helimagnet MnSi studied by positive muon spin relaxation

    International Nuclear Information System (INIS)

    Kadono, R.; Matsuzaki, T.; Yamazaki, T.; Kreitzman, S.R.; Brewer, J.H.

    1990-03-01

    The local magnetic fields and spin dynamics of the itinerant helimagnet MnSi(T c ≅ 29.5 K) have been studied experimentally using positive muon spin rotation/relaxation (μ + SR) methods. In the ordered phase (T c ), zero-field μSR was used to measure the hyperfine fields at the muon sites as well as the muon spin-lattice relaxation time T 1 μ . Two magnetically inequivalent interstitial μ + sites were found with hyperfine coupling constants A hf (1) = -3.94 kOe/μ B and A hf (2) = -6.94 kOe/μ B , respectively. In the paramagnetic phase (T > T c ), the muon-nuclear spin double relaxation technique was used to simultaneously but independently determine the spin-lattice relaxation time T 1 Mn of 55 Mn spins and that of positive muons (T 1 μ ) over a wide temperature range (T c 1 Mn and T 1 μ in both phases shows systematic deviations from the predictions of self-consistent renormalization (SCR) theory. (author)

  4. Appearance of normal brain maturation on 1.5-T MR images

    International Nuclear Information System (INIS)

    Barkovich, A.J.; Kjos, B.; Jackson, D.E. Jr.; Norman, D.

    1987-01-01

    To investigate the pattern of normal white-matter maturation as demonstrated by high-field-strength MR imaging, 82 normal infants were examined using a 1.5-T unit with spin-echo T1-weighted and T2-weighted pulse sequences. The infants ranged in age from 4 days to 2 years. The scans were assessed for qualitative changes of white matter relative to gray matter and correlated with the patient's age in 14 anatomic areas of the brain. The MR images showed that changes of brain maturation occur in an orderly manner, commencing in the brain stem and progressing to the cerebellum and the cerebrum. Changes from brain myelination were seen earlier on T1-weighted images than on T2-weighted images, possibly because of T1 shortening by the components of the developing myelin sheaths. The later changes on the T2-weighted images correlated best with the development of myelination, as demonstrated by histochemical methods. T1-weighted images were most useful to monitor normal brain development in the first 6 to 8 months of life; T2-weighted images were more useful after 6 months. The milestones in the MR appearance of normal maturation of the brain are presented. The milestones in the MR appearance of normal maturation of the brain are presented. Persistent areas of long T2 relaxation times are seen superior and dorsal to the ventricular trigone in all infants examined and should not be mistaken for ischemic change

  5. Temperature dependence of the NMR spin-lattice relaxation rate for spin-1/2 chains

    Science.gov (United States)

    Coira, E.; Barmettler, P.; Giamarchi, T.; Kollath, C.

    2016-10-01

    We use recent developments in the framework of a time-dependent matrix product state method to compute the nuclear magnetic resonance relaxation rate 1 /T1 for spin-1/2 chains under magnetic field and for different Hamiltonians (XXX, XXZ, isotropically dimerized). We compute numerically the temperature dependence of the 1 /T1 . We consider both gapped and gapless phases, and also the proximity of quantum critical points. At temperatures much lower than the typical exchange energy scale, our results are in excellent agreement with analytical results, such as the ones derived from the Tomonaga-Luttinger liquid (TLL) theory and bosonization, which are valid in this regime. We also cover the regime for which the temperature T is comparable to the exchange coupling. In this case analytical theories are not appropriate, but this regime is relevant for various new compounds with exchange couplings in the range of tens of Kelvin. For the gapped phases, either the fully polarized phase for spin chains or the low-magnetic-field phase for the dimerized systems, we find an exponential decrease in Δ /(kBT ) of the relaxation time and can compute the gap Δ . Close to the quantum critical point our results are in good agreement with the scaling behavior based on the existence of free excitations.

  6. Tunneling splitting of magnetic levels in Fe8 detected by 1H NMR cross relaxation

    Science.gov (United States)

    Furukawa, Y.; Aizawa, K.; Kumagai, K.; Ullu, R.; Lascialfari, A.; Borsa, F.

    2003-05-01

    Measurements of proton NMR and the spin lattice relaxation rate 1/T1 in the octanuclear iron (III) cluster [Fe8(N3C6H15)6O2(OH)12]ṡ[Br8ṡ9H2O], in short Fe8, have been performed at 1.5 K in a powder sample aligned along the main anisotropy z axis, as a function of a transverse magnetic field (i.e., perpendicular to the main easy axis z). A big enhancement of 1/T1 is observed over a wide range of fields (2.5-5 T), which can be attributed to the tunneling dynamics; in fact, when the tunneling splitting of the pairwise degenerate m=±10 states of the Fe8 molecule becomes equal to the proton Larmor frequency a very effective spin lattice relaxation channel for the nuclei is opened. The experimental results are explained satisfactorily by considering the distribution of tunneling splitting resulting from the distribution of the angles in the hard xy plane for the aligned powder, and the results of the direct diagonalization of the model Hamiltonian.

  7. Measurements of spin-lattice relaxation time in mixed alkali halide crystals

    International Nuclear Information System (INIS)

    Tannus, A.

    1983-01-01

    Using magneto-optic techniques the ground state spin-lattice relaxation times (T1) of 'F' centers in mixed Alkali Halide cristals (KCl-KBr), was studied. A computer assisted system to optically measure short relaxation times (approx. = 1mS), was described. The technique is based on the measurement of the Magnetic Circular Dicroism (MCD) presented by F centers. The T1 magnetic field dependency at 2 K (up to 65 KGauss), was obtained as well as the MCD spectra for different relative concentration at the mixed matrices. The theory developed by Panepucci and Mollenauer for F centers spin-lattice relaxation in pure matrices was modified to explain the behaviour of T1 in mixed cristals. The Direct Process results (T approx. = 2.0 K) compared against that theory shows that the main relaxation mecanism, up to 25 KGauss, continues to be phonon modulation of the hiperfine iteraction between F electrons and surrounding nuclei. (Author) [pt

  8. Detailing magnetic field strength dependence and segmental artifact distribution of myocardial effective transverse relaxation rate at 1.5, 3.0, and 7.0 T.

    Science.gov (United States)

    Meloni, Antonella; Hezel, Fabian; Positano, Vincenzo; Keilberg, Petra; Pepe, Alessia; Lombardi, Massimo; Niendorf, Thoralf

    2014-06-01

    Realizing the challenges and opportunities of effective transverse relaxation rate (R2 *) mapping at high and ultrahigh fields, this work examines magnetic field strength (B0 ) dependence and segmental artifact distribution of myocardial R2 * at 1.5, 3.0, and 7.0 T. Healthy subjects were considered. Three short-axis views of the left ventricle were examined. R2 * was calculated for 16 standard myocardial segments. Global and mid-septum R2 * were determined. For each segment, an artifactual factor was estimated as the deviation of segmental from global R2 * value. The global artifactual factor was significantly enlarged at 7.0 T versus 1.5 T (P = 0.010) but not versus 3.0 T. At 7.0 T, the most severe susceptibility artifacts were detected in the inferior lateral wall. The mid-septum showed minor artifactual factors at 7.0 T, similar to those at 1.5 and 3.0 T. Mean R2 * increased linearly with the field strength, with larger changes for global heart R2 * values. At 7.0 T, segmental heart R2 * analysis is challenging due to macroscopic susceptibility artifacts induced by the heart-lung interface and the posterior vein. Myocardial R2 * depends linearly on the magnetic field strength. The increased R2 * sensitivity at 7.0 T might offer means for susceptibility-weighted and oxygenation level-dependent MR imaging of the myocardium. Copyright © 2013 Wiley Periodicals, Inc.

  9. Comparative study of the sensitivity of ADC value and T2 relaxation time for early detection of Wallerian degeneration

    International Nuclear Information System (INIS)

    Zhang Fan; Lu Guangming; Zee Chishing

    2011-01-01

    Background and purpose: Wallerian degeneration (WD), the secondary degeneration of axons from cortical and subcortical injuries, is associated with poor neurological outcome. There is some quantitative MR imaging techniques used to estimate the biologic changes secondary to delayed neuronal and axonal losses. Our purpose is to assess the sensitivity of ADC value and T 2 relaxation time for early detection of WD. Methods: Ten male Sprague-Dawley rats were used to establish in vivo Wallerian degeneration model of CNS by ipsilateral motor-sensory cortex ablation. 5 days after cortex ablation, multiecho-T 2 relaxometry and multi-b value DWI were acquired by using a 7 T MR imaging scanner. ADC-map and T 2 -map were reconstructed by post-processing. ROIs are selected according to pathway of corticospinal tract from cortex, internal capsule, cerebral peduncle, pons, medulla oblongata to upper cervical spinal cord to measure ADC value and T 2 relaxation time of healthy side and affected side. The results were compared between the side with cortical ablation and the side without ablation. Results: Excluding ablated cortex, ADC values of the corticospinal tract were significantly increased (P 2 relaxation time was observed between the affected and healthy sides. Imaging findings were correlated with histological examinations. Conclusion: As shown in this animal experiment, ADC values could non-invasively demonstrate the secondary degeneration involving descending white matter tracts. ADC values are more sensitive indicators for detection of early WD than T 2 relaxation time.

  10. The relaxation phenomena of radicals induced in irradiated fresh mangoes

    International Nuclear Information System (INIS)

    Kikuchi, Masahiro; Morishita, Norio; Kobayashi, Yasuhiko; Ogawa, Hideyuki; Shimoyama, Yuhei; Ukai, Mitsuko

    2009-01-01

    Using the γ-irradiated fresh mangoes followed by freeze-drying and powderization, electron spin resonance spectrometry of specimens was performed. As a result, a strong single peak in the flesh, the pericarp and the seed was observed at g=2.004 and attributed to organic free radicals. When relaxation times of the peak was calculated using the method of Lund et al., T 2 showed dose responses according to increasing doses while T 1 was almost constant. Dose responsibility of the relaxation time T 2 obtained from flesh specimens of the mangoes could be measured regardless of the preservation period of 1 to 9 days following γ-irradiation. Therefore, there might be possible to detect the irradiation treatment of fresh mangoes using relaxation time T 2 . (author)

  11. Quantifying NMR relaxation correlation and exchange in articular cartilage with time domain analysis

    Science.gov (United States)

    Mailhiot, Sarah E.; Zong, Fangrong; Maneval, James E.; June, Ronald K.; Galvosas, Petrik; Seymour, Joseph D.

    2018-02-01

    Measured nuclear magnetic resonance (NMR) transverse relaxation data in articular cartilage has been shown to be multi-exponential and correlated to the health of the tissue. The observed relaxation rates are dependent on experimental parameters such as solvent, data acquisition methods, data analysis methods, and alignment to the magnetic field. In this study, we show that diffusive exchange occurs in porcine articular cartilage and impacts the observed relaxation rates in T1-T2 correlation experiments. By using time domain analysis of T2-T2 exchange spectroscopy, the diffusive exchange time can be quantified by measurements that use a single mixing time. Measured characteristic times for exchange are commensurate with T1 in this material and so impacts the observed T1 behavior. The approach used here allows for reliable quantification of NMR relaxation behavior in cartilage in the presence of diffusive fluid exchange between two environments.

  12. Nuclear spin-lattice relaxation in nitroxide spin-label EPR.

    Science.gov (United States)

    Marsh, Derek

    2016-11-01

    Nuclear relaxation is a sensitive monitor of rotational dynamics in spin-label EPR. It also contributes competing saturation transfer pathways in T 1 -exchange spectroscopy, and the determination of paramagnetic relaxation enhancement in site-directed spin labelling. A survey shows that the definition of nitrogen nuclear relaxation rate W n commonly used in the CW-EPR literature for 14 N-nitroxyl spin labels is inconsistent with that currently adopted in time-resolved EPR measurements of saturation recovery. Redefinition of the normalised 14 N spin-lattice relaxation rate, b=W n /(2W e ), preserves the expressions used for CW-EPR, whilst rendering them consistent with expressions for saturation recovery rates in pulsed EPR. Furthermore, values routinely quoted for nuclear relaxation times that are deduced from EPR spectral diffusion rates in 14 N-nitroxyl spin labels do not accord with conventional analysis of spin-lattice relaxation in this three-level system. Expressions for CW-saturation EPR with the revised definitions are summarised. Data on nitrogen nuclear spin-lattice relaxation times are compiled according to the three-level scheme for 14 N-relaxation: T 1 n =1/W n . Results are compared and contrasted with those for the two-level 15 N-nitroxide system. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Tunneling splitting of magnetic levels in Fe8 detected by 1H NMR cross relaxation

    OpenAIRE

    Furukawa, Y.; Aizawa, K.; Kumagai, K.; Ullu, R.; Lascialfari, A.; Borsa, F.

    2003-01-01

    Measurements of proton NMR and the spin lattice relaxation rate 1/T1 in the octanuclear iron (III) cluster [Fe8(N3C6H15)6O2(OH)12][Br8 9H2O], in short Fe8, have been performed at 1.5 K in a powder sample aligned along the main anisotropy z axis, as a function of a transverse magnetic field (i.e., perpendicular to the main easy axis z). A big enhancement of 1/T1 is observed over a wide range of fields (2.5-5 T), which can be attributed to the tunneling dynamics; in fact, when the tunneling spl...

  14. The age dependence of T2 relaxation times of N-acetyl aspartate, creatine and choline in the human brain at 3 and 4T

    Czech Academy of Sciences Publication Activity Database

    Jirů, F.; Škoch, A.; Wágnerová, D.; Dezortová, M.; Visková, J.; Profant, Oliver; Syka, Josef; Hájek, M.

    2016-01-01

    Roč. 29, č. 3 (2016), s. 284-292 ISSN 0952-3480 Institutional support: RVO:68378041 Keywords : MRS * T2 relaxation times of metabolites * age dependence of T2 Subject RIV: FH - Neurology Impact factor: 2.872, year: 2016

  15. 13C NMR relaxation times of hepatic glycogen in vitro and in vivo

    International Nuclear Information System (INIS)

    Zang, Lihsin; Laughlin, M.R.; Rothman, D.L.; Shulman, R.G.

    1990-01-01

    The field dependence of relaxation times of the C-1 carbon of glycogen was studied in vitro by natural-abundance 13 C NMR. T 1 is strongly field dependent, while T 2 does not change significantly with magnetic field. T 1 and T 2 were also measured for rat hepatic glycogen enriched with [1- 13 C]glucose in vivo at 4.7 T, and similar relaxation times were observed as those obtained in vitro at the same field. The in vitro values of T 1 were 65 ± 5 ms at 2.1 T, 142 ± 10 ms at 4.7 T, and 300 ± 10 ms at 8.4 T, while T 2 values were 6.7 ± 1 ms at 2.1 T, 9.4 ± 1 ms at 4.7 T, and 9.5 ± 1 ms at 8.4 T. Calculations based on the rigid-rotor nearest-neighbor model give qualitatively good agreement with the T 1 field dependence with a best-fit correlation time of 6.4 x 10 -9 s, which is significantly smaller than τ M , the estimated overall correlation time for the glycogen molecule (ca. 10 -5 s). A more accurate fit of T 1 data using a modified Lipari and Szabo approach indicates that internal fast motions dominate the T 1 relaxation in glycogen. On the other hand, the T 2 relaxation is dominated by the overall correlation time τ M while the internal motions are almost but not completely unrestricted

  16. Measurement of the Exchange Rate of Waters of Hydration in Elastin by 2D T(2)-T(2) Correlation Nuclear Magnetic Resonance Spectroscopy.

    Science.gov (United States)

    Sun, Cheng; Boutis, Gregory S

    2011-02-28

    We report on the direct measurement of the exchange rate of waters of hydration in elastin by T(2)-T(2) exchange spectroscopy. The exchange rates in bovine nuchal ligament elastin and aortic elastin at temperatures near, below and at the physiological temperature are reported. Using an Inverse Laplace Transform (ILT) algorithm, we are able to identify four components in the relaxation times. While three of the components are in good agreement with previous measurements that used multi-exponential fitting, the ILT algorithm distinguishes a fourth component having relaxation times close to that of free water and is identified as water between fibers. With the aid of scanning electron microscopy, a model is proposed allowing for the application of a two-site exchange analysis between any two components for the determination of exchange rates between reservoirs. The results of the measurements support a model (described elsewhere [1]) wherein the net entropy of bulk waters of hydration should increase upon increasing temperature in the inverse temperature transition.

  17. Influence of age, BMI, gender and lumbar level on T1ρ magnetic resonance imaging of lumbar discs in healthy asymptomatic adults

    Energy Technology Data Exchange (ETDEWEB)

    Guebitz, Raphael [Asklepios Hospital Altona, Hamburg (Germany). Dept. of Radiology and Neuroradiology; Lange, Tobias; Gosheger, Georg [University Hospital Muenster (Germany). Dept. of Orthopaedics and Tumor Orthopaedics; Heindel, Walter; Allkemper, Thomas [University Hospital Muenster (Germany). Dept. of Clinical Radiology; Stehling, Christoph [Sankt-Barbara Hospital Ham-Heessen, Hamm (Germany). Clinic for Radiology and Neuroradiology; Gerss, Joachim [Muenster Univ. (Germany). Inst. of Biostatistics and Clinical Research; Kanthak, Christian [Fraunhofer MEVIS, Bremen (Germany). Inst. for Medical Image Computing; Schulte, Tobias L. [Bochum Univ. St. Josef Hospital (Germany). Dept. of Orthopaedics and Trauma Surgery

    2018-02-15

    To assess the T1ρ range of lumbar intervertebral discs in healthy asymptomatic individuals at 1.5 T and to investigate the influence of age, body mass index (BMI), gender, and lumbar level on T1ρ relaxation. In a prospective study, a total of 81 volunteers aged 20 - 80 years were included in this study and divided into three age groups (A: 20 - 39y; B: 40 - 59y; C: 60 - 80y). All of the volunteers underwent magnetic resonance imaging (MRI) at 1.5 T with acquisition of sagittal T1ρ images. The calculated T1ρ relaxation times were correlated with age, BMI, gender, and lumbar level relative to the total disc, the annulus fibrosus, and the nucleus pulposus. Age had a significant influence on T1ρ relaxation times at all lumbar levels, with increasing age being associated with reduced relaxation times. There was also a significant difference between age groups A vs. C and B vs. C (P = 0.0008 and P = 0.0149, respectively). No significant differences in T1ρ relaxation time were observed between men and women (P > 0.05). BMI showed a significant negative correlation with T1ρ relaxation times (P < 0.0001). Analysis of the lumbar level revealed a significant decrease in relaxation times from L1/2 to L5 / S1 (P = 0.0013). Increasing age correlated significantly with advanced lumbar disc degeneration in asymptomatic individuals, particularly in those aged 60 or older. Increasing BMI correlated significantly with increasing degeneration. The lower discs showed more degeneration than the upper ones.

  18. Influence of age, BMI, gender and lumbar level on T1ρ magnetic resonance imaging of lumbar discs in healthy asymptomatic adults

    International Nuclear Information System (INIS)

    Guebitz, Raphael; Lange, Tobias; Gosheger, Georg; Heindel, Walter; Allkemper, Thomas; Stehling, Christoph; Gerss, Joachim; Kanthak, Christian; Schulte, Tobias L.

    2018-01-01

    To assess the T1ρ range of lumbar intervertebral discs in healthy asymptomatic individuals at 1.5 T and to investigate the influence of age, body mass index (BMI), gender, and lumbar level on T1ρ relaxation. In a prospective study, a total of 81 volunteers aged 20 - 80 years were included in this study and divided into three age groups (A: 20 - 39y; B: 40 - 59y; C: 60 - 80y). All of the volunteers underwent magnetic resonance imaging (MRI) at 1.5 T with acquisition of sagittal T1ρ images. The calculated T1ρ relaxation times were correlated with age, BMI, gender, and lumbar level relative to the total disc, the annulus fibrosus, and the nucleus pulposus. Age had a significant influence on T1ρ relaxation times at all lumbar levels, with increasing age being associated with reduced relaxation times. There was also a significant difference between age groups A vs. C and B vs. C (P = 0.0008 and P = 0.0149, respectively). No significant differences in T1ρ relaxation time were observed between men and women (P > 0.05). BMI showed a significant negative correlation with T1ρ relaxation times (P < 0.0001). Analysis of the lumbar level revealed a significant decrease in relaxation times from L1/2 to L5 / S1 (P = 0.0013). Increasing age correlated significantly with advanced lumbar disc degeneration in asymptomatic individuals, particularly in those aged 60 or older. Increasing BMI correlated significantly with increasing degeneration. The lower discs showed more degeneration than the upper ones.

  19. Relaxation rates of low-field gas-phase ^129Xe storage cells

    Science.gov (United States)

    Limes, Mark; Saam, Brian

    2010-10-01

    A study of longitudinal nuclear relaxation rates T1 of ^129Xe and Xe-N2 mixtures in a magnetic field of 3.8 mT is presented. In this regime, intrinsic spin relaxation is dominated by the intramolecular spin-rotation interaction due to persistent xenon dimers, a mechanism that can be quelled by introducing large amounts of N2 into the storage cell. Extrinsic spin relaxation is dominated by the wall-relaxation rate, which is the primary quantity of interest for the various low-field storage cells and coatings that we have tested. Previous group work has shown that extremely long gas-phase relaxation times T1 can be obtained, but only at large magnetic fields and low xenon densities. The current work is motivated by the practical benefits of retaining hyperpolarized ^129Xe for extended periods of time in a small magnetic field.

  20. The effects of bone on proton NMR relaxation times of surrounding liquids

    Science.gov (United States)

    Davis, C. A.; Genant, H. K.; Dunham, J. S.

    1986-01-01

    Preliminary attempts by our group at UCSF to assess fat content of vertebral marrow in the lumbar spine using relaxation time information demonstrated that the presence of trabecular bone affects relaxation times. The objective of this work was a thorough study of the effects of bone on NMR relaxation characteristics of surrounding liquids. Trabecular bone from autopsy specimens was ground up and sifted into a series of powders with graded densities ranging from 0.3 gm/cc to 0.8 gm/cc. Each powder was placed first in n-saline and then in cottonseed oil. With spectroscopy, spin-lattice relaxation times (T1) and effective spin-spin relaxation times (T2*) were measured for each liquid in each bone powder. As bone density and surface to volume ratio increased, T1 decreased faster for saline than for oil. T2* decreased significantly for both water and oil as the surface to volume ratio increased. It was concluded that effects of water on T1 could be explained by a surface interaction at the bone/liquid interface, which restricted rotational and translational motion of nearby molecules. The T1s of oil were not affected since oil molecules are nonpolar, do not participate in significant intermolecular hydrogen bonding, and therefore would not be expected to interact strongly with the bone surface. Effects on T2* could be explained by local magnetic field inhomogeneities created by discontinuous magnetic susceptibility near the bone surface. These preliminary results suggest that water in contact with trabecular bone in vivo will exhibit shortened relaxation times.

  1. Spin Diffusion and Spin Lattice Relaxation of Dipolar Order in Solids Containing Paramagnetic Impurities

    International Nuclear Information System (INIS)

    Furman, G.B.; Panich, A.M.; Goren, S.D.

    1998-01-01

    The phenomena of spin diffusion and spin lattice relaxation of nuclear dipolar order in solids containing paramagnetic impurities (PI) is considered. We show that at the beginning of the relaxation process the diffusion vanishing regime realizes with non-exponential time dependence, R(t) ∼ exp [- (t/T 1d ) α ], where T 1d ∼ C p -1/α , C p is PI's concentration. For a homogeneous distribution of Pis and nuclear spins, α=Q/6, where Q is the sample dimensionality; for an inhomogeneous distribution, the sample is divided into q-dimensional subsystems, each containing one PI, yield- ing α= (Q + q) /6. This result coincides with experimental data for CaF 2 doped with 0.8 - 10 -3 ωt % of Mn 2+ , where the non-exponential decay of the dipolar signal with α= 0.83 has been observed [3]. Fitting the experimental data yields a good agreement with T 1d = 66 ms . For another independent check of the obtained results we use dependence of the relaxation time on impurities concentration. In accordance that 1/α=1.2 , we have T 1d ∼ C p -1 '. 2 . Exactly this dependence on impurity concentration of the relaxation time has been found in the experiment. Then the relaxation regime starts as a non-exponential time dependent, proceed asymptotically to an to an exponential function of time, to so called diffusion limited relaxation regime with relaxation time T 1d D is inversely depends on impurities concentration. This kind of relaxation behavior of the dipolar order takes place in the experiment [2]. Using experimental results [2] from this two regime we can estimate the diffusion coefficient of the nuclear dipolar order in CaF 2 , which gives for typical values of impurity concentration C p ∼ 10 18 cm 3 the diffusion coefficient of dipolar order in the interval D ∼ 10 -11 -i- 10 -12 cm 2 /sec which is coincide to the case of Zeeman energy spin diffusion

  2. Hydrogen-1 NMR relaxation time studies in membrane: anesthetic systems

    International Nuclear Information System (INIS)

    Pinto, L.M.A.; Fraceto, L.; Paula, E. de; Franzoni, L.; Spisni, A.

    1997-01-01

    The study of local anesthetics'(LA) interaction with model phospholipid membranes is justified by the direct correlation between anesthetic's hydrophobicity and its potency/toxicity. By the same reason, uncharged LA species seems to play a crucial role in anesthesia. Most clinically used LA are small amphiphilics with a protonated amine group (pKa around 8). Although both charged (protonated) and uncharged forms can coexist at physiological pH, it has been shown (Lee, Biochim. Biophys. Acta 514:95, 1978; Screier et al. Biochim. Biophys. Acta 769:231, 1984) that the real anesthetic pka can be down-shifted, due to differential partition into membranes, increasing the ratio of uncharged species at pH 7.4. We have measured 1 H-NMR longitudinal relaxation times (T 1 ) for phospholipid and three local anesthetics (tetracaine, lidocaine, benzocaine), in sonicated vesicles at a 3:1 molar ratio. All the LA protons have shown smaller T 1 in this system than in isotropic phases, reflecting LA immobilization caused by insertion in the membrane. T 1 values for the lipid protons in the presence of LA were analyzed, in an attempt to identify specific LA:lipid contact regions. (author)

  3. T-stresses for internally cracked components

    International Nuclear Information System (INIS)

    Fett, T.

    1997-12-01

    The failure of cracked components is governed by the stresses in the vicinity of the crack tip. The singular stress contribution is characterised by the stress intensity factor K, the first regular stress term is represented by the so-called T-stress. T-stress solutions for components containing an internal crack were computed by application of the Bundary Collocation Method (BCM). The results are compiled in form of tables or approximative relations. In addition a Green's function of T-stresses is proposed for internal cracks which enables to compute T-stress terms for any given stress distribution in the uncracked body. (orig.) [de

  4. Single-shot T1 mapping of the corpus callosum: A rapid characterization of fiber bundle anatomy

    Directory of Open Access Journals (Sweden)

    Sabine eHofer

    2015-05-01

    Full Text Available Using diffusion-tensor MRI and fiber tractography the topographic organization of the corpus callosum (CC has been described to comprise 5 segments with fibers projecting into prefrontal (I, premotor and supplementary motor (II, primary motor (III, and primary sensory areas (IV, as well as into parietal, temporal, and occipital cortical areas (V. In order to more rapidly characterize the underlying anatomy of these segments, this study used a novel single-shot T1 mapping method to quantitatively determine T1 relaxation times in the human CC. A region-of-interest analysis revealed a tendency for the lowest T1 relaxation times in the genu and the highest T1 relaxation times in the somatomotor region of the CC. This observation separates regions dominated by myelinated fibers with large diameters (somatomotor area from densely packed smaller axonal bundles (genu with less myelin. The results indicate that characteristic T1 relaxation times in callosal profiles provide an additional means to monitor differences in fiber anatomy, fiber density, and gray matter in respective neocortical areas. In conclusion, rapid T1 mapping allows for a characterization of the axonal architecture in an individual CC in less than 10 s. The approach emerges as a valuable means for studying neocortical brain anatomy with possible implications for the diagnosis of neurodegenerative processes.

  5. Nuclear spin-lattice relaxation in nitroxide spin-label EPR

    DEFF Research Database (Denmark)

    Marsh, Derek

    2016-01-01

    that the definition of nitrogen nuclear relaxation rate Wn commonly used in the CW-EPR literature for 14N-nitroxyl spin labels is inconsistent with that currently adopted in time-resolved EPR measurements of saturation recovery. Redefinition of the normalised 14N spin-lattice relaxation rate, b = Wn/(2We), preserves...... of spin-lattice relaxation in this three-level system. Expressions for CW-saturation EPR with the revised definitions are summarised. Data on nitrogen nuclear spin-lattice relaxation times are compiled according to the three-level scheme for 14N-relaxation: T1 n = 1/Wn. Results are compared and contrasted...

  6. Measuring hepatic functional reserve using T1 mapping of Gd-EOB-DTPA enhanced 3T MR imaging: A preliminary study comparing with 99mTc GSA scintigraphy and signal intensity based parameters.

    Science.gov (United States)

    Nakagawa, Masataka; Namimoto, Tomohiro; Shimizu, Kie; Morita, Kosuke; Sakamoto, Fumi; Oda, Seitaro; Nakaura, Takeshi; Utsunomiya, Daisuke; Shiraishi, Shinya; Yamashita, Yasuyuki

    2017-07-01

    To determine the utility of liver T1-mapping on gadolinium-ethoxybenzyl-diethylenetriamine-pentaacetic acid (Gd-EOB-DTPA) enhanced magnetic resonance (MR) imaging for the measurement of liver functional reserve compared with the signal intensity (SI) based parameters, technetium-99m-galactosyl serum albumin ( 99m Tc-GSA) scintigraphy and indocyanine green (ICG) clearance. This retrospective study included 111 patients (Child-Pugh-A 90; -B 21) performed with both Gd-EOB-DTPA enhanced liver MR imaging and 99m Tc-GSA (76 patients with ICG). Receiver operating characteristic (ROC) curve analysis was performed to compare diagnostic performances of T1-relaxation-time parameters [pre-(T1pre) and post-contrast (T1hb) Gd-EOB-DTPA], SI based parameters [relative enhancement (RE), liver-to-muscle-ratio (LMR), liver-to-spleen-ratio (LSR)] and 99m Tc-GSA scintigraphy blood clearance index (HH15)] for Child-Pugh classification. Pearson's correlation was used for comparisons among T1-relaxation-time parameters, SI-based parameters, HH15 and ICG. A significant difference was obtained for Child-Pugh classification with T1hb, ΔT1, all SI based parameters and HH15. T1hb had the highest AUC followed by RE, LMR, LSR, ΔT1, HH15 and T1pre. The correlation coefficients with HH15 were T1pre 0.22, T1hb 0.53, ΔT1 -0.38 of T1 relaxation parameters; RE -0.44, LMR -0.45, LSR -0.43 of SI-based parameters. T1hb was highest for correlation with HH15. The correlation coefficients with ICG were T1pre 0.29, T1hb 0.64, ΔT1 -0.42 of T1 relaxation parameters; RE -0.50, LMR -0.61, LSR -0.58 of SI-based parameters; 0.64 of HH15. Both T1hb and HH15 were highest for correlation with ICG. T1 relaxation time at post-contrast of Gd-EOB-DTPA (T1hb) was strongly correlated with ICG clearance and moderately correlated HH15 with 99m Tc-GSA. T1hb has the potential to provide robust parameter of liver functional reserve. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Evaluation of multi-exponential relaxation processes: In vitro and in vivo studies

    International Nuclear Information System (INIS)

    Henriksen, O.; Thomsen, C.; Kjaer, L.; Ring, P.

    1986-01-01

    T1 and T2 relaxation values obtained at 1.5 T were measured on 12 inversion-recovery (IR) sequences and a multiple spin-echo (SE) sequence with 32 echoes. Phantom studies were carried out for different CuSO/sub 4/ solutions, using MR imaging and reference spectrometry. The correlation was excellent (r=.98, P>.01;r=1.00, P>.01). T1 and T2 values varied less than 10% in the imaging plane. Then two-compartment phantoms were examined. For T1 and T2, the ratios T1(compartment A)/T1 (compartment B)>6 ant T2(c.A)/T2(c.B) > 6 were essential for reliable estimation. Studies on the normal brain indicate a multiexponential T1 and T2 relaxation process in gray matter

  8. Comparative study of the sensitivity of ADC value and T{sub 2} relaxation time for early detection of Wallerian degeneration

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Fan [Department of Radiology, Nanjing Jinling Hospital, Clinical School of Medical College of Nanjing University, Nanjing 210002 (China); Lu Guangming, E-mail: cjr.luguangming@vip.163.com [Department of Radiology, Nanjing Jinling Hospital, Clinical School of Medical College of Nanjing University, Nanjing 210002 (China); Zee Chishing, E-mail: chishing@usc.edu [Department of Radiology, USC Keck School of Medicine (United States)

    2011-07-15

    Background and purpose: Wallerian degeneration (WD), the secondary degeneration of axons from cortical and subcortical injuries, is associated with poor neurological outcome. There is some quantitative MR imaging techniques used to estimate the biologic changes secondary to delayed neuronal and axonal losses. Our purpose is to assess the sensitivity of ADC value and T{sub 2} relaxation time for early detection of WD. Methods: Ten male Sprague-Dawley rats were used to establish in vivo Wallerian degeneration model of CNS by ipsilateral motor-sensory cortex ablation. 5 days after cortex ablation, multiecho-T{sub 2} relaxometry and multi-b value DWI were acquired by using a 7 T MR imaging scanner. ADC-map and T{sub 2}-map were reconstructed by post-processing. ROIs are selected according to pathway of corticospinal tract from cortex, internal capsule, cerebral peduncle, pons, medulla oblongata to upper cervical spinal cord to measure ADC value and T{sub 2} relaxation time of healthy side and affected side. The results were compared between the side with cortical ablation and the side without ablation. Results: Excluding ablated cortex, ADC values of the corticospinal tract were significantly increased (P < 0.05) in affected side compared to the unaffected, healthy side; no difference in T{sub 2} relaxation time was observed between the affected and healthy sides. Imaging findings were correlated with histological examinations. Conclusion: As shown in this animal experiment, ADC values could non-invasively demonstrate the secondary degeneration involving descending white matter tracts. ADC values are more sensitive indicators for detection of early WD than T{sub 2} relaxation time.

  9. Spin relaxation of iron in mixed state hemoproteins

    International Nuclear Information System (INIS)

    Wajnberg, E.; Kalinowski, H.J.; Bemski, G.; Helman, J.S.

    1984-01-01

    In pure states hemoproteins the relaxation of iron depends on its spin state. It is found that in both mixed state met-hemoglobin and met-myoglobin, the low and high spin states relax through an Orbach-like process. Also, very short (approx. 1 ns) and temperature independent transverse relaxation times T 2 were estimated. This peculiar behaviour of the relaxation may result from the unusual electronic structure of mixed state hemoproteins that allows thermal equilibrium and interconversion of the spin states. (Author) [pt

  10. Is the T1ρ MRI profile of hyaline cartilage in the normal hip uniform?

    Science.gov (United States)

    Rakhra, Kawan S; Cárdenas-Blanco, Arturo; Melkus, Gerd; Schweitzer, Mark E; Cameron, Ian G; Beaulé, Paul E

    2015-04-01

    T1ρ MRI is an imaging technique sensitive to proteoglycan (PG) content of hyaline cartilage. However, normative T1ρ values have not been established for the weightbearing cartilage of the hip, and it is not known whether it is uniform or whether there is topographic variation. Knowledge of the T1ρ profile of hyaline cartilage in the normal hip is important for establishing a baseline against which comparisons can be made to experimental and clinical arthritic subjects. In this diagnostic study, we determined (1) the T1ρ MRI values of hyaline cartilage of the normal hip; and (2) whether the T1ρ MRI profile of the normal hip hyaline cartilage is uniform. Fourteen asymptomatic volunteers (11 men, three women; mean age, 35 years) prospectively underwent 1.5-T T1ρ MRI of a single hip. The weightbearing hyaline cartilage bilayer of the acetabulum and femoral head was evaluated on sagittal images and segmented into four zones: (1) anterior; (2) anterosuperior; (3) posterosuperior; and (4) and posterior. For the full region of interest and within each zone and each sagittal slice, we calculated the mean T1ρ relaxation value, a parameter that indirectly quantifies PG content, where T1ρ is inversely related to PG concentration. There was variation in the T1ρ relaxation values depending on zone (anterior to posterior) and slice (medial to lateral). When combining the most anterior quadrants (Zones 1 and 2), the T1ρ relaxation values were lower than those in the combined posterior quadrants (Zones 3 and 4) (30.4 msec versus 32.2 msec, respectively; p = 0.002), reflecting higher PG concentration. There was a difference between the T1ρ relaxation values of the sagittal slices (p = 0.038), most pronounced anteriorly in Zone 1 (26.6 msec, p = 0.001). With a selective combination of zones and slices, there were lower mean T1ρ values in the anterolateral-most region compared with the remainder of the weightbearing portion of the hip (28.6 msec versus 32.2 msec

  11. Measurements of T1 and T2 over time in formalin-fixed human whole-brain specimens

    International Nuclear Information System (INIS)

    Tovi, M.; Ericsson, A.

    1992-01-01

    T1 and T2 were measured in 5 formalin-fixed human whole-brain specimens as a function of time. Gray matter/white matter contrast reversal was observed around the 4th day and was considered to be due to the greater decrease in T1 in gray than in white matter. A possible explanation for this is that the decomposition of the myelin phospholipid structure by formalin somewhat counteracts the general reductive effect of the fixation procedure on relaxation times. (orig.)

  12. Hydration water dynamics in biopolymers from NMR relaxation in the rotating frame.

    Science.gov (United States)

    Blicharska, Barbara; Peemoeller, Hartwig; Witek, Magdalena

    2010-12-01

    Assuming dipole-dipole interaction as the dominant relaxation mechanism of protons of water molecules adsorbed onto macromolecule (biopolymer) surfaces we have been able to model the dependences of relaxation rates on temperature and frequency. For adsorbed water molecules the correlation times are of the order of 10(-5)s, for which the dispersion region of spin-lattice relaxation rates in the rotating frame R(1)(ρ)=1/T(1)(ρ) appears over a range of easily accessible B(1) values. Measurements of T(1)(ρ) at constant temperature and different B(1) values then give the "dispersion profiles" for biopolymers. Fitting a theoretical relaxation model to these profiles allows for the estimation of correlation times. This way of obtaining the correlation time is easier and faster than approaches involving measurements of the temperature dependence of R(1)=1/T(1). The T(1)(ρ) dispersion approach, as a tool for molecular dynamics study, has been demonstrated for several hydrated biopolymer systems including crystalline cellulose, starch of different origins (potato, corn, oat, wheat), paper (modern, old) and lyophilized proteins (albumin, lysozyme). Copyright © 2010 Elsevier Inc. All rights reserved.

  13. Faster metabolite (1H transverse relaxation in the elder human brain.

    Directory of Open Access Journals (Sweden)

    Małgorzata Marjańska

    Full Text Available (1H magnetic resonance spectroscopy (MRS is unique among imaging modalities because signals from several metabolites are measured during a single examination period. Each metabolite reflects a distinct intracellular process. Furthermore transverse (T2 relaxation times probe the viability of the cell microenvironment, e.g., the viscosity of the cellular fluids, the microscopic susceptibility distribution within the cells, and the iron content. In this study, T2s of brain metabolites were measured in the occipital lobe of eighteen young and fourteen elderly subjects at a field strength of 4 tesla. The T2s of N-acetylaspartate, total creatine, and total choline were 23%, 16% and 10% shorter in elderly than in young subjects. The findings of this study suggest that noninvasive detection of T2 provides useful biological information on changes in the cellular microenvironment that take place during aging.

  14. Assessing liver function in patients with HBV-related HCC: a comparison of T{sub 1} mapping on Gd-EOB-DTPA-enhanced MR imaging with DWI

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Ying; Rao, Sheng-Xiang; Chen, Caizhong; Li, Renchen; Zeng, Meng-Su [Zhongshan Hospital of Fudan University, Department of Radiology, 180 Fenglin Road, Xuhui District, Shanghai (China)

    2015-05-01

    To compare the potential of T{sub 1} mapping on gadoxetic acid (Gd-EOB-DTPA)-enhanced magnetic resonance imaging (MRI) and diffusion-weighted imaging (DWI) for assessing liver function in patients with hepatitis B virus (HBV)-related hepatocellular carcinoma (HCC). One hundred consecutive patients with known HBV-related HCCs were included. T{sub 1} relaxation time and apparent diffusion coefficient (ADC) of the liver were measured, and the reduction rate of T{sub 1} relaxation time (∇%) was calculated. T{sub 1} relaxation time measurements were compared with ADC values according to the Model for End-Stage Liver Disease (MELD) score. Hepatobiliary phase (HBP) and ∇% of T{sub 1} relaxation time measurements showed significant correlations with MELD score (rho = 0.571, p < 0.0001; rho = -0.573, p < 0.0001, respectively). HBP and ∇% of T{sub 1} relaxation time were significantly different between good (MELD ≤8) and poor liver function (MELD ≥9) (p < 0.0001 for both). Areas under the receiver operating characteristic curves (AUCs) of T{sub 1} relaxation time for HBP (AUC 0.84) and ∇% (AUC 0.82) were significantly better than for ADC (AUC 0.53; p < 0.0001). T{sub 1} mapping on Gd-EOB-DTPA-enhanced MRI showed promise for evaluating liver function in patients with HBV-related HCC, while DWI was not reliable. HBP T{sub 1} relaxation time measurement was equally accurate as ∇% measurement. (orig.)

  15. Relaxation of nuclear spin on holes in semiconductors

    International Nuclear Information System (INIS)

    Gr'ncharova, E.I.; Perel', V.I.

    1977-01-01

    The longitudienal relaxation time T 1 of nuclear spins due to dipole-dipole interaction with holes in semiconductors is calculated. Expressions for T 1 in cubic and uniaxial semiconductors are obtained for non-degenerate and degenerate cases. On the basis of comparison with available experimental data for silicon the agreement with the theoretical results is obtained. It is demonstrated that in uniaxial semiconductors the time of relaxation on holes for a nuclear spin directed along the c axis is considerably greater than that for a spin in the normal direction

  16. Tuning the non-covalent confinement of Gd(III) complexes in silica nanoparticles for high T1-weighted MR imaging capability.

    Science.gov (United States)

    Fedorenko, Svetlana V; Grechkina, Svetlana L; Mustafina, Asiya R; Kholin, Kirill V; Stepanov, Alexey S; Nizameev, Irek R; Ismaev, Ildus E; Kadirov, Marsil K; Zairov, Rustem R; Fattakhova, Alfia N; Amirov, Rustem R; Soloveva, Svetlana E

    2017-01-01

    The present work introduces deliberate synthesis of Gd(III)-doped silica nanoparticles with high relaxivity at magnetic field strengths below 1.5T. Modified microemulsion water-in-oil procedure was used in order to achieve superficial localization of Gd(III) complexes within 40-55nm sized silica spheres. The relaxivities of the prepared nanoparticles were measured at 0.47, 1.41 and 1.5T with the use of both NMR analyzer and whole body NMR scanner. Longitudinal relaxivities of the obtained silica nanoparticles reveal significant dependence on the confinement mode, changing from 4.1 to 49.6mM -1 s -1 at 0.47T when the localization of Gd(III) complexes changes from core to superficial zones of the silica spheres. The results highlight predominant contribution of the complexes located close to silica/water interface to the relaxivity of the nanoparticles. Low effect of blood proteins on the relaxivity in the aqueous colloids of the nanoparticles was exemplified by serum bovine albumin. T 1 - weighted MRI data indicate that the nanoparticles provide strong positive contrast at 1.5T, which along with low cytotoxicity effect make a good basis for their application as contrast agents. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. Slow relaxation in weakly open rational polygons.

    Science.gov (United States)

    Kokshenev, Valery B; Vicentini, Eduardo

    2003-07-01

    The interplay between the regular (piecewise-linear) and irregular (vertex-angle) boundary effects in nonintegrable rational polygonal billiards (of m equal sides) is discussed. Decay dynamics in polygons (of perimeter P(m) and small opening Delta) is analyzed through the late-time survival probability S(m) approximately equal t(-delta). Two distinct slow relaxation channels are established. The primary universal channel exhibits relaxation of regular sliding orbits, with delta=1. The secondary channel is given by delta>1 and becomes open when m>P(m)/Delta. It originates from vertex order-disorder dual effects and is due to relaxation of chaoticlike excitations.

  18. Effects of spin vacancies on the correlated spin dynamics in La2Cu1-xZnxO4 from 63Cu nuclear quadrupole resonance relaxation

    International Nuclear Information System (INIS)

    Carretta, P.; Rigamonti, A.; Sala, R.

    1997-01-01

    63 Cu nuclear quadrupole resonance (NQR) relaxation measurements in La 2 CuO 4 doped Zn are used in order to investigate the temperature dependence of the in-plane magnetic correlation length ξ 2D and the effects associated to spin vacancies in two dimensional quantum Heisenberg antiferromagnets (QHAF). The relaxation rates T 1 -1 and T 2 -1 have been related to the static generalized susceptibility χ(q,0) and to the decay rate Γ q of the normal excitations. By using scaling arguments for χ(q,0) and Γ q , the relaxation rates have been expressed in close form in terms of ξ 2D (x,T) and its dependence on temperature and spin doping x thus extracted. The experimental findings are analyzed in light of the renormalized classical (RC) and quantum critical (QC) behaviors predicted for ξ 2D by recent theories for S=1/2 HAF in square lattices. It is first shown that in pure La 2 CuO 4 , ξ 2D is consistent with a RC regime up to about 900 K, with tendency toward the QC regime above. The spin vacancies reduce the Nacute eel temperature according to the law T N (x)∼T N (0)(1 3.5x). From the temperature dependence of 63 Cu NQR relaxation rate T 1 -1 , T 2 -1 and from the composition dependence of T N it is consistently proved that the effect on ξ 2D can be accounted for by the modification of the spin stiffness in a simple dilutionlike model, the system still remaining in the RC regime, at least for T≤900 K. copyright 1997 American Institute of Physics

  19. Contrast visibility for indirect MR arthrography with different protein contents and agent relaxivities at different field strengths: An in vitro model

    International Nuclear Information System (INIS)

    Nouh, M.R.; Schweitzer, M.E.; Ragatte, Ravinder R.

    2011-01-01

    Objectives: Protein binding and relaxivity are major determinants of the relative effectiveness of an MR arthrographic contrast agent. We sought to evaluate the optimal concentrations of high and usual relaxivity agents in two different proteinous environments at variable field strength for two MR contrast agents of different relaxivities. Materials and methods: At 1.5, 3.0 and 7.0 T, gadobenate dimeglumine (Multihance) with high-relaxivity in proteinous environment and gadoteridol (Prohance) with more typical behavior were studied at 1.25, 2.5, 5, and 10 mmol in 1.7 g/dL and 3 g/dL albumin (mimicking protein content of normal and inflammatory synovial fluids, respectively) vs. pure normal saline, as a control. Analysis of image signal intensity (SI) and relaxivity values was done. Results: In our study a change in concentration had no significant effect on T1 SI. In contrast, nearly every change in concentration led to a significant change in T2 SI. In 1.25 mmol concentration, there was no effect on T1 SI of either protein concentrations while higher concentrations showed significant decreased SI in either protein carrier compared to saline. The SI of Gadoteridol was significantly higher (p < 0.0001) than that of gadobenate at each of 3 T and 7 T, but was significantly lower (p < 0.001) at 1.5 T in saline solution while this was not significant for either protein carrier. Both protein carriers had significant effect on T1 (p = 0.0124) and T2 (p = 0.0118) relaxivities. Also solution concentration significantly (p < 0.01) affected both T1 and T2 relaxivities. Field strength did not affect T1 relaxivity (p = 0.02511) while it significantly affected T2 relaxivity (p < 0.001). This was significant (p = 0.035) in case of gadoteridol at 3 T. Conclusion: 1.25 mmol concentration of both gadoteridol and gadobenate solutions yields the best diagnostic T1 SI specially in higher fields (3 T and 7 T) and avoid the deleterious effect of increasing concentration on T2 SI

  20. Nuclear Spin relaxation mediated by Fermi-edge electrons in n-type GaAs

    Science.gov (United States)

    Kotur, M.; Dzhioev, R. I.; Kavokin, K. V.; Korenev, V. L.; Namozov, B. R.; Pak, P. E.; Kusrayev, Yu. G.

    2014-03-01

    A method based on the optical orientation technique was developed to measure the nuclear-spin lattice relaxation time T 1 in semiconductors. It was applied to bulk n-type GaAs, where T 1 was measured after switching off the optical excitation in magnetic fields from 400 to 1200 G at low (< 30 K) temperatures. The spin-lattice relaxation of nuclei in the studied sample with n D = 9 × 1016 cm-3 was found to be determined by hyperfine scattering of itinerant electrons (Korringa mechanism) which predicts invariability of T 1 with the change in magnetic field and linear dependence of the relaxation rate on temperature. This result extends the experimentally verified applicability of the Korringa relaxation law in degenerate semiconductors, previously studied in strong magnetic fields (several Tesla), to the moderate field range.

  1. Relaxation of ion energy spectrum just after turbulent heating pulse in TRIAM-1 tokamak

    International Nuclear Information System (INIS)

    Nakamura, Kazuo; Hiraki, Naoji; Nakamura, Yukio; Itoh, Satoshi

    1982-01-01

    The temporal evolution and spatial profile of the ion energy spectrum just after the application of a toroidal current pulse for turbulent heating are investigated experimentally in the TRIAM-1 tokamak and also numerically using the Fokker-Planck equation. The two-component ion energy spectrum formed by turbulent heating relaxes to a single one within tausub(i) (the ion collision time). (author)

  2. Relaxation of ion energy spectrum just after turbulent heating pulse in TRIAM-1 tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Kazuo; Hiraki, Naoji; Nakamura, Yukio; Itoh, Satoshi [Kyushu Univ., Fukuoka (Japan). Research Inst. for Applied Mechanics

    1982-07-01

    The temporal evolution and spatial profile of the ion energy spectrum just after the application of a toroidal current pulse for turbulent heating are investigated experimentally in the TRIAM-1 tokamak and also numerically using the Fokker-Planck equation. The two-component ion energy spectrum formed by turbulent heating relaxes to a single one within tausub(i) (the ion collision time).

  3. Effect of Temper Condition on Stress Relaxation Behavior of an Aluminum Copper Lithium Alloy

    Science.gov (United States)

    Mishra, Sumeet; Beura, Vikrant Kumar; Singh, Amit; Yadava, Manasij; Nayan, Niraj

    2018-04-01

    Deformation behavior of an Al-Cu-Li alloy in different temper conditions (solutionized and T8) is investigated using stress relaxation tests. Fundamental parameters such as the apparent and physical activation volume, strain rate sensitivity, effective stress, and exhaustion rate of mobile dislocation density are determined from single and multiple relaxation tests. It was found that dislocation-dislocation interaction controls the kinetics of plastic deformation in the solutionized sample, whereas dislocation-precipitate interaction is the overriding factor in the presence of T1 precipitates. The apparent activation volume was found to be significantly lower in the presence of T1 precipitates compared with solutionized samples. Strain rate sensitivity and effective stress were found to be higher in the presence of T1 precipitates. In addition, multiple relaxation tests showed that irrespective of microstructural features (solutes, semi-coherent precipitates), the mobile dislocation density reduces during the relaxation period. Further evidence regarding reduction in mobile dislocation density is obtained from uniaxial tensile tests carried out after stress relaxation tests, where both solutionized and T8 samples show an increase in strength. Additional discussion on relaxation strain is included to provide a complete overview regarding the time-dependent deformation behavior of the Al-Cu-Li alloy in different temper conditions.

  4. T1ρ magnetic resonance: basic physics principles and applications in knee and intervertebral disc imaging

    NARCIS (Netherlands)

    Wáng, Yì-Xiáng J.; Zhang, Qinwei; Li, Xiaojuan; Chen, Weitian; Ahuja, Anil; Yuan, Jing

    2015-01-01

    T1ρ relaxation time provides a new contrast mechanism that differs from T1- and T2-weighted contrast, and is useful to study low-frequency motional processes and chemical exchange in biological tissues. T1ρ imaging can be performed in the forms of T1ρ-weighted image, T1ρ mapping and T1ρ dispersion.

  5. Determination of the magnetic impurities contribution to the nuclear relaxation in metals

    International Nuclear Information System (INIS)

    Cohen, A.M.

    1982-01-01

    The renormalization group techniques developed by Wilson for the Kondo problem are applied, for the first time, to the calculation of nuclear spin relaxation rates in dilute magnetic alloys. A procedure that calculates the longitudinal relaxation time T 1 over the entire temperature range 0 B T 1 is derived; for distances R between the impurity and the nucleus large compared to the inverse Fermi momentum H f , the result is identical to Korringa's expression for the nuclear spin relaxation rate in the pure metal. For smaller k F R, T 1 increases and becomes infinite as k F R→0. A numerical approach, capable of calculating T 1 at finite temperatures, is presented and tested by calculating T 1 for T→0; the numerical results are in excellent agreement with the analytical expression discussed above. Only for k F R→ infinity do the results for T 1 at T=0 agree with those found by Roshen and Saam, who recently analysed this problem in the light of Nozieres's Fermi liquid theory. The reasons for the discrepancy for finite k F R are discussed. (author) [pt

  6. Enhancement of relaxation rates in the normal state of superconductor PuRhGa5:NQR relaxation study

    International Nuclear Information System (INIS)

    Sakai, H.; Kambe, S.; Tokunaga, Y.; Fujimoto, T.; Walstedt, R.E.; Yasuoka, H.; Aoki, D.; Homma, Y.; Yamamoto, E.; Nakamura, A.; Shiokawa, Y.; Nakajima, K.; Arai, Y.; Matsuda, T.D.; Haga, Y.; Onuki, Y.

    2007-01-01

    The spin-lattice relaxation rates (1/T 1 ) have been measured under zero field using nuclear quadrupole resonance (NQR) lines in superconductor PuRhGa 5 and Pauli-paramagnet LuCoGa 5 . In the reference LuCoGa 5 with fully-occupied 4f shell, the 1/T 1 shows the constant behavior of (T 1 T) -1 =0.495+/-0.002(sK) -1 . On the other hand, in PuRhGa 5 , 1/T 1 is much larger than in LuCoGa 5 and the 1/T 1T behavior below ∼30K is seen, where its (T 1 T) -1 value is 3.27+/-0.005(sK) -1 . These results suggest a development of coherent Fermi liquid state incorporated with 5f electrons below ∼30K in PuRhGa 5

  7. Patellofemoral instability in children: T2 relaxation times of the patellar cartilage in patients with and without patellofemoral instability and correlation with morphological grading of cartilage damage

    International Nuclear Information System (INIS)

    Kang, Chang Ho; Kim, Hee Kyung; Shiraj, Sahar; Anton, Christopher; Kim, Dong Hoon; Horn, Paul S.

    2016-01-01

    Patellofemoral instability is one of the most common causes of cartilage damage in teenagers. To quantitatively evaluate the patellar cartilage in patients with patellofemoral instability using T2 relaxation time maps (T2 maps), compare the values to those in patients without patellofemoral instability and correlate them with morphological grades in patients with patellofemoral instability. Fifty-three patients with patellofemoral instability (mean age: 15.9 ± 2.4 years) and 53 age- and gender-matched patients without patellofemoral instability were included. Knee MR with axial T2 map was performed. Mean T2 relaxation times were obtained at the medial, central and lateral zones of the patellar cartilage and compared between the two groups. In the patellofemoral instability group, morphological grading of the patellar cartilage (0-4) was performed and correlated with T2 relaxation times. Mean T2 relaxation times were significantly longer in the group with patellofemoral instability as compared to those of the control group across the patellar cartilage (Student's t-test, P<0.05) with the longest time at the central area. Positive correlation was seen between mean T2 relaxation time and morphological grading (Pearson correlation coefficiency, P<0.001). T2 increased with severity of morphological grading from 0 to 3 (mixed model, P<0.001), but no statistical difference was seen between grades 3 and 4. In patellofemoral instability, patellar cartilage damage occurs across the entire cartilage with the highest T2 values at the apex. T2 relaxation times directly reflect the severity in low-grade cartilage damage, which implies an important role for T2 maps in differentiating between normal and low-grade cartilage damage. (orig.)

  8. Proton relaxation relationships of human and animal tissues in vitro. Changes due to autolysis and fixing

    International Nuclear Information System (INIS)

    Grodd, W.; Schmitt, W.G.H.

    1983-01-01

    The results of measurements of proton relaxation times of various tissues from rats, pigs and humans are reported; these were obtained by a resonance spectroscope at 20 MHz and 40 0 C. There were specific differences in both relaxation times (T 1 and T 2 ) of the liver and spleen. There was a difference of more than 150 ms in the longitudinal relaxation time between grey and white cerebral tissue. Autolytic changes show an increase in both relaxation times. Fixation produced a reduction in T 1 only. The significance of these findings for NMR tomography is discussed. (orig.) [de

  9. Ferromagnetism versus slow paramagnetic relaxation in Fe-doped Li3N

    Science.gov (United States)

    Fix, M.; Jesche, A.; Jantz, S. G.; Bräuninger, S. A.; Klauss, H.-H.; Manna, R. S.; Pietsch, I. M.; Höppe, H. A.; Canfield, P. C.

    2018-02-01

    We report on isothermal magnetization, Mössbauer spectroscopy, and magnetostriction as well as temperature-dependent alternating-current (ac) susceptibility, specific heat, and thermal expansion of single crystalline and polycrystalline Li2(Li1 -xFex) N with x =0 and x ≈0.30 . Magnetic hysteresis emerges at temperatures below T ≈50 K with coercivity fields of up to μ0H =11.6 T at T =2 K and magnetic anisotropy energies of 310 K (27 meV). The ac susceptibility is strongly frequency-dependent (f =10 -10 000 Hz) and reveals an effective energy barrier for spin reversal of Δ E ≈1100 K (90 meV). The relaxation times follow Arrhenius behavior for T >25 K . For T <10 K , however, the relaxation times of τ ≈1010 s are only weakly temperature-dependent, indicating the relevance of a quantum tunneling process instead of thermal excitations. The magnetic entropy amounts to more than 25 J molFe-1 K-1, which significantly exceeds R ln 2 , the value expected for the entropy of a ground-state doublet. Thermal expansion and magnetostriction indicate a weak magnetoelastic coupling in accordance with slow relaxation of the magnetization. The classification of Li2(Li1 -xFex) N as ferromagnet is stressed and contrasted with highly anisotropic and slowly relaxing paramagnetic behavior.

  10. Stretched Exponential relaxation in pure Se glass

    Science.gov (United States)

    Dash, S.; Ravindren, S.; Boolchand, P.

    A universal feature of glasses is the stretched exponential relaxation, f (t) = exp[ - t / τ ] β . The model of diffusion of excitations to randomly distributed traps in a glass by Phillips1 yields the stretched exponent β = d[d +2] where d, the effective dimensionality. We have measured the enthalpy of relaxation ΔHnr (tw) at Tg of Se glass in modulated DSC experiments as glasses age at 300K and find β = 0.43(2) for tw in the 0 relaxation is a narrowing of the glass transition width from 7.1°C to 1.4°C, and the ΔHnr term increasing from 0.21 cal/gm to 0.92 cal/gm. In bulk GexSe100-x glasses as x increases to 20%, the length of the polymeric Sen chains between the Ge-crosslinks decreases to n = 2. and the striking relaxation effects nearly vanish. J.C. Phillips, Rep.Prog.Phys. 59 , 1133 (1996). Supported by NSF Grant DMR 08-53957.

  11. On the relaxation of cold electrons and hot ions

    International Nuclear Information System (INIS)

    Potapenko, I.F.; Bobylev, A.V.; Azevedo, C.A. de; Sakanaka, P.H.; Assis, A.S. de

    1998-01-01

    The relaxation process of a space uniform plasma composed of cold electrons and one species of hot ions is studied numerically using one- and two-dimensional Landau - Fokker - Planck codes. Relaxation of a monoenergetic ion beam is considered in possibly extreme temperature regimes. Special attention is paid to the deviation of the relaxation process from the classical picture, which is characterized by the close initial temperatures T e >(m e /m i ) 1/3 T i . The present results give quite a clear idea of the relaxation picture for any initial temperatures also in extreme temperature regimes. A difference scheme, preserving the number of particles and the energy, gives the possibility of solving the problem numerically without error accumulation, except for machine errors. copyright 1998 American Institute of Physics

  12. Quantitative Assessment of the T2 Relaxation Time of the Gluteus Muscles in Children with Duchenne Muscular Dystrophy: a Comparative Study Before and After Steroid Treatment

    International Nuclear Information System (INIS)

    Kim, Hee Kyung; Laor, Tal; Wong, Brenda; Horn, Paul S.

    2010-01-01

    To determine the feasibility of using T2 mapping as a quantitative method to longitudinally follow the disease activity in children with Duchenne muscular dystrophy (DMD) who are treated with steroids. Eleven boys with DMD (age range: 5-14 years) underwent evaluation with the clinical functional score (CFS), and conventional pelvic MRI and T2 mapping before and during steroid therapy. The gluteus muscle inflammation and fatty infiltration were evaluated on conventional MRI. The histograms and mean T2 relaxation times were obtained from the T2 maps. The CFS, the conventional MRI findings and the T2 values were compared before and during steroid therapy. None of the patients showed interval change of their CFSs. On conventional MRI, none of the images showed muscle inflammation. During steroid treatment, two boys showed increased fatty infiltration on conventional MRI, and both had an increase of the mean T2 relaxation time (p < 0.05). The remaining nine boys had no increase in fatty infiltration. Of these, three showed an increased mean T2 relaxation time (p < 0.05), two showed no change and four showed a decreased mean T2 relaxation time (p < 0.05). T2 mapping is a feasible technique to evaluate the longitudinal muscle changes in those children who receive steroid therapy for DMD. The differences of the mean T2 relaxation time may reflect alterations in disease activity, and even when the conventional MRI and CFS remain stable

  13. Quantitative Assessment of the T2 Relaxation Time of the Gluteus Muscles in Children with Duchenne Muscular Dystrophy: a Comparative Study Before and After Steroid Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hee Kyung; Laor, Tal; Wong, Brenda [Cincinnati Children' s Hospital Medical Center, Cincinnati (United States); Horn, Paul S. [University of Cincinnati, Cincinnati (United States)

    2010-06-15

    To determine the feasibility of using T2 mapping as a quantitative method to longitudinally follow the disease activity in children with Duchenne muscular dystrophy (DMD) who are treated with steroids. Eleven boys with DMD (age range: 5-14 years) underwent evaluation with the clinical functional score (CFS), and conventional pelvic MRI and T2 mapping before and during steroid therapy. The gluteus muscle inflammation and fatty infiltration were evaluated on conventional MRI. The histograms and mean T2 relaxation times were obtained from the T2 maps. The CFS, the conventional MRI findings and the T2 values were compared before and during steroid therapy. None of the patients showed interval change of their CFSs. On conventional MRI, none of the images showed muscle inflammation. During steroid treatment, two boys showed increased fatty infiltration on conventional MRI, and both had an increase of the mean T2 relaxation time (p < 0.05). The remaining nine boys had no increase in fatty infiltration. Of these, three showed an increased mean T2 relaxation time (p < 0.05), two showed no change and four showed a decreased mean T2 relaxation time (p < 0.05). T2 mapping is a feasible technique to evaluate the longitudinal muscle changes in those children who receive steroid therapy for DMD. The differences of the mean T2 relaxation time may reflect alterations in disease activity, and even when the conventional MRI and CFS remain stable.

  14. NMR relaxation induced by iron oxide particles: testing theoretical models.

    Science.gov (United States)

    Gossuin, Y; Orlando, T; Basini, M; Henrard, D; Lascialfari, A; Mattea, C; Stapf, S; Vuong, Q L

    2016-04-15

    Superparamagnetic iron oxide particles find their main application as contrast agents for cellular and molecular magnetic resonance imaging. The contrast they bring is due to the shortening of the transverse relaxation time T 2 of water protons. In order to understand their influence on proton relaxation, different theoretical relaxation models have been developed, each of them presenting a certain validity domain, which depends on the particle characteristics and proton dynamics. The validation of these models is crucial since they allow for predicting the ideal particle characteristics for obtaining the best contrast but also because the fitting of T 1 experimental data by the theory constitutes an interesting tool for the characterization of the nanoparticles. In this work, T 2 of suspensions of iron oxide particles in different solvents and at different temperatures, corresponding to different proton diffusion properties, were measured and were compared to the three main theoretical models (the motional averaging regime, the static dephasing regime, and the partial refocusing model) with good qualitative agreement. However, a real quantitative agreement was not observed, probably because of the complexity of these nanoparticulate systems. The Roch theory, developed in the motional averaging regime (MAR), was also successfully used to fit T 1 nuclear magnetic relaxation dispersion (NMRD) profiles, even outside the MAR validity range, and provided a good estimate of the particle size. On the other hand, the simultaneous fitting of T 1 and T 2 NMRD profiles by the theory was impossible, and this occurrence constitutes a clear limitation of the Roch model. Finally, the theory was shown to satisfactorily fit the deuterium T 1 NMRD profile of superparamagnetic particle suspensions in heavy water.

  15. Predicting the effect of relaxation during frequency-selective adiabatic pulses

    Science.gov (United States)

    Pfaff, Annalise R.; McKee, Cailyn E.; Woelk, Klaus

    2017-11-01

    Adiabatic half and full passages are invaluable for achieving uniform, B1-insensitive excitation or inversion of macroscopic magnetization across a well-defined range of NMR frequencies. To accomplish narrow frequency ranges with adiabatic pulses (computer-calculated data with experimental results demonstrates that, in non-viscous, small-molecule fluids, it is possible to model magnetization and relaxation by considering standard T1 and T2 relaxation in the traditional rotating frame. The proposed model is aimed at performance optimizations of applications in which these pulses are employed. It differs from previous reports which focused on short high-power adiabatic pulses and relaxation that is governed by dipole-dipole interactions, cross polarization, or chemical exchange.

  16. Patellofemoral instability in children: T2 relaxation times of the patellar cartilage in patients with and without patellofemoral instability and correlation with morphological grading of cartilage damage.

    Science.gov (United States)

    Kang, Chang Ho; Kim, Hee Kyung; Shiraj, Sahar; Anton, Christopher; Kim, Dong Hoon; Horn, Paul S

    2016-07-01

    Patellofemoral instability is one of the most common causes of cartilage damage in teenagers. To quantitatively evaluate the patellar cartilage in patients with patellofemoral instability using T2 relaxation time maps (T2 maps), compare the values to those in patients without patellofemoral instability and correlate them with morphological grades in patients with patellofemoral instability. Fifty-three patients with patellofemoral instability (mean age: 15.9 ± 2.4 years) and 53 age- and gender-matched patients without patellofemoral instability were included. Knee MR with axial T2 map was performed. Mean T2 relaxation times were obtained at the medial, central and lateral zones of the patellar cartilage and compared between the two groups. In the patellofemoral instability group, morphological grading of the patellar cartilage (0-4) was performed and correlated with T2 relaxation times. Mean T2 relaxation times were significantly longer in the group with patellofemoral instability as compared to those of the control group across the patellar cartilage (Student's t-test, Ppatellofemoral instability, patellar cartilage damage occurs across the entire cartilage with the highest T2 values at the apex. T2 relaxation times directly reflect the severity in low-grade cartilage damage, which implies an important role for T2 maps in differentiating between normal and low-grade cartilage damage.

  17. Nuclear magnetic relaxation studies of semiconductor nanocrystals and solids

    Energy Technology Data Exchange (ETDEWEB)

    Sachleben, Joseph Robert [Lawrence Berkeley Lab., CA (United States); California Univ., Berkeley, CA (United States). Dept. of Chemistry

    1993-09-01

    Semiconductor nanocrystals, small biomolecules, and 13C enriched solids were studied through the relaxation in NMR spectra. Surface structure of semiconductor nanocrystals (CdS) was deduced from high resolution 1H and 13C liquid state spectra of thiophenol ligands on the nanocrystal surfaces. The surface coverage by thiophenol was found to be low, being 5.6 and 26% for nanocrystal radii of 11.8 and 19.2 Å. Internal motion is estimated to be slow with a correlation time > 10-8 s-1. The surface thiophenol ligands react to form a dithiophenol when the nanocrystals were subjected to O2 and ultraviolet. A method for measuring 14N-1H J-couplings is demonstrated on pyridine and the peptide oxytocin; selective 2D T1 and T2 experiments are presented for measuring relaxation times in crowded spectra with overlapping peaks in 1D, but relaxation effects interfere. Possibility of carbon-carbon cross relaxation in 13C enriched solids is demonstrated by experiments on zinc acetate and L-alanine.

  18. Nuclear magnetic resonance relaxation times for human lung cancer and lung tissues

    International Nuclear Information System (INIS)

    Matsuura, Yoshifumi; Shioya, Sumie; Kurita, Daisaku; Ohta, Takashi; Haida, Munetaka; Ohta, Yasuyo; Suda, Syuichi; Fukuzaki, Minoru.

    1994-01-01

    We investigated the nuclear magnetic resonance (NMR) relaxation times, T 1 and T 2 , for lung cancer tissue, and other samples of lung tissue obtained from surgical specimens. The samples were nine squamous cell carcinomas, five necrotic squamous cell carcinomas, 15 adenocarcinomas, two benign mesotheliomas, and 13 fibrotic lungs. The relaxation times were measured with a 90 MHz NMR spectrometer and the results were correlated with histological changes. The values of T 1 and T 2 for squamous cell carcinoma and mesothelioma were significantly longer than those of adenocarcinoma and fibrotic lung tissue. There were no significant differences in values of T 1 and T 2 between adenocarcinoma and lung tissue. The values of T 1 and T 2 for benign mesothelioma were similar to those of squamous cell carcinoma, which suggested that increases in T 1 and T 2 are not specific to malignant tissues. (author)

  19. Whole brain MP2RAGE-based mapping of the longitudinal relaxation time at 9.4T.

    Science.gov (United States)

    Hagberg, G E; Bause, J; Ethofer, T; Ehses, P; Dresler, T; Herbert, C; Pohmann, R; Shajan, G; Fallgatter, A; Pavlova, M A; Scheffler, K

    2017-01-01

    Mapping of the longitudinal relaxation time (T 1 ) with high accuracy and precision is central for neuroscientific and clinical research, since it opens up the possibility to obtain accurate brain tissue segmentation and gain myelin-related information. An ideal, quantitative method should enable whole brain coverage within a limited scan time yet allow for detailed sampling with sub-millimeter voxel sizes. The use of ultra-high magnetic fields is well suited for this purpose, however the inhomogeneous transmit field potentially hampers its use. In the present work, we conducted whole brain T 1 mapping based on the MP2RAGE sequence at 9.4T and explored potential pitfalls for automated tissue classification compared with 3T. Data accuracy and T 2 -dependent variation of the adiabatic inversion efficiency were investigated by single slice T 1 mapping with inversion recovery EPI measurements, quantitative T 2 mapping using multi-echo techniques and simulations of the Bloch equations. We found that the prominent spatial variation of the transmit field at 9.4T (yielding flip angles between 20% and 180% of nominal values) profoundly affected the result of image segmentation and T 1 mapping. These effects could be mitigated by correcting for both flip angle and inversion efficiency deviations. Based on the corrected T 1 maps, new, 'flattened', MP2RAGE contrast images were generated, that were no longer affected by variations of the transmit field. Unlike the uncorrected MP2RAGE contrast images acquired at 9.4T, these flattened images yielded image segmentations comparable to 3T, making bias-field correction prior to image segmentation and tissue classification unnecessary. In terms of the T 1 estimates at high field, the proposed correction methods resulted in an improved precision, with test-retest variability below 1% and a coefficient-of-variation across 25 subjects below 3%. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. SU-F-I-63: Relaxation Times of Lipid Resonances in NAFLD Animal Model Using Enhanced Curve Fitting

    Energy Technology Data Exchange (ETDEWEB)

    Song, K-H; Yoo, C-H; Lim, S-I; Choe, B-Y [Department of Biomedical Engineering, and Research Institute of Biomedical Engineering, The Catholic University of Korea College of Medicine, Seoul (Korea, Republic of)

    2016-06-15

    Purpose: The objective of this study is to evaluate the relaxation time of methylene resonance in comparison with other lipid resonances. Methods: The examinations were performed on a 3.0T MRI scanner using a four-channel animal coil. Eight more Sprague-Dawley rats in the same baseline weight range were housed with ad libitum access to water and a high-fat (HF) diet (60% fat, 20% protein, and 20% carbohydrate). In order to avoid large blood vessels, a voxel (0.8×0.8×0.8 cm{sup 3}) was placed in a homogeneous area of the liver parenchyma during free breathing. Lipid relaxations in NC and HF diet rats were estimated at a fixed repetition time (TR) of 6000 msec, and multi echo time (TEs) of 40–220 msec. All spectra for data measurement were processed using the Advanced Method for Accurate, Robust, and Efficient Spectral (AMARES) fitting algorithm of the Java-based Magnetic Resonance User Interface (jMRUI) package. Results: The mean T2 relaxation time of the methylene resonance in normal-chow diet was 37.1 msec (M{sub 0}, 2.9±0.5), with a standard deviation of 4.3 msec. The mean T2 relaxation time of the methylene resonance was 31.4 msec (M{sub 0}, 3.7±0.3), with a standard deviation of 1.8 msec. The T2 relaxation times of methylene protons were higher in normal-chow diet rats than in HF rats (p<0.05), and the extrapolated M{sub 0} values were higher in HF rats than in NC rats (p<0.005). The excellent linear fit with R{sup 2}>0.9971 and R{sup 2}>0.9987 indicates T2 relaxation decay curves with mono-exponential function. Conclusion: In in vivo, a sufficient spectral resolution and a sufficiently high signal-to-noise ratio (SNR) can be achieved, so that the data measured over short TE values can be extrapolated back to TE = 0 to produce better estimates of the relative weights of the spectral components. In the short term, treating the effective decay rate as exponential is an adequate approximation.

  1. Heteronuclear relaxation in time-dependent spin systems: 15N-T1ρ dispersion during adiabatic fast passage

    International Nuclear Information System (INIS)

    Konrat, Robert; Tollinger, Martin

    1999-01-01

    A novel NMR experiment comprising adiabatic fast passage techniques for the measurement of heteronuclear self-relaxation rates in fully 15N-enriched proteins is described. Heteronuclear self-relaxation is monitored by performing adiabatic fast passage (AFP) experiments at variable adiabaticity (e.g., variation of RF spin-lock field intensity). The experiment encompasses gradient- selection and sensitivity-enhancement. It is shown that transverse relaxation rates derived with this method are in good agreement with the ones measured by the classical Carr-Purcell-Meiboom-Gill (CPMG) sequences. An application of this method to the study of the carboxyl-terminal LIM domain of quail cysteine and glycine-rich protein qCRP2(LIM2) is presented

  2. Characterization of structural relaxation in inorganic glasses using length dilatometry

    Science.gov (United States)

    Koontz, Erick

    characterization technique is comprised of three main components: experimental measurements, fitting of configurational length change, and description of glass behavior by analysis of fitting parameters. N-BK7 optical glass from Schott was used as the proof of concept glass but the main scientific interest was in three chalcogenide glasses: As40Se 60, As20Se80, and Ge17.9As19.7 Se62.4. The dilatometric experiments were carried out using a thermomechanical analyzer (TMA) on glass sample that were synthesized by the author, in all cases except N-BK7. Isothermal structural relaxation measurements were done on (12 mm tall x 3 mm x 3 mm) beams placed vertically in the TMA. The samples were equilibrated at a starting temperature (T 0) until structural equilibrium was reached then a temperature down step was initiated to the final temperature (T 1) and held isothermally until relaxation concluded. The configurational aspect of length relaxation, and therefore volume relaxation was extracted and fit with a Prony series. The Prony series parameters indicated a number of relaxation events occurring within the glass on timescales typically an order of magnitude apart in time. The data analysis showed as many as 4 discrete relaxation times at lower temperatures. The number of discrete relaxation decreased as the temperature increased until just one single relaxation was left in the temperature range just at or above Tg. In the case of N-BK7 these trends were utilized to construct a simple model that could be applied to glass manufacturing in the areas of annealing or PGM. A future development of a rather simple finite element model (FEM) would easily be able to use this model to predict the exponential-like, temperature and time dependent relaxation behaviors of the glass. The predictive model was not extended to the chalcogenide glass studied here, but could easily be applied to them in the future. The relaxation time trends versus temperature showed a definite region of transition between a

  3. Objective measurement of minimal fat in normal skeletal muscles of healthy children using T2 relaxation time mapping (T2 maps) and MR spectroscopy.

    Science.gov (United States)

    Kim, Hee Kyung; Serai, Suraj; Merrow, Arnold C; Wang, Lily; Horn, Paul S; Laor, Tal

    2014-02-01

    Various skeletal muscle diseases result in fatty infiltration, making it important to develop noninvasive biomarkers to objectively measure muscular fat. We compared T2 relaxation time mapping (T2 maps) and magnetic resonance spectroscopy (MRS) with physical characteristics previously correlated with intramuscular fat to validate T2 maps and MRS as objective measures of skeletal muscle fat. We evaluated gluteus maximus muscles in 30 healthy boys (ages 5-19 years) at 3 T with T1-weighted images, T2-W images with fat saturation, T2 maps with and without fat saturation, and MR spectroscopy. We calculated body surface area (BSA), body mass index (BMI) and BMI percentile (BMI %). We performed fat and inflammation grading on T1-W imaging and fat-saturated T2-W imaging, respectively. Mean T2 values from T2 maps with fat saturation were subtracted from T2 maps without fat saturation to determine T2 fat values. We obtained lipid-to-water ratios by MR spectroscopy. Pearson correlation was used to assess relationships between BSA, BMI, BMI %, T2 fat values, and lipid-to-water ratios for each boy. Twenty-four boys completed all exams; 21 showed minimal and 3 showed no fatty infiltration. None showed muscle inflammation. There was correlation between BSA, BMI, and BMI %, and T2 fat values (P values and lipid-to-water ratios (P skeletal muscles, even in microscopic amounts, and validate each other. Both techniques might enable detection of minimal pathological fatty infiltration in children with skeletal muscle disorders.

  4. The advantage of high relaxivity contrast agents in brain perfusion

    International Nuclear Information System (INIS)

    Cotton, F.; Hermier, M.

    2006-01-01

    Accurate MRI characterization of brain lesions is critical for planning therapeutic strategy, assessing prognosis and monitoring response to therapy. Conventional MRI with gadolinium-based contrast agents is useful for the evaluation of brain lesions, but this approach primarily depicts areas of disruption of the blood-brain barrier (BBB) rather than tissue perfusion. Advanced MR imaging techniques such as dynamic contrast agent-enhanced perfusion MRI provide physiological information that complements the anatomic data available from conventional MRI. We evaluated brain perfusion imaging with gadobenate dimeglumine (Gd-BOPTA, MultiHance; Bracco Imaging, Milan, Italy). The contrast-enhanced perfusion technique was performed on a Philips Intera 1.5-T MR system. The technique used to obtain perfusion images was dynamic susceptibility contrast-enhanced MRI, which is highly sensitive to T2* changes. Combined with PRESTO perfusion imaging, SENSE is applied to double the temporal resolution, thereby improving the signal intensity curve fit and, accordingly, the accuracy of the derived parametric images. MultiHance is the first gadolinium MR contrast agent with significantly higher T1 and T2 relaxivities than conventional MR contrast agents. The higher T1 relaxivity, and therefore better contrast-enhanced T1-weighted imaging, leads to significantly improved detection of BBB breakdown and hence improved brain tumor conspicuity and delineation. The higher T2 relaxivity allows high-quality T2*-weighted perfusion MRI and the derivation of good quality relative cerebral blood volume (rCBV) maps. We determined the value of MultiHance for enhanced T2*-weighted perfusion imaging of histologically proven (by surgery or stereotaxic biopsy) intraaxial brain tumors (n=80), multiple sclerosis lesions (n=10), abscesses (n=4), neurolupus (n=15) and stroke (n=16). All the procedures carried out were safe and no adverse events occurred. The acquired perfusion images were of good quality in

  5. Electron paramagnetic relaxation studies of free radicals in. gamma. -irradiated DNA

    Energy Technology Data Exchange (ETDEWEB)

    Kuwabara, M; Yoshi, G [Hokkaido Univ., Sapporo (Japan)

    1980-01-01

    Using the continuous microwave power saturation method the T/sub 1/ spin-lattice relaxation time and T/sub 2/ spin-spin relaxation time for DNA radicals (measured at 297/sup 0/K) are reported. Identical experiments carried out on thymidine-5'-monophosphate sodium salt (TMP) and deoxycytidine-5'-monophosphate sodium salt (dCMP) are also reported. Irradiated DNA produces TMP radicals on the base moiety and dCMP radicals on the sugar moiety. Comparing the relaxation times of DNA with those of TMP and dCMP provided a reliable analysis of the nature of DNA radicals.

  6. T2-mapping of the sacroiliac joints at 1.5 Tesla: a feasibility and reproducibility study.

    Science.gov (United States)

    Albano, Domenico; Chianca, Vito; Cuocolo, Renato; Bignone, Rodolfo; Ciccia, Francesco; Sconfienza, Luca Maria; Midiri, Massimo; Brunetti, Arturo; Lagalla, Roberto; Galia, Massimo

    2018-04-20

    To evaluate the reproducibility of T2 relaxation time measurements of the sacroiliac joints at 1.5 T. Healthy volunteers underwent an oblique axial multislice multiecho spin-echo sequence of the sacroiliac joints at 1.5 T. Regions of interest were manually drawn using a dedicated software by two musculoskeletal radiologists to include the cartilaginous part of the sacroiliac joints. A senior radiologist performed the measurement twice, while a resident measured once. Intra- and inter-observer reproducibility was tested using the Bland-Altman method. Association between sex and T2 relaxation times was tested using the Mann-Whitney U test. Correlation between T2 relaxation times and body mass index (BMI) was tested using the Spearman's rho. Eighty sacroiliac joints of 40 subjects (mean age: 28 ± 4.8 years, range: 20-43; mean BMI: 23.3 ± 3.1, range: 18.9-30) were imaged. The mean T2 values obtained by the senior radiologist in the first series of measurements were 42 ± 4.4 ms, whereas in the second series were 40.7 ± 4.5 ms. The mean T2 values obtained by the radiology resident were 41.1 ± 4.2 ms. Intra-observer reproducibility was 88% (coefficient of repeatability = 3.8; bias = 1.28; p sacroiliac joints seems to be highly reproducible at 1.5 T. Further studies could investigate the potential clinical application of this tool in the sacroiliac joints.

  7. Relaxation dynamics of the conductive processes for PbNb2O6 ferroelectric ceramics in the frequency and time domain

    International Nuclear Information System (INIS)

    Gonzalez, R L; Leyet, Y; Guerrero, F; Guerra, J de Los S; Venet, M; Eiras, J A

    2007-01-01

    The relaxation dynamics of the conductive process present in PbNb 2 O 6 piezoelectric ceramics was investigated. A relaxation function in the time domain, Φ(t), was found from the frequency dependence of the dielectric modulus (imaginary component, M'') by using a relaxation function in the frequency domain, F*(ω). The best relaxation function, F*(ω), was found to be a Cole-Cole distribution function, in which relaxation characteristic parameters, such as α and τ CC , are involved. On the other hand, the relaxation function, Φ(t), obtained by the time domain method, was found to be a Kohlrausch-Williams-Watts (KWW) function type. The thermal evolution of the characteristics parameters of the KWW function (β and τ*) was analysed. The values of the activation energy (E a ), obtained in the whole investigated temperature interval, suggest the existence of a relaxation mechanism (a conductive process), which may be interpreted by an ion hopping between neighbouring sites within the crystalline lattice. The results are corroborated with the formalism of the AC conductivity

  8. T1 value of hyperplastic and hypoplastic bone marrow

    International Nuclear Information System (INIS)

    Asai, Sae; Yoshida, Hideo; Yoshikawa, Hiroki; Yashiro, Naofumi; Iio, Masahiro; Takaku, Fumimaro

    1985-01-01

    Magnetic resonance (MR) images of the bone marrow of 18 patients (11 normal control, 4 aplastic anemia, 2 chronic myelocytic leukemia, 1 polycythemia vera) were discussed. MR imager had 0.15T registive system. Sagittal section of the body was obtained with inversion recovery (TR1,000, 1,600/TI 350, 450/TE 13, 40 msec) and saturation recovery (TR 1,000, 2,000/TE 13,40 msec) sequences. T 1 relaxation time was calculated from those images. T 1 value of the thoracic and lumbar vertebral bone marrow which contains red marrow even in elderly patients was measured. The results were as follows: 1) T 1 values of chronic myelocytic leukemia (CML) and polycythemia vera were longer than that of normal. 2) T 1 values of four aplastic anemia were all shorter than normal. CML and polycythemia vera can be called myeloproliferative disease and their bone marrows are hyperplastic, which may explain elongated T 1 . The bone marrow of aplasticanemia is hypoplastic and shows fatty change which may have decreased T 1 . Our results suggest T 1 value of bone marrow is useful to evaluate hematological disorders. (author)

  9. Nuclear relaxation and critical fluctuations in membranes containing cholesterol

    Science.gov (United States)

    McConnell, Harden

    2009-04-01

    Nuclear resonance frequencies in bilayer membranes depend on lipid composition. Our calculations describe the combined effects of composition fluctuations and diffusion on nuclear relaxation near a miscibility critical point. Both tracer and gradient diffusion are included. The calculations involve correlation functions and a correlation length ξ =ξ0T/(T -Tc), where T -Tc is temperature above the critical temperature and ξ0 is a parameter of molecular length. Several correlation functions are examined, each of which is related in some degree to the Ising model correlation function. These correlation functions are used in the calculation of transverse deuterium relaxation rates in magic angle spinning and quadrupole echo experiments. The calculations are compared with experiments that report maxima in deuterium and proton nuclear relaxation rates at the critical temperature [Veatch et al., Proc. Nat. Acad. Sci. U.S.A. 104, 17650 (2007)]. One Ising-model-related correlation function yields a maximum 1/T2 relaxation rate at the critical temperature for both magic angle spinning and quadrupole echo experiments. The calculated rates at the critical temperature are close to the experimental rates. The rate maxima involve relatively rapid tracer diffusion in a static composition gradient over distances of up to 10-100 nm.

  10. Irradiation properties of T0 chopper components

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, Shinichi, E-mail: shinichi.itoh@kek.jp [Neutron Science Division, Institute of Materials Structure Science, High Energy Accelerator Research Organization, Tsukuba 305-0801 (Japan); Ueno, Kenji; Ohkubo, Ryuji [Mechanical Engineering Center, Applied Research Laboratory, High Energy Accelerator Research Organization, Tsukuba 305-0801 (Japan); Sagehashi, Hidenori [Neutron Science Division, Institute of Materials Structure Science, High Energy Accelerator Research Organization, Tsukuba 305-0801 (Japan); Funahashi, Yoshisato [Mechanical Engineering Center, Applied Research Laboratory, High Energy Accelerator Research Organization, Tsukuba 305-0801 (Japan); Yokoo, Tetsuya [Neutron Science Division, Institute of Materials Structure Science, High Energy Accelerator Research Organization, Tsukuba 305-0801 (Japan)

    2011-10-21

    We investigated the irradiation properties of the components of a T0 chopper. The organic materials in the rotor bearing grease, the magnetic fluids in seals, and the rubber in the timing belt, as well as the semiconductor materials in the rotation sensor and motor encoder, were all irradiated with high-energy {gamma}-rays up to 100 kGy. No significant damage that shortens the lifetime of a T0 chopper was observed for the mechanical components. However, the semiconductor components were damaged by the irradiation. For the rotation sensor system detecting the rotor phase, the signal from a marker on the rotor shaft was transmitted outside the shielding by an optical fiber with radiation-proofing and the electrical circuits were removed from the beamline shielding. The lifetime of the motor encoder possibly meets the requirement for the maintenance period of the T0 chopper.

  11. Momentum constraint relaxation

    International Nuclear Information System (INIS)

    Marronetti, Pedro

    2006-01-01

    Full relativistic simulations in three dimensions invariably develop runaway modes that grow exponentially and are accompanied by violations of the Hamiltonian and momentum constraints. Recently, we introduced a numerical method (Hamiltonian relaxation) that greatly reduces the Hamiltonian constraint violation and helps improve the quality of the numerical model. We present here a method that controls the violation of the momentum constraint. The method is based on the addition of a longitudinal component to the traceless extrinsic curvature A ij -tilde, generated by a vector potential w i , as outlined by York. The components of w i are relaxed to solve approximately the momentum constraint equations, slowly pushing the evolution towards the space of solutions of the constraint equations. We test this method with simulations of binary neutron stars in circular orbits and show that it effectively controls the growth of the aforementioned violations. We also show that a full numerical enforcement of the constraints, as opposed to the gentle correction of the momentum relaxation scheme, results in the development of instabilities that stop the runs shortly

  12. T20 measurements for 1H(d searrow,γ)3He and the P-wave component of the nucleon-nucleon force

    International Nuclear Information System (INIS)

    Schmid, G.J.; Chasteler, R.M.; Weller, H.R.; Tilley, D.R.; Fonseca, A.C.; Lehman, D.R.

    1996-01-01

    Measurements of T 20 (θ lab =90 degree) for 1 H(d searrow,γ) 3 He, in the energy range E d (lab)=12.7 endash 19.8 MeV, have been compared with the results of new exact three-body Faddeev calculations using the Paris and Bonn-A nucleon-nucleon (NN) potentials. This comparison indicates a strong sensitivity of the T 20 observable to the p-wave part of the NN force. In particular, we find that the 3 P 1 component of the P-wave interaction is the dominant P-wave term affecting the value of T 20 (θ lab =90 degree) at these energies. This contrasts with the results of polarized N-D scattering studies where the 3 P 0 component has been found to dominate. cents 1996 The American Physical Society

  13. Nuclear spin relaxation due to chemical shift anisotropy of gas-phase 129Xe.

    Science.gov (United States)

    Hanni, Matti; Lantto, Perttu; Vaara, Juha

    2011-08-14

    Nuclear spin relaxation provides detailed dynamical information on molecular systems and materials. Here, first-principles modeling of the chemical shift anisotropy (CSA) relaxation time for the prototypic monoatomic (129)Xe gas is carried out, both complementing and predicting the results of NMR measurements. Our approach is based on molecular dynamics simulations combined with pre-parametrized ab initio binary nuclear shielding tensors, an "NMR force field". By using the Redfield relaxation formalism, the simulated CSA time correlation functions lead to spectral density functions that, for the first time, quantitatively determine the experimental spin-lattice relaxation times T(1). The quality requirements on both the Xe-Xe interaction potential and binary shielding tensor are investigated in the context of CSA T(1). Persistent dimers Xe(2) are found to be responsible for the CSA relaxation mechanism in the low-density limit of the gas, completely in line with the earlier experimental findings.

  14. Electron spin-lattice relaxation in fractals

    International Nuclear Information System (INIS)

    Shrivastava, K.N.

    1986-08-01

    We have developed the theory of the spin-fracton interaction for paramagnetic ions in fractal structures. The interaction is exponentially damped by the self-similarity length of the fractal and by the range dimensionality d Φ . The relaxation time of the spin due to the absorption and emission of the fracton has been calculated for a general dimensionality called the Raman dimensionality d R , which for the fractons differs from the Hausdorff (fractal) dimensionality, D, as well as from the Euclidean dimensionality, d. The exponent of the energy level separation in the relaxation rate varies with d R d Φ /D. We have calculated the spin relaxation rate due to a new type of Raman process in which one fracton is absorbed to affect a spin transition from one electronic level to another and later another fracton is emitted along with a spin transition such that the difference in the energies of the two fractons is equal to the electronic energy level separation. The temperature and the dimensionality dependence of such a process has been found in several approximations. In one of the approximations where the van Vleck relaxation rate for a spin in a crystal is known to vary with temperature as T 9 , our calculated variation for fractals turns out to be T 6.6 , whereas the experimental value for Fe 3+ in frozen solutions of myoglobin azide is T 6.3 . Since we used d R =4/3 and the fracton range dimensionality d Φ =D/1.8, we expect to measure the dimensionalities of the problem by measuring the temperature dependence of the relaxation times. We have also calculated the shift of the paramagnetic resonance transition for a spin in a fractal for general dimensionalities. (author)

  15. Relaxation of coupled nuclear spin systems

    International Nuclear Information System (INIS)

    Koenigsberger, E.

    1985-05-01

    The subject of the present work is the relaxation behaviour of scalarly coupled spin-1/2 systems. In the theoretical part the semiclassical Redfield equations are used. Dipolar (D), Chemical Shift Anisotropy (CSA) and Random Field (RF) interactions are considered as relaxation mechanisms. Cross correlations of dipolar interactions of different nuclei pairs and those between the D and the CSA mechanisms are important. The model of anisotropic molecular rotational relaxation and the extreme narrowing approximation are used to obtain the spectral density functions. The longitudinal relaxation data are analyzed into normal modes following Werbelow and Grant. The time evolution of normal modes is derived for the AX system with D-CSA cross terms. In the experimental part the hypothesis of dimerization in the cinnamic acid and the methyl cinnamate - AMX systems with DD cross terms - is corroborated by T 1 -time measurements and a calculation of the diffusion constants. In pentachlorobenzene - an AX system - taking into account of D-CSA cross terms enables the complete determination of movements anosotropy and the determination of the sign of the indirect coupling constant 1 Jsub(CH). (G.Q.)

  16. Meniscal T1rho and T2 measured with 3.0T MRI increases directly after running a marathon

    Energy Technology Data Exchange (ETDEWEB)

    Stehling, Christoph [University of California, Musculoskeletal and Quantitative Imaging Group (MQIR), Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); University of Muenster, Department of Clinical Radiology, Muenster (Germany); Luke, Anthony [University of California, Department of Orthopedic Surgery, San Francisco, CA (United States); Stahl, Robert [University of California, Musculoskeletal and Quantitative Imaging Group (MQIR), Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); Ludwig Maximilians University of Munich, Department of Clinical Radiology, Munich (Germany); Baum, Thomas; Joseph, Gabby; Pan, Judong; Link, Thomas M. [University of California, Musculoskeletal and Quantitative Imaging Group (MQIR), Department of Radiology and Biomedical Imaging, San Francisco, CA (United States)

    2011-06-15

    To prospectively evaluate changes in T1rho and T2 relaxation time in the meniscus using 3.0 T MRI in asymptomatic knees of marathon runners and to compare these findings with those of age-matched healthy subjects. Thirteen marathon runners underwent 3.0 T MRI including T1rho and T2 mapping sequences before, 48-72 h after, and 3 months after competition. Ten controls were examined at baseline and after 3 months. All images were analyzed by two musculoskeletal radiologists identifying and grading cartilage, meniscal, ligamentous. and other knee abnormalities with WORMS scores. Meniscal segmentation was performed to generate T1rho and T2 maps in six compartments. No differences in morphological knee abnormalities were found before and after the marathon. However, all marathon runners showed a significant increase in T1rho and T2 values after competition in all meniscus compartments (p < 0.0001), which may indicate changes in the biochemical composition of meniscal tissue. While T2 values decreased after 3 months T1rho values remained at a high level, indicating persisting changes in the meniscal matrix composition after a marathon. T2 values in menisci have the potential to be used as biomarkers for identifying reversible meniscus matrix changes indicating potential tissue damage. T1rho values need further study, but may be a valuable marker for diagnosing early, degenerative changes in the menisci following exercise. (orig.)

  17. Earth's magnetic field enabled scalar coupling relaxation of 13C nuclei bound to fast-relaxing quadrupolar 14N in amide groups.

    Science.gov (United States)

    Chiavazza, Enrico; Kubala, Eugen; Gringeri, Concetta V; Düwel, Stephan; Durst, Markus; Schulte, Rolf F; Menzel, Marion I

    2013-02-01

    Scalar coupling relaxation, which is usually only associated with closely resonant nuclei (e.g., (79)Br-(13)C), can be a very effective relaxation mechanism. While working on hyperpolarized [5-(13)C]glutamine, fast liquid-state polarization decay during transfer to the MRI scanner was observed. This behavior could hypothetically be explained by substantial T(1) shortening due to a scalar coupling contribution (type II) to the relaxation caused by the fast-relaxing quadrupolar (14)N adjacent to the (13)C nucleus in the amide group. This contribution is only effective in low magnetic fields (i.e., less than 800 μT) and prevents the use of molecules bearing the (13)C-amide group as hyperpolarized MRS/MRI probes. In the present work, this hypothesis is explored both theoretically and experimentally. The results show that high hyperpolarization levels can be retained using either a (15)N-labeled amide or by applying a magnetic field during transfer of the sample from the polarizer to the MRI scanner. Copyright © 2012 Elsevier Inc. All rights reserved.

  18. Relaxation parameter estimation and comparison of NLS and LLS methods for DCE MRI in the cervix

    DEFF Research Database (Denmark)

    Mariager, Christian; Kallehauge, Jesper; Tanderup, Kari

    Dynamic Contrast Enhanced (DCE) MRI is a promising tool for tumor treatment planning. However, prior knowledge of the T1 value within each tumor voxel is needed to utilize this technique. Therefore, a T1 relaxation measurement is performed before the DCE experiment to establish a baseline, before...... any injection of contrast agent. This T1 relaxation measurement is often performed using a variable flip angle spoiled gradient recalled echo (SPGR) sequence. T1 can then be estimated using either a linear least squares (LLS) or a non-linear least squares (NLS) fitting algorithm....

  19. Postearthquake relaxation after the 2004 M6 Parkfield, California, earthquake and rate-and-state friction

    Science.gov (United States)

    Savage, J.C.; Langbein, J.

    2008-01-01

    An unusually complete set of measurements (including rapid rate GPS over the first 10 days) of postseismic deformation is available at 12 continuous GPS stations located close to the epicenter of the 2004 M6.0 Parkfield earthquake. The principal component modes for the relaxation of the ensemble of those 12 GPS stations were determined. The first mode alone furnishes an adequate approximation to the data. Thus, the relaxation at all stations can be represented by the product of a common temporal function and distinct amplitudes for each component (north or east) of relaxation at each station. The distribution in space of the amplitudes indicates that the relaxation is dominantly strike slip. The temporal function, which spans times from about 5 min to 900 days postearthquake, can be fit by a superposition of three creep terms, each of the form ??l loge(1 + t/??l), with characteristic times ??, = 4.06, 0.11, and 0.0001 days. It seems likely that what is actually involved is a broad spectrum of characteristic times, the individual components of which arise from afterslip on different fault patches. Perfettini and Avouac (2004) have shown that an individual creep term can be explained by the spring-slider model with rate-dependent (no state variable) friction. The observed temporal function can also be explained using a single spring-slider model (i.e., single fault patch) that includes rate-and-state-dependent friction, a single-state variable, and either of the two commonly used (aging and slip) state evolution laws. In the latter fits, the rate-and-state friction parameter b is negative.

  20. Brownian rotational relaxation and power absorption in magnetite nanoparticles

    International Nuclear Information System (INIS)

    Goya, G.F.; Fernandez-Pacheco, R.; Arruebo, M.; Cassinelli, N.; Ibarra, M.R.

    2007-01-01

    We present a study of the power absorption efficiency in several magnetite-based colloids, to asses their potential as magnetic inductive hyperthermia (MIH) agents. Relaxation times τ were measured through the imaginary susceptibility component χ ' '(T), and analyzed within Debye's theory of dipolar fluid. The results indicated Brownian rotational relaxation and allowed to calculate the hydrodynamic radius close to the values obtained from photon correlation. The study of the colloid performances as power absorbers showed no detectable increase of temperature for dextran-coated Fe 3 O 4 nanoparticles, whereas a second Fe 3 O 4 -based dispersion of similar concentration could be heated up to 12K after 30min under similar experimental conditions. The different power absorption efficiencies are discussed in terms of the magnetic structure of the nanoparticles

  1. Relaxation of polarized nuclei in superconducting rhodium

    DEFF Research Database (Denmark)

    Knuuttila, T.A.; Tuoriniemi, J.T.; Lefmann, K.

    2000-01-01

    Nuclear spin lattice relaxation rates were measured in normal and superconducting (sc) rhodium with nuclear polarizations up to p = 0.55. This was sufficient to influence the sc state of Rh, whose T, and B-c, are exceptionally low. Because B-c ... is unchanged, the nuclear spin entropy was fully sustained across the sc transition. The relaxation in the sc state was slower at all temperatures without the coherence enhancement close to T-c. Nonzero nuclear polarization strongly reduced the difference between the relaxation rates in the sc and normal...

  2. Corroborative evidences of TV γ -scaling of the α-relaxation originating from the primitive relaxation/JG β relaxation

    Science.gov (United States)

    Ngai, K. L.; Paluch, M.

    2017-12-01

    Successful thermodynamic scaling of the structural alpha-relaxation time or transport coefficients of glass-forming liquids determined at various temperatures T and pressures P means the data conform to a single function of the product variable TVgamma, where V is the specific volume and gamma is a material specific constant. In the past two decades we have witnessed successful TVgamma-scaling in many molecular, polymeric, and even metallic glass-formers, and gamma is related to the slope of the repulsive part of the intermolecular potential. The advances made indicate TVgamma-scaling is an important aspect of the dynamic and thermodynamic properties of glass-formers. In this paper we show the origin of TVgamma-scaling is not from the structural alpha-relaxation time. Instead it comes from its precursor, the Johari-Goldstein beta-relaxation or the primitive relaxation of the Coupling Model and their relaxation times or tau_0 respectively. It is remarkable that all relaxation times are functions of TVgamma with the same gama, as well as the fractional exponent of the Kohlrausch correlation function of the structural alpha-relaxation. We arrive at this conclusion convincingly based on corroborative evidences from a number of experiments and molecular dynamics simulations performed on a wide variety of glass-formers and in conjunction with consistency with the predictions of the Coupling Model.

  3. Evaluation of the Delta-T SPN1 radiometer for the measurement of solar irradiance components

    Science.gov (United States)

    Estelles, Victor; Serrano, David; Segura, Sara; Wood, John; Webb, Nick; Utrillas, Maria Pilar

    2016-04-01

    In this study we analyse the performance of an SPN1 radiometer built by Delta-T Devices Ltd. to retrieve global solar irradiance at ground and its components (diffuse, direct) in comparison with measurements from two Kipp&Zonen CMP21 radiometers and a Kipp&Zonen CHP1 pirheliometer, mounted on an active Solys-2 suntracker at the Burjassot site (Valencia, Spain) using data acquired every minute during years 2013 - 2015. The measurement site is close to sea level (60 m a.s.l.), near the Mediterranean coast (10 km) and within the metropolitan area of Valencia City (over 1.500.000 inhabitants). The SPN1 is an inexpensive and versatile instrument for the measurement of the three components of the solar radiation without any mobile part and without any need to azimuthally align the instrument to track the sun (http://www.delta-t.co.uk). The three components of the solar radiation are estimated from a combination of measurements performed by 7 different miniature thermopiles. The SPN1 pyranometer measures the irradiance between 400 and 2700 nm, and the nominal uncertainty for the individual readings is about 8% ± 10 W/m2 (5% for the daily averages). The pyranometer Kipp&Zonen CMP21 model is a secondary standard for the measurement of broadband solar global irradiance in horizontal planes. Two ventilated CMP21 are used for the measurement of the global and diffuse irradiances. The expected total daily uncertainty of the radiometer is estimated to be 2%. The pirheliometer Kipp&Zonen CHP1 is designed for the measurement of the direct irradiance. The principles are similar to the CMP21 pyranometer. The results of the comparison show that the global irradiance from the SPN1 compares very well with the CMP21, with absolute RMSD and MBD differences below the combined uncertainties (15 W/m2 and -5.4 W/m2, respectively; relative RMSD of 3.1%). Both datasets are very well correlated, with a correlation coefficient higher than 0.997 and a slope and intercept very close to 1 and 0

  4. Gradient-induced longitudinal relaxation of hyperpolarized noble gases in the fringe fields of superconducting magnets used for magnetic resonance.

    Science.gov (United States)

    Zheng, Wangzhi; Cleveland, Zackary I; Möller, Harald E; Driehuys, Bastiaan

    2011-02-01

    When hyperpolarized noble gases are brought into the bore of a superconducting magnet for magnetic resonance imaging (MRI) or spectroscopy studies, the gases must pass through substantial field gradients, which can cause rapid longitudinal relaxation. In this communication, we present a means of calculating this spatially dependent relaxation rate in the fringe field of typical magnets. We then compare these predictions to experimental measurements of (3)He relaxation at various positions near a medium-bore 2-T small animal MRI system. The calculated and measured relaxation rates on the central axis of the magnet agree well and show a maximum (3)He relaxation rate of 3.83×10(-3) s(-1) (T(1)=4.4 min) at a distance of 47 cm from the magnet isocenter. We also show that if this magnet were self-shielded, its minimum T(1) would drop to 1.2 min. In contrast, a typical self-shielded 1.5-T clinical MRI scanner will induce a minimum on-axis T(1) of 12 min. Additionally, we show that the cylindrically symmetric fields of these magnets enable gradient-induced relaxation to be calculated using only knowledge of the on-axis longitudinal field, which can either be measured directly or calculated from a simple field model. Thus, while most MRI magnets employ complex and proprietary current configurations, we show that their fringe fields and the resulting gradient-induced relaxation are well approximated by simple solenoid models. Finally, our modeling also demonstrates that relaxation rates can increase by nearly an order of magnitude at radial distances equivalent to the solenoid radius. Copyright © 2010 Elsevier Inc. All rights reserved.

  5. Lactate and T2 measurements of synovial aspirates at 1.5 T: differentiation of septic from non-septic arthritis

    International Nuclear Information System (INIS)

    Wiener, Edzard; Zanetti, Marco; Hodler, Juerg; Pfirrmann, Christian W.A.

    2008-01-01

    The aim of this study was to differentiate septic from non-septic arthritis by measuring lactate concentration with 1 H magnetic resonance spectroscopy (HMRS) and by estimating total protein content with the assessment of T 2 values. In 30 patients with acute arthritis, synovial fluid was aspirated. Lactate concentrations were analyzed with single voxel HMRS at 1.5 T. T 2 relaxation times were mapped with a multi-spin echo sequence. All samples underwent microbiological testing and routine laboratory analysis to quantify lactate concentration and total protein content. Values obtained in septic and non-septic arthritis were compared with a Mann-Whitney U test. Synovial fluid from patients with septic arthritis (n=10) had higher concentrations of lactate (11.4 ± 4.0 mmol/L) and higher total protein content (51.8 ± 10.7 g/L) than fluid obtained in non-septic arthritis (n=20; 5.2±1.1 mmol/L and 40.4±6.9 g/L, respectively, p 2 relaxation times (as an indicator of total protein content) were moderately correlated to laboratory-confirmed lactate concentration (r 2 =0.71) and total protein content (r 2 =0.73). Markedly increased lactate concentrations (>6 mmol/L) in combination with low T 2 values ( 2 may be of value in the differentiation of septic from non-septic arthritis. (orig.)

  6. Influence of dietary components on regulatory T cells

    DEFF Research Database (Denmark)

    Navikas, Shohreh; Teimer, Roman; Bockermann, Robert

    2011-01-01

    It is no longer a myth that a balanced diet is fundamental for general health. Common dietary components including vitamins A and D, omega-3 and probiotics are now widely accepted to be essential to protect against many diseases with an inflammatory nature. On the other hand, high fat diets...... components on diseases in which Tregs play a seminal role will be discussed. Among chronic diseases where dietary factors could have a direct influence via modulation of Tregs homeostasis and functions, we will review chronic tissue-specific autoimmune and inflammatory conditions such as IBD, T1D, MS, RA...

  7. Relaxation along a fictitious field (RAFF and Z-spectroscopy using alternating-phase irradiation (ZAPI in permanent focal cerebral ischemia in rat.

    Directory of Open Access Journals (Sweden)

    Kimmo T Jokivarsi

    Full Text Available Cerebral ischemia alters the molecular dynamics and content of water in brain tissue, which is reflected in NMR relaxation, diffusion and magnetization transfer (MT parameters. In this study, the behavior of two new MRI contrasts, Relaxation Along a Fictitious Field (RAFF and Z-spectroscopy using Alternating-Phase Irradiation (ZAPI, were quantified together with conventional relaxation parameters (T1, T2 and T1ρ and MT ratios in acute cerebral ischemia in rat. The right middle cerebral artery was permanently occluded and quantitative MRI data was acquired sequentially for the above parameters for up to 6 hours. The following conclusions were drawn: 1 Time-dependent changes in RAFF and T1ρ relaxation are not coupled to those in MT. 2 RAFF relaxation evolves more like transverse, rather than longitudinal relaxation. 3 MT measured with ZAPI is less sensitive to ischemia than conventional MT. 4 ZAPI data suggest alterations in the T2 distribution of macromolecules in acute cerebral ischemia. It was shown that both RAFF and ZAPI provide complementary MRI information from acute ischemic brain tissue. The presented multiparametric MRI data may aid in the assessment of brain tissue status early in ischemic stroke.

  8. Characterizing the microstructural basis of "unidentified bright objects" in neurofibromatosis type 1: A combined in vivo multicomponent T2 relaxation and multi-shell diffusion MRI analysis.

    Science.gov (United States)

    Billiet, Thibo; Mädler, Burkhard; D'Arco, Felice; Peeters, Ronald; Deprez, Sabine; Plasschaert, Ellen; Leemans, Alexander; Zhang, Hui; den Bergh, Bea Van; Vandenbulcke, Mathieu; Legius, Eric; Sunaert, Stefan; Emsell, Louise

    2014-01-01

    The histopathological basis of "unidentified bright objects" (UBOs) (hyperintense regions seen on T2-weighted magnetic resonance (MR) brain scans in neurofibromatosis-1 (NF1)) remains unclear. New in vivo MRI-based techniques (multi-exponential T2 relaxation (MET2) and diffusion MR imaging (dMRI)) provide measures relating to microstructural change. We combined these methods and present previously unreported data on in vivo UBO microstructure in NF1. 3-Tesla dMRI data were acquired on 17 NF1 patients, covering 30 white matter UBOs. Diffusion tensor, kurtosis and neurite orientation and dispersion density imaging parameters were calculated within UBO sites and in contralateral normal appearing white matter (cNAWM). Analysis of MET2 parameters was performed on 24 UBO-cNAWM pairs. No significant alterations in the myelin water fraction and intra- and extracellular (IE) water fraction were found. Mean T2 time of IE water was significantly higher in UBOs. UBOs furthermore showed increased axial, radial and mean diffusivity, and decreased fractional anisotropy, mean kurtosis and neurite density index compared to cNAWM. Neurite orientation dispersion and isotropic fluid fraction were unaltered. Our results suggest that demyelination and axonal degeneration are unlikely to be present in UBOs, which appear to be mainly caused by a shift towards a higher T2-value of the intra- and extracellular water pool. This may arise from altered microstructural compartmentalization, and an increase in 'extracellular-like', intracellular water, possibly due to intramyelinic edema. These findings confirm the added value of combining dMRI and MET2 to characterize the microstructural basis of T2 hyperintensities in vivo.

  9. Determination of Proton Relaxivities of Mn(II, Cu(II and Cr(III added to Solutions of Serum Proteins

    Directory of Open Access Journals (Sweden)

    Ali Yilmaz

    2009-04-01

    Full Text Available Relaxometric studies are still of scientific interest due to their use in medicine and biology. In this study, proton T1 and T2 relaxivities of Mn(II, Cu(II and Cr(III in water were determined in the presence and absence of various proteins (albumin, α-globulin, γ-globulin, lysozyme, fibrinogen. The 1/T1 and 1/T2 in all solutions are linearly proportional to the concentration of the paramagnetic ions. Mn(II has the great influence to alter relaxations in all protein solutions, while Cu(II and Cr(III have a poor influence on the relaxations. In addition, Mn(II and Cu(II are bound to each protein, but Cr(III is not bound to any protein.

  10. Proton T2 Relaxation effect of superparamagnetic iron oxide on fast spin echo sequence. Influence of echo number (even or odd) of effective TE

    International Nuclear Information System (INIS)

    Tsuchihashi, Toshio; Maki, Toshio; Kitagawa, Matsuo; Suzuki, Takeshi; Fujita, Isao

    1999-01-01

    The T 2 relaxation effect of the fast spin echo sequence (FSE) was investigated using superparamagnetic iron oxide (SPIO) particles. When even echoes were used as the effective TE of FSE, the signal intensity ratio [signal intensity of FSE/signal intensity of conventional spin echo sequence (CSE)] of FSE and CSE increased, whereas the T 2 relaxation effect of SPIO with FSE was reduced. However, when odd echoes were used, neither signal intensity changed, and weakening of the T 2 relaxation effect, considered a problem with FSE, was reduced. This phenomenon was not observed when the refocusing flip angle was changed to 30 and 60 degrees. However, it was observed when the refocusing flip angle was 120 and 150 degrees. Thus, this phenomenon can be considered to be related to oscillation in longitudinal magnetization when using the Carr-Purcell-Meiboom-Gill (CPMG) technique. (author)

  11. Water-selective excitation of short T2 species with binomial pulses.

    Science.gov (United States)

    Deligianni, Xeni; Bär, Peter; Scheffler, Klaus; Trattnig, Siegfried; Bieri, Oliver

    2014-09-01

    For imaging of fibrous musculoskeletal components, ultra-short echo time methods are often combined with fat suppression. Due to the increased chemical shift, spectral excitation of water might become a favorable option at ultra-high fields. Thus, this study aims to compare and explore short binomial excitation schemes for spectrally selective imaging of fibrous tissue components with short transverse relaxation time (T2 ). Water selective 1-1-binomial excitation is compared with nonselective imaging using a sub-millisecond spoiled gradient echo technique for in vivo imaging of fibrous tissue at 3T and 7T. Simulations indicate a maximum signal loss from binomial excitation of approximately 30% in the limit of very short T2 (0.1 ms), as compared to nonselective imaging; decreasing rapidly with increasing field strength and increasing T2 , e.g., to 19% at 3T and 10% at 7T for T2 of 1 ms. In agreement with simulations, a binomial phase close to 90° yielded minimum signal loss: approximately 6% at 3T and close to 0% at 7T for menisci, and for ligaments 9% and 13%, respectively. Overall, for imaging of short-lived T2 components, short 1-1 binomial excitation schemes prove to offer marginal signal loss especially at ultra-high fields with overall improved scanning efficiency. Copyright © 2013 Wiley Periodicals, Inc.

  12. T1 value of hyperplastic and hypoplastic bone marrow. Preliminary report

    Energy Technology Data Exchange (ETDEWEB)

    Asai, Sae; Yoshida, Hideo; Yoshikawa, Hiroki; Yashiro, Naofumi; Iio, Masahiro; Takaku, Fumimaro

    1985-03-01

    Magnetic resonance (MR) images of the bone marrow of 18 patients (11 normal control, 4 aplastic anemia, 2 chronic myelocytic leukemia, 1 polycythemia vera) were discussed. MR imager had 0.15T registive system. Sagittal section of the body was obtained with inversion recovery (TR1,000, 1,600/TI 350, 450/TE 13, 40 msec) and saturation recovery (TR 1,000, 2,000/TE 13,40 msec) sequences. T1 relaxation time was calculated from those images. T1 value of the thoracic and lumbar vertebral bone marrow which contains red marrow even in elderly patients was measured. T1 values of chronic myelocytic leukemia (CML) and polycythemia vera were longer than that of normal. T1 values of four aplastic anemia were all shorter than normal. CML and polycythemia vera can be called myeloproliferative disease and their bone marrows are hyperplastic, which may explain elongated T1. The bone marrow of aplasticanemia is hypoplastic and shows fatty change which may have decreased T1. Our results suggest T1 value of bone marrow is useful to evaluate hematological disorders. (author).

  13. QM/MM studies on the excited-state relaxation mechanism of a semisynthetic dTPT3 base.

    Science.gov (United States)

    Guo, Wei-Wei; Zhang, Teng-Shuo; Fang, Wei-Hai; Cui, Ganglong

    2018-02-14

    Semisynthetic alphabets can potentially increase the genetic information stored in DNA through the formation of unusual base pairs. Recent experiments have shown that near-visible-light irradiation of the dTPT3 chromophore could lead to the formation of a reactive triplet state and of singlet oxygen in high quantum yields. However, the detailed excited-state relaxation paths that populate the lowest triplet state are unclear. Herein, we have for the first time employed the QM(MS-CASPT2//CASSCF)/MM method to explore the spectroscopic properties and excited-state relaxation mechanism of the aqueous dTPT3 chromophore. On the basis of the results, we have found that (1) the S 2 ( 1 ππ*) state of dTPT3 is the initially populated excited singlet state upon near-visible light irradiation; and (2) there are two efficient relaxation pathways to populate the lowest triplet state, i.e. T 1 ( 3 ππ*). In the first one, the S 2 ( 1 ππ*) system first decays to the S 1 ( 1 nπ*) state near the S 2 /S 1 conical intersection, which is followed by an efficient S 1T 1 intersystem crossing process at the S 1 /T 1 crossing point; in the second one, an efficient S 2 → T 2 intersystem crossing takes place first, and then, the T 2 ( 3 nπ*) system hops to the T 1 ( 3 ππ*) state through an internal conversion process at the T 2 /T 1 conical intersection. Moreover, an S 2 /S 1 /T 2 intersection region is found to play a vital role in the excited-state relaxation. These new mechanistic insights help in understanding the photophysics and photochemistry of unusual base pairs.

  14. In vivo determination of T1 and T2 in the brain of patients with severe but stable multiple sclerosis

    DEFF Research Database (Denmark)

    Larsson, H B; Frederiksen, J; Kjaer, L

    1988-01-01

    investigated, using a whole-body superconductive MR scanner, operating at 1.5 T. By employing 12-point (or 6-point) partial saturation inversion recovery (PSIR) and 32-echo multiple spin-echo sequences we measured T1 and T2 in MS plaques, white matter, and cortical gray matter. We also focused on the issue......, whether T1 and T2 relaxation processes in fact were monoexponential. T1 and T2 in plaques were found to cover a wide range, which could be explained only by inherent biophysical dissimilarity of the plaques, possibly due to differences in disease activity, edema and gliosis. T1 appeared monoexponential...... in all the plaques, but in seven cases T2 showed biexponential behavior. This was found to be most pronounced near the cerebrospinal fluid of the ventricles, probably caused by partial volume effects or increased free water content. The T2 of apparently normal white matter was significantly longer in MS...

  15. Dielectric and mechanical relaxation in isooctylcyanobiphenyl (8*OCB)

    Energy Technology Data Exchange (ETDEWEB)

    Pawlus, S; Mierzwa, M; Paluch, M; Rzoska, S J [Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Roland, C M, E-mail: michal.mierzwa@us.edu.p [Chemistry Division, Naval Research Laboratory, Code 6120, Washington, DC 20375-5342 (United States)

    2010-06-16

    The dynamics of isooctylcyanobiphenyl (8*OCB) was characterized using dielectric and mechanical spectroscopies. This isomer of the liquid crystalline octylcyanobiphenyl (8OCB) vitrifies during cooling or on application of pressure, exhibiting the typical features of glass-forming liquids: non-Debye relaxation function, non-Arrhenius temperature dependence of the relaxation times, {tau}{sub {alpha}}, a dynamic crossover at T {approx} 1.6T{sub g}. This crossover is evidenced by changes in the behavior of both the peak shape and the temperature dependence of {tau}{sub {alpha}}. The primary relaxation time at the crossover, 2 ns at ambient pressure, is the smallest value reported to date for any molecular liquid or polymer. Interestingly, at all temperatures below this crossover, {tau}{sub {alpha}}and the dc conductivity remain coupled (i.e., conform to the Debye-Stokes-Einstein relation). Two secondary relaxations are observed in the glassy state, one of which is identified as the Johari-Goldstein process. Unlike the case for 8OCB, no liquid crystalline phase could be attained for 8*OCB, demonstrating that relatively small differences in chemical structure can effect substantial changes in the intermolecular potential.

  16. Brownian rotational relaxation and power absorption in magnetite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Goya, G.F. [Institute of Nanoscience of Aragon (INA), University of Zaragoza, 50009 Zaragoza (Spain)]. E-mail: goya@unizar.es; Fernandez-Pacheco, R. [Institute of Nanoscience of Aragon (INA), University of Zaragoza, 50009 Zaragoza (Spain); Arruebo, M. [Institute of Nanoscience of Aragon (INA), University of Zaragoza, 50009 Zaragoza (Spain); Cassinelli, N. [Electronics Division, Bauer and Associates, Buenos Aires (Argentina); Facultad de Ingenieria, UNLP (Argentina); Ibarra, M.R. [Institute of Nanoscience of Aragon (INA), University of Zaragoza, 50009 Zaragoza (Spain)

    2007-09-15

    We present a study of the power absorption efficiency in several magnetite-based colloids, to asses their potential as magnetic inductive hyperthermia (MIH) agents. Relaxation times {tau} were measured through the imaginary susceptibility component {chi}{sup '}'(T), and analyzed within Debye's theory of dipolar fluid. The results indicated Brownian rotational relaxation and allowed to calculate the hydrodynamic radius close to the values obtained from photon correlation. The study of the colloid performances as power absorbers showed no detectable increase of temperature for dextran-coated Fe{sub 3}O{sub 4} nanoparticles, whereas a second Fe{sub 3}O{sub 4}-based dispersion of similar concentration could be heated up to 12K after 30min under similar experimental conditions. The different power absorption efficiencies are discussed in terms of the magnetic structure of the nanoparticles.

  17. Stress relaxation of bi-disperse polystyrene melts

    DEFF Research Database (Denmark)

    Hengeller, Ludovica; Huang, Qian; Dorokhin, Andriy

    2016-01-01

    We present start-up of uniaxial extension followed by stress relaxation experiments of a bi-disperse 50 % by weight blend of 95k and 545k molecular weight polystyrene. We also show, for comparison, stress relaxation measurements of the polystyrene melts with molecular weight 95k and 545k, which...... are the components of the bi-disperse melt. The measurements show three separated relaxation regimes: a fast regime, a transition regime, and a slow regime. In the fast regime, the orientation of the long chains is frozen and the stress relaxation is due to stretch relaxation of the short chains primarily....... Conversely in the slow regime, the long chains have retracted and undergo relaxation of orientation in fully relaxed short chains....

  18. Low-temperature strain ageing in In-Pb alloys under stress relaxation conditions

    International Nuclear Information System (INIS)

    Fomenko, L.S.

    2000-01-01

    The dynamic strain ageing (DSA) of In-Pb (6 and 8 at. % Pb) substitutional solid solution single crystals is studied at temperatures 77-205 K under stress relaxation conditions. The dependences of the stress increment after relaxation connected with DSA on stress relaxation time, stress relaxation rate at the end of the relaxation, temperature, alloy content, flow stress, and strain are determined. It is shown that the DSA kinetic is described by a Harper-type equation with the exponent equal to 1/3 and a low activation energy value (0.3-0.34 eV). This provides a low temperature of the DSA onset (∼ 0.17 T m , where T m is the melt temperature) and is evidence of pipe-mode diffusion. It is supposed that the obstacles to dislocation motion in the crystals studied consist of the groups of solutes, and the strength of the obstacles increases during the DSA due to the pipe diffusion of the solute atoms along the dislocations

  19. Quantitative assessment of the T2 relaxation time of the gluteus muscles in children with Duchenne muscular dystrophy: a comparative study before and after steroid treatment.

    Science.gov (United States)

    Kim, Hee Kyung; Laor, Tal; Horn, Paul S; Wong, Brenda

    2010-01-01

    To determine the feasibility of using T2 mapping as a quantitative method to longitudinally follow the disease activity in children with Duchenne muscular dystrophy (DMD) who are treated with steroids. ELEVEN BOYS WITH DMD (AGE RANGE: 5-14 years) underwent evaluation with the clinical functional score (CFS), and conventional pelvic MRI and T2 mapping before and during steroid therapy. The gluteus muscle inflammation and fatty infiltration were evaluated on conventional MRI. The histograms and mean T2 relaxation times were obtained from the T2 maps. The CFS, the conventional MRI findings and the T2 values were compared before and during steroid therapy. None of the patients showed interval change of their CFSs. On conventional MRI, none of the images showed muscle inflammation. During steroid treatment, two boys showed increased fatty infiltration on conventional MRI, and both had an increase of the mean T2 relaxation time (p muscle changes in those children who receive steroid therapy for DMD. The differences of the mean T2 relaxation time may reflect alterations in disease activity, and even when the conventional MRI and CFS remain stable.

  20. Non-equilibrium relaxation and near-arrest dynamics in colloidal suspensions

    International Nuclear Information System (INIS)

    Medina-Noyola, M; RamIrez-Gonzalez, Pedro

    2009-01-01

    In this work we propose a theory to describe the irreversible diffusive relaxation of the local concentration of a colloidal dispersion that proceeds toward its stable thermodynamic equilibrium state, but which may in the process be trapped in metastable or dynamically arrested states. The central assumption of this theory is that the irreversible relaxation of the macroscopically observed mean value n-bar(r,t) of the local concentration of colloidal particles is described by a diffusion equation involving a local mobility b*(r,t) that depends not only on the mean value n-bar(r,t) but also on the covariance σ(r,r';t)≡δn(r,t)δn(r',t)-bar of the fluctuations δn(r,t)≡n(r,t)-n-bar(r,t). This diffusion equation must hence be solved simultaneously with the relaxation equation for the covariance σ(r,r';t), and here we also derive the corresponding relaxation equation. The dependence of the local mobility b*(r,t) on the mean value and the covariance is determined by a self-consistent set of equations involving now the spatially and temporally non-local time-dependent correlation functions, which in a uniform system in equilibrium reduces to the self-consistent generalized Langevin equation (SCGLE) theory of colloid dynamics. The resulting general theory considers the possibility that these relaxation processes occur under the influence of external fields, such as gravitational forces acting in the process of sedimentation. In this paper, however, we describe a simpler application, in which the system remains spatially uniform during the irreversible relaxation process, and discuss the general features of the glass transition scenario predicted by this non-equilibrium theory.

  1. Stress relaxation experiments on a lamellar polystyrene-polyisoprene diblock copolymer melt

    DEFF Research Database (Denmark)

    Holmqvist, P.; Castelletto, V.; Hamley, I.W.

    2001-01-01

    The non-linear rheology of the lamellar phase of a polystyrene-polyisoprene diblock copolymer is studied by oscillatory shear experiments. The relaxation of the shear modulus, G(t, gamma) is studied as a function of strain amplitude, gamma, up to large amplitude strains, gamma = 100%. The decay...... of G(t, gamma) is analysed using the model-independent CONTIN inverse Laplace transform algorithm to obtain a series of relaxation times, which reveals multiple relaxation processes. The timescale for the fastest relaxation processes is compared to those previously observed for diblock copolymer melts...... via dynamic light scattering experiments. The slowest relaxation process may be related to the shear-induced orientation of the lamellae. It is shown that time-strain separability G(t, gamma)= G(t)h(gamma) can be applied, and the damping function h(gamma) is consistent with a strongly strain...

  2. Ovarian chocolate cysts. Staging with relaxation time in MR imaging

    Energy Technology Data Exchange (ETDEWEB)

    Sugimura, Kazuro; Ishida, Tetsuya; Takemori, Masayuki; Kitagaki, Hajime; Tanaka, Yutaka; Yamasaki, Katsuhito; Shimizu, Tadafumi; Kono, Michio

    1988-10-01

    Accurate preoperative staging of ovarian chocolate cysts is very important because recent hormonal therapy has been effective in low stage patients. However, it has been difficult to assess the preoperative stage of ovarian chocolate cysts. We evaluated the diagnostic potential of MRI in preoperative staging of 15 overian chocolate cysts. It was well known that the older the ovarian chocolate cyst was the more iron content it had. We examined the iron contents effect on T1 and T2 relaxation times in surgically confirmed chocolate cysts (stage II: 3 cases, stage III: 3 cases and stage IV: 9 cases by AFS classification, 1985) employing the 0.15-T MR system and 200 MHz spectrometer. There was a positive linear relation between T1 of the lesion using the MR system (T1) and T1 of the resected contents using the spectrometer (sp-T1); r = 0.93. The same relation was revealed between T2 and sp-T2; r = 0.87. It was indicated that T1 and T2 using the MR system was accurate. There was a negative linear relation between T1 and the iron contents ( r = -0.81) but no relation between T2 and the iron contents. T1 was 412 +- 91 msec for stage II, 356 +- 126 msec for stage III and 208 +- 30 msec for stage IV. T1 for stage IV was shorter than that for stage II and III, statistically significant differences were noted (p < 0.05). Thus, T1 was useful in differentiating a fresh from an old ovarian chocolate cyst. We concluded that T1 relaxation time using the MR system was useful for the staging of an ovarian chocolate cyst without surgery.

  3. Muon-spin-relaxation study of magnetism in ErBa2Cu3O6.2

    International Nuclear Information System (INIS)

    Lichti, R.L.; Chan, K.B.; Adams, T.R.; Boekema, C.; Dawson, W.K.; Flint, J.A.; Cooke, D.W.; Kwok, R.S.; Willis, J.O.

    1990-01-01

    The copper magnetism of ErBa 2 Cu 3 O 6.2 is examined by transverse-field (TF) and zero-field (ZF) muon-spin relaxation (μSR). These data indicate two magnetic phases with T N1 congruent 330 K and T N2 ∼65 K. The second phase is signaled by deviation of the ZF-μSR frequencies from a standard magnetization curve and an abrupt change in the TF-μSR relaxation rate. A relaxation feature indicates a muon depolarization mechanism with a T 3/2 dependence in the low-temperature phase. Observed fields are compared to those calculated for proposed magnetic structures

  4. Magnetization relaxation in spin glasses above transition point

    International Nuclear Information System (INIS)

    Zajtsev, I.A.; Minakov, A.A.; Galonzka, R.R.

    1988-01-01

    Magnetization relaxation of Cd 0.6 Zn 0.4 Cr 2 Se 4 and Cd 0.6 Mn 0.4 Te monocrystalline samples with T g =21 K and T g =12 K respectively and magnetic colloid is investigated. It is shown that magnetization inexponential relaxation detected experimentally in spin and dipole glasses is essentially higher than T g temperature transition. It is found that at temperatures higher than T g the essential difference is observed in behaviour of spin glasses with different Z and disorder types

  5. Dielectric relaxation in Li2SO4 in the intermedia-temperature regime

    Science.gov (United States)

    Diosa, J. E.; Vargas, R. A.; Fernández, M. E.; Albinsson, I.; Mellander, B.-E.

    2005-08-01

    The dielectric permittivity of polycrystalline Li2SO4 was measured from 5 Hz to 13 MHz and over the temperature range 235-460 °C. The corrected imaginary part of permittivity, , and its real part vs. frequency clearly show a new dielectric relaxation around fmax = 2 × 104 Hz at T = 256 °C, which shifts to higher frequencies (1 MHz) as the temperatures increases. The relaxation frequency (calculated from the peak position of ) vs. reciprocal T shows an activated relaxation process with activation energy Ea= 0.9 eV, which is very close to that derived from the dc conductivity, E (0.87 eV). We suggest that this dielectric relaxation could be due to the Li+ jump and SO4- reorientation that cause distortion and change of the local lattice polarizability inducing dipoles like LiSO4-.

  6. The freezing of water bonded in the wheat (Triticum aestivum L.) grain studied by means protons magnetic relaxation method; Zamarzanie wody zwiazanej w ziarnach pszenicy (Triticum aestivum L.) badane metoda relaksacji magnetycznej dla protonow

    Energy Technology Data Exchange (ETDEWEB)

    Haranczyk, H.; Jasinski, G. [Inst. Fizyki, Uniwersytet Jagiellonski, Cracow (Poland); Strzalka, K. [Inst. Biologii Molekularnej, Uniwersytet Jagiellonski, Cracow (Poland)

    1994-12-31

    Some biological aspects of water freezing in the wheat grain have been studied using NMR methods. Measuring of the relaxation times for freezing and liquid water shown absence of T{sub 2}{approx}100 {mu}s and T{sub 2}{approx}1 ms separated components what pointed for some different way of water bonding. 7 refs, 12 figs, 2 tabs.

  7. Induced magnetic moment in stainless steel components of orthodontic appliances in 1.5 T MRI scanners

    Science.gov (United States)

    Rollins, Nancy K.; Liang, Hui; Park, Yong Jong

    2015-01-01

    Purpose: Most orthodontic appliances are made of stainless steel materials and induce severe magnetic susceptibility artifacts in brain MRI. In an effort for correcting these artifacts, it is important to know the value of induced magnetic moments in all parts of orthodontic appliances. In this study, the induced magnetic moment of stainless steel orthodontic brackets, molar bands, and arch-wires from several vendors is measured. Methods: Individual stainless steel brackets, molar bands, and short segments of arch-wire were positioned in the center of spherical flask filled with water through a thin plastic rod. The induced magnetic moment at 1.5 T was determined by fitting the B0 map to the z-component of the magnetic dipole field using a computer routine. Results: The induced magnetic moment at 1.5 T was dominated by the longitudinal component mz, with a small contribution from the transverse components. The mz was insensitive to the orientation of the metal parts. The orthodontic brackets collectively dominated the magnetic dipole moment in orthodontic appliances. In brackets from six vendors, the total induced mz from 20 brackets for nonmolar teeth ranged from 0.108 to 0.158 (median 0.122) A ⋅ m2. The mz in eight molar bands with bracket attachment from two vendors ranged from 0.0004 to 0.0166 (median 0.0035) A ⋅ m2. Several full length arch wires had induced magnetic moment in the range of 0.006–0.025 (median 0.015) A ⋅ m2. Conclusions: Orthodontic brackets collectively contributed most to the total magnetic moment. Different types of brackets, molar bands, and arch wires all exhibit substantial variability in the induced magnetic moment. PMID:26429261

  8. The spin relaxation of nitrogen donors in 6H SiC crystals as studied by the electron spin echo method

    Science.gov (United States)

    Savchenko, D.; Shanina, B.; Kalabukhova, E.; Pöppl, A.; Lančok, J.; Mokhov, E.

    2016-04-01

    We present the detailed study of the spin kinetics of the nitrogen (N) donor electrons in 6H SiC wafers grown by the Lely method and by the sublimation "sandwich method" (SSM) with a donor concentration of about 1017 cm-3 at T = 10-40 K. The donor electrons of the N donors substituting quasi-cubic "k1" and "k2" sites (Nk1,k2) in both types of the samples revealed the similar temperature dependence of the spin-lattice relaxation rate (T1-1), which was described by the direct one-phonon and two-phonon processes induced by the acoustic phonons proportional to T and to T9, respectively. The character of the temperature dependence of the T1-1 for the donor electrons of N substituting hexagonal ("h") site (Nh) in both types of 6H SiC samples indicates that the donor electrons relax through the fast-relaxing centers by means of the cross-relaxation process. The observed enhancement of the phase memory relaxation rate (Tm-1) with the temperature increase for the Nh donors in both types of the samples, as well as for the Nk1,k2 donors in Lely grown 6H SiC, was explained by the growth of the free electron concentration with the temperature increase and their exchange scattering at the N donor centers. The observed significant shortening of the phase memory relaxation time Tm for the Nk1,k2 donors in the SSM grown sample with the temperature lowering is caused by hopping motion of the electrons between the occupied and unoccupied states of the N donors at Nh and Nk1,k2 sites. The impact of the N donor pairs, triads, distant donor pairs formed in n-type 6H SiC wafers on the spin relaxation times was discussed.

  9. Cooling-history effects on magnetic relaxation through quantum tunneling

    Science.gov (United States)

    Fernandez, Julio; Alonso, Juan

    2003-03-01

    Magnetic clusters, such as Fe8 and Mn_12, that make up the core of large organometallic molecules, behave at low temperatures as large single spins S. In crystals, magnetic anisotropy energies U inhibit magnetic relaxation of these spins, which can then proceed at very small temperatures (at k_BT tunneling (MQT). Magnetic dipolar interactions then play an essential role. We study how an Ising system of spins that interact through magnetic dipolar fields relaxes. A spin is allowed to flip, at rate Γ, only if the magnetic field h acting on it is within some tunnel window -hw < h< h_w. We let (1) this system be initially held for some time at some temperature Ta that is above both the long-range ordering temperature and T ˜ U/S, and (2) apply a magnetic field at t=0, inmediately after the system is quenched to T < 0.1U/S. This is somewhat as in the experiments of Wernsdorfer et al on Fe_8. The time evolution of the magnetiztion m and field distributions after the field is applied at t=0 is studied. For small applied fields H, m ˜= hw HF(Γ t). In addition, F(Γ t)˜= cΓ t for Γ t < 1 and F(Γ t)˜= cΓ t for 1t < (h_d/h_w)^2, where hd is a nearest neighbor dipolar field. We will show how c depends on the cooling protocol. Finally, m saturates at m_s˜= 0.13\\varepsilon_aH.

  10. {sup 13}C relaxation in an RNA hairpin

    Energy Technology Data Exchange (ETDEWEB)

    King, G.C. [Univ. of South Wales, Kensington (Australia)]|[Rice Univ., Houston, TX (United States); Akratos, C. [Univ. of South Wales, Kensington (Australia); Xi, Z.; Michnica, M.J. [Rice Univ., Houston, TX (United States)

    1994-12-01

    This initial survey of {sup 13}C relaxation in the {triangle}TAR RNA element has generated a number of interesting results that should prove generally useful for future studies. The most readily comparable study in the literature monitored {sup 13}C relaxation of the methyl groups from unusual bases in tRNA{sup Phe}. The study, which used T{sub 1} and NOE data only, reported order parameters for the methyl group axis that ranged between 0.51 and 0.97-a range similar to that observed here. However, they reported a breakdown of the standard order parameter analysis at higher (118-MHz {sup 13}C) frequencies, which should serve to emphasize the need for a thorough exploration of suitable motional models.

  11. Evaluation of the internal structure of articular cartilage in terms of 1H-NMR relaxation behavior

    International Nuclear Information System (INIS)

    Matsuo, Takeshi

    2000-01-01

    The structural characteristics of articular cartilage were analyzed using 1 H-longitudinal (T 1 ) and transverse (T 2 ) relaxation times as measured by fast-inversion-recovery and multi-spin-echo magnetic resonance imaging (MRI). Pairs of cartilage-bone plugs from weight bearing and non-weight bearing regions were dissected from 15 medial femoral condyles and were subjected to NMR measurements with and without static loads (0.15-1.0 MPa). The T 1 of the cartilage with no load showed a maximum value just beneath the articular surface and this value decreased gradually towards the deeper zones. The T 2 of the same cartilage showed a maximum value at, or just beneath, the articular surface, decreased rapidly towards the intermediate zone yet increased again in the deepest zone. The increase of T 2 in the deepest zone was more greatly pronounced in the weight bearing region than in the non-weight bearing region. These layer-dependent differences in the T 1 and T 2 could account for the laminar appearance of the articular cartilage in the MR images. Under static loads, the decrease of T 1 in the transitional zone (from just beneath the articular surface to the intermediate zone) was significant. Because T 1 has a positive correlation with the water content, this decrease in T 1 may signify that the largest water loss occurs in the transitional zone. These findings suggest that the transitional zone might attenuate mechanical stress in the joint, and the expressed water from the cartilage could substantially contribute to the lubrication of the joint. (author)

  12. Evaluation of relaxation time measurements by magnetic resonance imaging. A phantom study

    DEFF Research Database (Denmark)

    Kjaer, L; Thomsen, C; Henriksen, O

    1987-01-01

    Several circumstances may explain the great variation in reported proton T1 and T2 relaxation times usually seen. This study was designed to evaluate the accuracy of relaxation time measurements by magnetic resonance imaging (MRI) operating at 1.5 tesla. Using a phantom of nine boxes with different...... concentrations of CuSO4 and correlating the calculated T1 and T2 values with reference values obtained by two spectrometers (corrected to MRI-proton frequency = 64 MHz) we found a maximum deviation of about 10 per cent. Measurements performed on a large water phantom in order to evaluate the homogeneity...... in the imaging plane showed a variation of less than 10 per cent within 10 cm from the centre of the magnet in all three imaging planes. Changing the gradient field strength apparently had no influence on the T2 values recorded. Consequently diffusion processes seem without significance. It is concluded...

  13. Preliminary study for differential diagnosis of intracranial tumors using in vivo quantitative proton MR spectroscopy with correction for T2 relaxation time

    International Nuclear Information System (INIS)

    Isobe, Tomonori; Yamamoto, Tetsuya; Akutsu, Hiroyoshi; Shiigai, Masanari; Shibata, Yasushi; Takada, Kenta; Masumoto, Tomohiko; Anno, Izumi; Matsumura, Akira

    2015-01-01

    Introduction: The intent of this study was to differentiate intracranial tumors using the metabolite concentrations obtained by quantification with correction for T2 relaxation time, and to analyze whether the spectrum peak was generated by the existence of metabolites in proton magnetic resonance spectroscopy (MRS). Methods: All proton MRS studies were performed on a clinical 1.5T MR system. 7 normal volunteers and 57 patients (gliomas, metastases, meningiomas, acoustic neuromas, and pituitary adenomas) underwent single voxel proton MRS with different echo times (TE: 68, 136, 272 ms) for T2 correction of signal derived from metabolites and tissue water. With tissue water employed as an internal reference, the concentrations of metabolite (i.e. N-acetylaspartate (NAA), total creatine (t-Cr) and choline-containing compounds (Cho)) were calculated. Moreover, proton MRS data of previously published typical literatures were critically reviewed and compared with our data. Results: Extramedullary tumors were characterized by absence of NAA compared with intramedullary tumors. High-grade glioma differed from low-grade glioma by lower t-Cr concentrations. Metastasis differed from cystic glioblastoma by higher Cho concentrations, lower t-Cr concentrations, an absence of NAA, and a prominent Lipids peak. Based on these results and review of previous reports, we suggest a clinical pathway for the differentiation of intracranial tumors. Conclusion: The metabolite concentrations obtained by quantification with correction for T2 relaxation time, and to analyze whether the spectrum peak was generated by the existence of metabolites in proton MRS is useful for the diagnosis of the intracranial tumors

  14. Quantitative MRI T2 relaxation time evaluation of knee cartilage: comparison of meniscus-intact and -injured knees after anterior cruciate ligament reconstruction.

    Science.gov (United States)

    Li, Hong; Chen, Shuang; Tao, Hongyue; Chen, Shiyi

    2015-04-01

    Associated meniscal injury is well recognized at anterior cruciate ligament (ACL) reconstruction, and it is a known risk factor for osteoarthritis. To evaluate and characterize the postoperative appearance of articular cartilage after different meniscal treatment in ACL-reconstructed knees using T2 relaxation time evaluation on MRI. Cohort study; Level of evidence, 3. A total of 62 consecutive patients who under ACL reconstruction were recruited in this study, including 23 patients undergoing partial meniscectomy (MS group), 21 patients undergoing meniscal repair (MR group), and 18 patients with intact menisci (MI group) at time of surgery. Clinical evaluation, including subjective functional scores and physical examination, was performed on the same day as the MRI examination and at follow-up times ranging from 2 to 4.2 years. The MRI multiecho sagittal images were segmented to determine the T2 relaxation time value of each meniscus and articular cartilage plate. Differences in each measurement were compared among groups. No patient had joint-line tenderness or reported pain or clicking on McMurray test or instability. There were also no statistically significant differences in functional scores or medial or lateral meniscus T2 values among the 3 groups (P > .05 for both). There was a significantly higher articular cartilage T2 value in the medial femorotibial articular cartilage for the MS group (P T2 value between the MS and MR groups (P > .05) in each articular cartilage plate. The medial tibial articular cartilage T2 value had a significant positive correlation with medial meniscus T2 value (r = 0.287; P = .024) CONCLUSION: This study demonstrates that knees with meniscectomy or meniscal repair had articular cartilage degeneration at 2 to 4 years postoperatively, with higher articular cartilage T2 relaxation time values compared with the knees with an intact meniscus. © 2015 The Author(s).

  15. MR imaging of the stomach and relaxation measurement with intraluminal hyperpolarized 129Xenon gas

    International Nuclear Information System (INIS)

    Yanagawa, Yasuhiro; Kimura, Atsuomi; Fujiwara, Hideaki; Kinoshita, Yoshimasa; Hattori, Mineyuki; Hiraga, Takashi; Iida, Hidehiro

    2001-01-01

    Using laser optical pumping, the nuclear spin polarization of noble gases can be strongly enhanced. The purpose of this study was to make a simple apparatus that can provide hyperpolarized 129 Xe gas, which can then be used in an attempt to obtain magnetic resonance imaging (MRI). We would also like to study the relaxation behavior of hyperpolarized 129 Xe gas through the measurement of the relaxation time. First, we demonstrated that hyperpolarized 129 Xe gas can be applied to magnetic resonance imaging of the stomach, by using a rat as a model. This was performed under a 4.7 T magnet field using the following imaging parameters for the hyperpolarized 129 Xe gas: TR=50 ms, TE=15 ms, FOV=10 x 10 cm 2 , matrix size 64 x 64, THK=2.54 cm. By using these parameters, we were able to obtain a hyperpolarized image of the stomach in rats for the first time. Next, we measured the relaxation times of the hyperpolarized 129 Xe gas enclosed in cavities such as the stomach of rats as well as in phantoms created by glass and gelatin bulbs. The cavity size dependency of the relaxation time was analyzed on the basis of the kinetic theory of gases. This analysis showed a linear relationship between the relaxation rate (1/T 1 ) and a square inverse of the cavity diameter (1/d 2 ). From this relationship, the wall effect on the 129 Xe relaxation can be estimated in the novel parameter t 1 , wall . This shows drastic dependency on the material of the wall, suggesting a potential use of the relaxation experiment as a diagnostic tool for organ surfaces in the future. (author)

  16. Ultralow-field and spin-locking relaxation dispersion in postmortem pig brain.

    Science.gov (United States)

    Dong, Hui; Hwang, Seong-Min; Wendland, Michael; You, Lixing; Clarke, John; Inglis, Ben

    2017-12-01

    To investigate tissue-specific differences, a quantitative comparison was made between relaxation dispersion in postmortem pig brain measured at ultralow fields (ULF) and spin locking at 7 tesla (T). The goal was to determine whether ULF-MRI has potential advantages for in vivo human brain imaging. Separate specimens of gray matter and white matter were investigated using an ULF-MRI system with superconducting quantum interference device (SQUID) signal detection to measure T1ULF at fields from 58.7 to 235.0 μT and using a commercial MRI scanner to measure T1ρ7T at spin-locking fields from 5.0 to 235.0 μT. At matched field strengths, T1ρ7T is 50 to 100% longer than T1ULF. Furthermore, dispersion in T1ULF is close to linear between 58.7 and 235 µT, whereas dispersion in T1ρ7T is highly nonlinear over the same range. A subtle elbow in the T1ULF dispersion at approximately 140 µT is tentatively attributed to the local dipolar field of macromolecules. It is suggested that different relaxation mechanisms dominate each method and that ULF-MRI has a fundamentally different sensitivity to the macromolecular structure of neural tissue. Ultralow-field MRI may offer distinct, quantitative advantages for human brain imaging, while simultaneously avoiding the severe heating limitation imposed on high-field spin locking. Magn Reson Med 78:2342-2351, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  17. Hydrogen bond network relaxation in aqueous polyelectrolyte solutions: the effect of temperature

    International Nuclear Information System (INIS)

    Sarti, S; Bordi, F; Truzzolillo, D

    2012-01-01

    Dielectric spectroscopy data over the range 100 MHz-40 GHz allow for a reliable analysis of two of the major relaxation phenomena for polyelectrolytes (PE) in water. Within this range, the dielectric relaxation of pure water is dominated by a near-Debye process at ν = 18.5 GHz corresponding to a relaxation time of τ = 8.4 ps at 25 °C. This mode is commonly attributed to the cooperative relaxation specific to liquids forming a hydrogen bond network (HBN) and arising from long range H-bond-mediated dipole-dipole interactions. The presence of charged polymers in water partially modifies the dielectric characteristics of the orientational water molecule relaxation due to a change of the dielectric constant of water surrounding the charges on the polyion chain. We report experimental results on the effect of the presence of a standard flexible polyelectrolyte (sodium polyacrylate) on the HBN relaxation in water for different temperatures, showing that the HBN relaxation time does not change by increasing the polyelectrolyte density in water, even if relatively high concentrations are reached (0.02 monomol l -1 ≤ C ≤ 0.4 monomol l -1 ). We also find that the effect of PE addition on the HBN relaxation is not even a broadening of its distribution, rather a decrease of the spectral weight that goes beyond the pure volume fraction effect. This extra decrease is larger at low T and less evident at high T, supporting the idea that the correlation length of the water is less affected by the presence of charged flexible chains at high temperatures. (paper)

  18. Relaxation of helium levels excited by heavy ion impact: III.- Orientation by anisotropic relaxation of excited atoms in previously aligned states

    International Nuclear Information System (INIS)

    Chamoun, E.; Lombardi, M.; Carre, M.; Gaillard, M.L.

    1977-01-01

    In the last paper of this series devoted to relaxation phenomena in a low pressure cell of helium excited by an accelerated ion beam, experimental evidence is given for a new mechanism of transfer between alignment and orientation through anisotropic relaxation of initially aligned excited states. The theory predicting this effect is briefly outlined and then description is given of the exact experimental conditions to detect the circularly polarized component of the light emitted by the target excited in the 4 1 D level of He I by Na + impact [fr

  19. Nuclear spin phonon relaxation by Raman process in Na{sub 3}H(SO{sub 4}){sub 2} single crystals with the electric-quadrupole-type interaction using {sup 1}H and {sup 23}Na NMR

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Ae Ran [Department of Science Education, Jeonju University, Jeonju 560-759, Chonbuk (Korea, Republic of)], E-mail: aeranlim@hanmail.net; Shin, Chang Woo [Solid State Analysis Team, Korea Basic Science Institute, Daegu 702-701 (Korea, Republic of)

    2008-11-30

    Successive phase transitions in a Na{sub 3}H(SO{sub 4}){sub 2} single crystal were found at 296, 513, and 533 K. To investigate the mechanism of the phase transition at 296 K, the {sup 1}H and {sup 23}Na spin-lattice relaxation time and the spin-spin relaxation time of Na{sub 3}H(SO{sub 4}){sub 2} were measured near the phase transition temperature using a FT NMR spectrometer. The spin-lattice relaxation time, T{sub 1}, for {sup 1}H in Na{sub 3}H(SO{sub 4}){sub 2} crystals exhibits a minimum below T{sub C1} (=296 K) indicating the presence of distinct molecular motion governed by the Bloembergen-Purcell-Pound (BPP) theory. Although the results for the {sup 1}H and {sup 23}Na relaxation times provide no evidence of the phase transition at T{sub C1}, the separation of the {sup 23}Na resonance lines changes abruptly at T{sub C1}. The phase transition at 296 K produces a change in the separation of the Na resonance line that is associated with a change in the atomic positions in the vicinity of the Na ions. Also, the nuclear spin-lattice relaxation process in Na{sub 3}H(SO{sub 4}){sub 2} crystals with the electric-quadrupole-type interaction proceed via Raman process. These results are compared with those obtained for other M{sub 3}H(SO{sub 4}){sub 2} (M=K, Rb, and Cs) crystals, which have similar hydrogen-bonded structures.

  20. 129 Xe NMR Relaxation-Based Macromolecular Sensing

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, Muller D. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials Sciences Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Dao, Phuong [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials Sciences Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Jeong, Keunhong [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials Sciences Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Slack, Clancy C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials Sciences Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Vassiliou, Christophoros C. [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Finbloom, Joel A. [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Francis, Matthew B. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials Sciences Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Wemmer, David E. [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry; Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Physical Biosciences Division; Pines, Alexander [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Materials Sciences Division; Univ. of California, Berkeley, CA (United States). Dept. of Chemistry

    2016-07-29

    A 129Xe NMR relaxation-based sensing approach is reported on that exploits changes in the bulk xenon relaxation rate induced by slowed tumbling of a cryptophane-based sensor upon target binding. The amplification afforded by detection of the bulk dissolved xenon allows sensitive detection of targets. The sensor comprises a xenon-binding cryptophane cage, a target interaction element, and a metal chelating agent. Xenon associated with the target-bound cryptophane cage is rapidly relaxed and then detected after exchange with the bulk. Here we show that large macromolecular targets increase the rotational correlation time of xenon, increasing its relaxation rate. Upon binding of a biotin-containing sensor to avidin at 1.5 μM concentration, the free xenon T2 is reduced by a factor of 4.

  1. Synergic nature of dielectric relaxation process in the layered perovskite halide salts: The case of 1,3- diammoniumpropylenetetrabromocadmate compound

    Science.gov (United States)

    Staśkiewicz, Beata

    2018-06-01

    The negative thermal expansion (NTE) property was a prototype to discuss the origin of difference between classical Debye relaxation process and the non-Debye behavior in the layered perovskite halide salt of chemical formula NH3(CH2)3NH3CdBr4. The analysis has been taken by dielectric relaxation spectroscopy measurements in almost six decades in frequency 5 × 102 ≤ f(ω) ≤ 1.2 × 108 and in the temperature range 315 ≤ T(K) ≤ 390. It was shown that the investigated sample exhibit an antiferrodistortive nature of phase transition between two orthorhombic structural modifications i.e. Pnma (phase I) and Ima2 (phase II) at Tc1(I → II) = 326 K, leading from an antiferroelectric to a paraelectric phase. The involvement of an odd number of carbon atoms in the alkylammonium chains in dielectric properties of examined sample is proved. Higher structural modifications, i.e. Ima2 (phase II) and P21/m (phase III), have shown significant deviations from a regular circle on the Cole-Cole diagram. Presented experimental observations are essentially important for the theoretical explanation of relaxation processes in analyzed organic - inorganic compound crystallizing in a perovskite-like topology and may provide new perspective on the fundamental aspect of relaxation response in "diammonium" series.

  2. Idiosyncratic reality claims, relaxation dispositions, and ABC relaxation theory: happiness, literal christianity, miraculous powers, metaphysics, and the paranormal.

    Science.gov (United States)

    Smith, Jonathan C; Karmin, Aaron D

    2002-12-01

    This study examined idiosyncratic reality claims, that is, irrational or paranormal beliefs often claimed to enhance relaxation and happiness and reduce stress. The Smith Idiosyncratic Reality Claims Inventory and the Smith Relaxation Dispositions Inventory (which measures relaxation and stress dispositions, or enduring states of mind frequently associated with relaxation or stress) were given to 310 junior college student volunteers. Principal components factor analysis with varimax rotation identified five idiosyncratic reality claim factors: belief in Literal Christianity; Magic; Space Aliens: After Death experiences; and Miraculous Powers of Meditation, Prayer, and Belief. No factor correlated with increased relaxation dispositions Peace, Energy, or Joy, or reduced dispositional somatic stress, worry, or negative emotion on the Smith Relaxation Dispositions Inventory. It was concluded that idiosyncratic reality claims may not be associated with reported relaxation, happiness, or stress. In contrast, previous research strongly supported self-affirming beliefs with few paranormal assumptions display such an association.

  3. Volume and structural relaxation in compressed sodium borate glass.

    Science.gov (United States)

    Svenson, Mouritz N; Youngman, Randall E; Yue, Yuanzheng; Rzoska, Sylwester J; Bockowski, Michal; Jensen, Lars R; Smedskjaer, Morten M

    2016-11-21

    The structure and properties of glass can be modified through compression near the glass transition temperature (T g ), and such modified structure and properties can be maintained at ambient temperature and pressure. However, once the compressed glass undergoes annealing near T g at ambient pressure, the modified structure and properties will relax. The challenging question is how the property relaxation is correlated with both the local and the medium-range structural relaxation. In this paper, we answer this question by studying the volume (density) and structural relaxation of a sodium borate glass that has first been pressure-quenched from its T g at 1 GPa, and then annealed at ambient pressure under different temperature-time conditions. Using 11 B MAS NMR and Raman spectroscopy, we find that the pressure-induced densification of the glass is accompanied by a conversion of six-membered rings into non-ring trigonal boron (B III ) units, i.e. a structural change in medium-range order, and an increase in the fraction of tetrahedral boron (B IV ), i.e. a structural change in short-range order. These pressure-induced structural conversions are reversible during ambient pressure annealing near T g , but exhibit a dependence on the annealing temperature, e.g. the ring/non-ring B III ratio stabilizes at different values depending on the applied annealing temperature. We find that conversions between structural units cannot account for the pressure-induced densification, and instead we suggest the packing of structural units as the main densification mechanism.

  4. Proton NMR relaxivity of blood samples in the presence of some gadolinium and dysprosium compounds

    International Nuclear Information System (INIS)

    Coroiu, I.; Darabont, Al.; Bogdan, M.

    1999-01-01

    The use of some new compounds in MRI tissue and blood characterisation based on nuclear spin relaxation time measurements cannot be sustained until the molecular sources of these variations are understood. Tissues and blood are complex molecular systems with complex NMR properties. A better comprehension of the molecular basis of relaxation offers the possibility to predict the changes expected for a given pathology. The purpose of this contribution is to evidence the different relaxation characteristics of some gadolinium and dysprosium compounds in the presence and absence of the blood and to give a possible explanation about the molecular processes that cause occurrence of changes. Some gadolinium and dysprosium compounds such as: Gd-CIT (gadolinium citrate), Dy-DTPA (DTPA-diethylenetriamine pentaacetic acid), iron oxide - gadolinium oxide (or dysprosium oxide)- dextran complexes were prepared. The longitudinal T 1 -1 and transverse T 2 -1 'relaxation rates' measurements have been carried out as a function of molar concentrations. All measurements have been made at room temperature (about 25 deg.C) and the proton Larmor frequency ν o = 90 MHz. The pulsed NMR spectrometer utilised was a commercial Bruker SXP4/100 spectrometer. Transverse relaxation rate measurements have been made using the Carr-Purcell method, while longitudinal relaxation rate measurements using the inversion recovery pulse sequence, 180 angle-τ-90 angle. The accuracy was about 2-3% for the longitudinal relaxation rates and about 5-7% for the transverse relaxation rates. R 1 and R 2 relaxivities, in mM -1 s -1 were determined from the least square determination of the slopes of plots 1/T 1,2 versus compound molar concentration, using at least five independent measurements at several concentrations between 0 and 2 mM. Increased R 2 relaxivity observed for dysprosium compounds in the blood presence can be explained by PRE effect. The largest gain in R 2 relaxivity seems to imply a noncovalent

  5. Combined Fat Imaging/Look Locker for mapping of lipid spin-lattice (T1) relaxation time

    Science.gov (United States)

    Jihyun Park, Annie; Yung, Andrew; Kozlowski, Piotr; Reinsberg, Stefan

    2012-10-01

    Tumor hypoxia is a main problem arising in the treatment of cancer due to its resistance to cytotoxic therapy such as radiation and chemotherapy, and selection for more aggressive tumor phenotypes. Attempts to improve and quantify tumor oxygenation are in development and tools to assess the success of such schemes are required. Monitoring oxygen level with MRI using T1 based method (where oxygen acts as T1 shortening agent) is a dynamic and noninvasive way to study tumor characteristics. The method's sensitivity to oxygen is higher in lipids than in water due to higher oxygen solubility in lipid. Our study aims to develop a time-efficient method to spatially map T1 of fat inside the tumor. We are combining two techniques: Fat/Water imaging and Look Locker (a rapid T1 measurement technique). Fat/Water Imaging is done with either Dixon or Direct Phase Encoding (DPE) method. The combination of these techniques poses new challenges that are tackled using spin dynamics simulations as well as experiments in vitro and in vivo.

  6. Evaluation of creep damage due to stress relaxation in SA533 grade B class 1 and SA508 class 3 pressure vessel steels

    International Nuclear Information System (INIS)

    Hoffmann, C.L.; Urko, W.

    1993-01-01

    Creep damage can result from stress relaxation of residual stresses in components when exposed to high temperature thermal cycles. Pressure vessels, such as the reactor vessel of the modular high-temperature gas reactor (MHTGR), which normally operate at temperatures well below the creep range can develop relatively high residual stresses in high stress locations. During short term excursions to elevated-temperatures, creep damage can be produced by the loadings on the vessel. In addition, residual stresses will relax out, causing greater creep damage in the pressure vessel material than might otherwise be calculated. The evaluation described in this paper assesses the magnitude of the creep damage due to relaxation of residual stresses resulting from short term exposure of the pressure vessel material to temperatures in the creep range. Creep relaxation curves were generated for SA533 Grade B, Class 1 and SA508 Class 3 pressure vessel steels using finite element analysis of a simple uniaxial truss loaded under constant strain conditions to produce an initial axial stress equal to 1.25 times the material yield strength at temperature. The strain is held constant for 1000 hours at prescribed temperatures from 700 F to 1000 F. The material creep law is used to calculate the relaxed stress for each time increment. The calculated stress relaxation versus time curves are compared with stress relaxation test data. Creep damage fractions are calculated by integrating the stress relaxation versus time curves and performing a linear creep damage summation using the minimum stress to rupture curves at the respective relaxation temperatures. Cumulative creep damage due to stress relaxation as a function of time and temperature is derived from the linear damage summation

  7. Effective temperature in relaxation of Coulomb glasses.

    Science.gov (United States)

    Somoza, A M; Ortuño, M; Caravaca, M; Pollak, M

    2008-08-01

    We study relaxation in two-dimensional Coulomb glasses up to macroscopic times. We use a kinetic Monte Carlo algorithm especially designed to escape efficiently from deep valleys around metastable states. We find that, during the relaxation process, the site occupancy follows a Fermi-Dirac distribution with an effective temperature much higher than the real temperature T. Long electron-hole excitations are characterized by T(eff), while short ones are thermalized at T. We argue that the density of states at the Fermi level is proportional to T(eff) and is a good thermometer to measure it. T(eff) decreases extremely slowly, roughly as the inverse of the logarithm of time, and it should affect hopping conductance in many experimental circumstances.

  8. Assessment of demyelination, edema, and gliosis by in vivo determination of T1 and T2 in the brain of patients with acute attack of multiple sclerosis

    DEFF Research Database (Denmark)

    Larsson, H B; Frederiksen, J; Petersen, J

    1989-01-01

    -body superconductive MR-scanner, operating at 1.5 T. The measurements were repeated several times, from onset of the disease and during remission by use of six-point partial saturation inversion recovery and 32-echo multiple spin-echo sequences, giving T1 and T2, respectively. We also focused on the issue, whether T1....... Hendriksen, and J. Olesen, Magn. Reson. Med. 7, 43 (1988)). In some of the acute plaques a slight initial increase in T1 and T2 was seen, when the measurement was repeated in about 10 days. Thereafter T1 decreased slowly in all but one patient as a function of days. In all cases the T1 relaxation process...

  9. Fast T1 and T2 mapping methods: the zoomed U-FLARE sequence compared with EPI and snapshot-FLASH for abdominal imaging at 11.7 Tesla.

    Science.gov (United States)

    Pastor, Géraldine; Jiménez-González, María; Plaza-García, Sandra; Beraza, Marta; Reese, Torsten

    2017-06-01

    A newly adapted zoomed ultrafast low-angle RARE (U-FLARE) sequence is described for abdominal imaging applications at 11.7 Tesla and compared with the standard echo-plannar imaging (EPI) and snapshot fast low angle shot (FLASH) methods. Ultrafast EPI and snapshot-FLASH protocols were evaluated to determine relaxation times in phantoms and in the mouse kidney in vivo. Owing to their apparent shortcomings, imaging artefacts, signal-to-noise ratio (SNR), and variability in the determination of relaxation times, these methods are compared with the newly implemented zoomed U-FLARE sequence. Snapshot-FLASH has a lower SNR when compared with the zoomed U-FLARE sequence and EPI. The variability in the measurement of relaxation times is higher in the Look-Locker sequences than in inversion recovery experiments. Respectively, the average T1 and T2 values at 11.7 Tesla are as follows: kidney cortex, 1810 and 29 ms; kidney medulla, 2100 and 25 ms; subcutaneous tumour, 2365 and 28 ms. This study demonstrates that the zoomed U-FLARE sequence yields single-shot single-slice images with good anatomical resolution and high SNR at 11.7 Tesla. Thus, it offers a viable alternative to standard protocols for mapping very fast parameters, such as T1 and T2, or dynamic processes in vivo at high field.

  10. Comparative study of imaging at 3.0 T versus 1.5 T of the knee

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Scott [University of California, San Francisco, Department of Radiology, San Francisco, CA (United States); University of Miami Miller School of Medicine, Miami, FL (United States); Steinbach, Lynne; Zhao, Jian; Link, Thomas M. [University of California, Department of Radiology, San Francisco, CA (United States); Stehling, Christoph [University of California, Department of Radiology, San Francisco, CA (United States); University of Muenster, Department of Radiology, Muenster (Germany); Ma, C.B. [University of California San Francisco, Department of Orthopedic Surgery, San Francisco, CA (United States)

    2009-08-15

    The objectives of the study were to compare MR imaging at 1.5 and 3.0 T in the same patients concerning image quality and visualization of cartilage pathology and to assess diagnostic performance using arthroscopy as a standard of reference. Twenty-six patients were identified retrospectively as having comparative 1.5 and 3.0 T MR studies of the knee within an average of 102 days. Standard protocols included T1-weighted and fat-saturated intermediate-weighted fast spin-echo sequences in three planes; sequence parameters had been adjusted to account for differences in relaxation at 3.0 T. Arthroscopy was performed in 19 patients. Four radiologists reviewed each study independently, scored image quality, and analyzed pathological findings. Sensitivities, specificities, and accuracies in diagnosing cartilage lesions were calculated in the 19 patients with arthroscopy, and differences between 1.5 and 3.0 T exams were compared using paired Student's t tests with a significance threshold of p<0.05. Each radiologist scored the 3.0 T studies higher than those obtained at 1.5 T in visualizing anatomical structures and abnormalities (p<0.05). Using arthroscopy as a standard of reference, diagnosis of cartilage abnormalities was improved at 3.0 T with higher sensitivity (75.7% versus 70.6%), accuracy (88.2% versus 86.4%), and correct grading of cartilage lesions (51.3% versus 42.9%). Diagnostic confidence scores were higher at 3.0 than 1.5 T (p<0.05) and signal-to-noise ratio at 3.0 T was approximately twofold higher than at 1.5 T. MRI at 3.0 T improved visualization of anatomical structures and improved diagnostic confidence compared to 1.5 T. This resulted in significantly better sensitivity and grading of cartilage lesions at the knee. (orig.)

  11. Comparative study of imaging at 3.0 T versus 1.5 T of the knee

    International Nuclear Information System (INIS)

    Wong, Scott; Steinbach, Lynne; Zhao, Jian; Link, Thomas M.; Stehling, Christoph; Ma, C.B.

    2009-01-01

    The objectives of the study were to compare MR imaging at 1.5 and 3.0 T in the same patients concerning image quality and visualization of cartilage pathology and to assess diagnostic performance using arthroscopy as a standard of reference. Twenty-six patients were identified retrospectively as having comparative 1.5 and 3.0 T MR studies of the knee within an average of 102 days. Standard protocols included T1-weighted and fat-saturated intermediate-weighted fast spin-echo sequences in three planes; sequence parameters had been adjusted to account for differences in relaxation at 3.0 T. Arthroscopy was performed in 19 patients. Four radiologists reviewed each study independently, scored image quality, and analyzed pathological findings. Sensitivities, specificities, and accuracies in diagnosing cartilage lesions were calculated in the 19 patients with arthroscopy, and differences between 1.5 and 3.0 T exams were compared using paired Student's t tests with a significance threshold of p<0.05. Each radiologist scored the 3.0 T studies higher than those obtained at 1.5 T in visualizing anatomical structures and abnormalities (p<0.05). Using arthroscopy as a standard of reference, diagnosis of cartilage abnormalities was improved at 3.0 T with higher sensitivity (75.7% versus 70.6%), accuracy (88.2% versus 86.4%), and correct grading of cartilage lesions (51.3% versus 42.9%). Diagnostic confidence scores were higher at 3.0 than 1.5 T (p<0.05) and signal-to-noise ratio at 3.0 T was approximately twofold higher than at 1.5 T. MRI at 3.0 T improved visualization of anatomical structures and improved diagnostic confidence compared to 1.5 T. This resulted in significantly better sensitivity and grading of cartilage lesions at the knee. (orig.)

  12. Measurement of the exchange rate of waters of hydration in elastin by 2D T2-T2 correlation nuclear magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    Sun Cheng; Boutis, Gregory S

    2011-01-01

    We report on a direct measurement of the exchange rate of waters of hydration in elastin by T 2 -T 2 exchange spectroscopy. The exchange rates in bovine nuchal ligament elastin and aortic elastin at temperatures near, below and at the physiological temperature are reported here. Using an inverse Laplace transform (ILT) algorithm, we are able to identify four components in the relaxation times. While three of the components are in good agreement with previous measurements that used multi-exponential fitting, the ILT algorithm distinguishes a fourth component having relaxation times close to that of free water and is identified as water between fibers. With the aid of scanning electron microscopy, a model is proposed that allows for the application of a two-site exchange analysis between any two components for the determination of exchange rates between reservoirs. The results of the measurements support a model (described by Urry and Parker 2002 J. Muscle Res. Cell Motil. 23 543-59) wherein the net entropy of waters of hydration should increase with increasing temperature in the inverse temperature transition.

  13. Distinct mechanisms of relaxation to bioactive components from chamomile species in porcine isolated blood vessels

    International Nuclear Information System (INIS)

    Roberts, R.E.; Allen, S.; Chang, A.P.Y.; Henderson, H.; Hobson, G.C.; Karania, B.; Morgan, K.N.; Pek, A.S.Y.; Raghvani, K.; Shee, C.Y.; Shikotra, J.; Street, E.; Abbas, Z.; Ellis, K.; Heer, J.K.; Alexander, S.P.H.

    2013-01-01

    German chamomile (Matricaria recutita L.), a widely-used herbal medicine, has been reported to have a wide range of biological effects, including smooth muscle relaxation. The aim of this study was to compare the effects of representative compounds from chamomile (apigenin, luteolin, (−)-α-bisabolol, farnesene, umbelliferone; 3–30 μM) on vascular tone using porcine coronary and splenic arteries mounted for isometric tension recording in isolated tissue baths and precontracted with the thromboxane-mimetic U46619. Apigenin, luteolin, and (−)-α-bisabolol produced slow, concentration-dependent relaxations in both the coronary and splenic arteries that were not blocked by inhibition of nitric oxide synthase or potassium channels. Removal of extracellular calcium inhibited the relaxations to all three compounds, and these compounds also inhibited calcium re-addition-evoked contractions, indicating that the relaxation response may be mediated through inhibition of calcium influx. Apigenin and luteolin, but not (−)-α-bisabolol, enhanced the relaxation to the nitric oxide donor sodium nitroprusside, indicating that apigenin and luteolin may act to regulate cyclic GMP levels. Umbelliferone produced a rapid, transient relaxation in the splenic artery, but not the coronary artery, that was inhibited by L-NAME and removal of the endothelium, suggesting an influence on nitric oxide production. Farnesene, at concentrations up to 30 μM, was without effect in either blood vessel. In conclusion, hydroxylated compounds (apigenin, luteolin and (−)-α-bisabolol) found in chamomile all caused a slow relaxation of isolated blood vessels through an effect on calcium influx. Umbelliferone, on the other hand, produced a rapid, transient relaxation dependent upon release of nitric oxide from the endothelium. - Highlights: • Apigenin, luteolin, and (-)-α-bisabolol are present in chamomile. • They produced slow, concentration-dependent relaxations in arteries. • These

  14. Distinct mechanisms of relaxation to bioactive components from chamomile species in porcine isolated blood vessels

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, R.E., E-mail: Richard.roberts@nottingham.ac.uk; Allen, S.; Chang, A.P.Y.; Henderson, H.; Hobson, G.C.; Karania, B.; Morgan, K.N.; Pek, A.S.Y.; Raghvani, K.; Shee, C.Y.; Shikotra, J.; Street, E.; Abbas, Z.; Ellis, K.; Heer, J.K.; Alexander, S.P.H., E-mail: steve.alexander@nottingham.ac.uk

    2013-11-01

    German chamomile (Matricaria recutita L.), a widely-used herbal medicine, has been reported to have a wide range of biological effects, including smooth muscle relaxation. The aim of this study was to compare the effects of representative compounds from chamomile (apigenin, luteolin, (−)-α-bisabolol, farnesene, umbelliferone; 3–30 μM) on vascular tone using porcine coronary and splenic arteries mounted for isometric tension recording in isolated tissue baths and precontracted with the thromboxane-mimetic U46619. Apigenin, luteolin, and (−)-α-bisabolol produced slow, concentration-dependent relaxations in both the coronary and splenic arteries that were not blocked by inhibition of nitric oxide synthase or potassium channels. Removal of extracellular calcium inhibited the relaxations to all three compounds, and these compounds also inhibited calcium re-addition-evoked contractions, indicating that the relaxation response may be mediated through inhibition of calcium influx. Apigenin and luteolin, but not (−)-α-bisabolol, enhanced the relaxation to the nitric oxide donor sodium nitroprusside, indicating that apigenin and luteolin may act to regulate cyclic GMP levels. Umbelliferone produced a rapid, transient relaxation in the splenic artery, but not the coronary artery, that was inhibited by L-NAME and removal of the endothelium, suggesting an influence on nitric oxide production. Farnesene, at concentrations up to 30 μM, was without effect in either blood vessel. In conclusion, hydroxylated compounds (apigenin, luteolin and (−)-α-bisabolol) found in chamomile all caused a slow relaxation of isolated blood vessels through an effect on calcium influx. Umbelliferone, on the other hand, produced a rapid, transient relaxation dependent upon release of nitric oxide from the endothelium. - Highlights: • Apigenin, luteolin, and (-)-α-bisabolol are present in chamomile. • They produced slow, concentration-dependent relaxations in arteries. • These

  15. Spin fluctuations in iron based superconductors probed by NMR relaxation rate

    Energy Technology Data Exchange (ETDEWEB)

    Graefe, Uwe; Kuehne, Tim; Wurmehl, Sabine; Buechner, Bernd; Grafe, Hans-Joachim [IFW Dresden, Institute for Solid State Research, PF 270116, 01171 Dresden (Germany); Hammerath, Franziska [IFW Dresden, Institute for Solid State Research, PF 270116, 01171 Dresden (Germany); Department of Physics ' ' A. Volta' ' , University of Pavia-CNISM, I-27100 Pavia (Italy); Lang, Guillaume [3LPEM-UPR5, CNRS, ESPCI Paris Tech, 10 Rue Vauquelin, 75005 Paris (France)

    2013-07-01

    We present {sup 75}As nuclear magnetic resonance (NMR) results in F doped LaOFeAs iron pnictides. In the underdoped superconducting samples, pronounced spin fluctuations lead to a peak in the NMR spin lattice relaxation rate, (T{sub 1}T){sup -1}. The peak shows a typical field dependence that indicates a critical slowing of spin fluctuations: it is reduced in height and shifted to higher temperatures. In contrast, a similar peak in the underdoped magnetic samples at the ordering temperature of the spin density wave does not show such a field dependence. Furthermore, the peak is absent in optimally and overdoped samples, suggesting the absence of strong spin fluctuations. Our results indicate a glassy magnetic ordering in the underdoped samples that is in contrast to the often reported Curie Weiss like increase of spin fluctuations towards T{sub c}. Additional measurements of the linewidth and the spin spin relaxation rate are in agreement with such a glassy magnetic ordering that is most likely competing with superconductivity. Our results will be compared to Co doped BaFe{sub 2}As{sub 2}, where a similar peak in (T{sub 1}T){sup -1} has been observed.

  16. Comparison of T2* relaxation times of articular cartilage of the knee in elite professional football players and age-and BMI-matched amateur athletes

    Energy Technology Data Exchange (ETDEWEB)

    Behzadi, C., E-mail: c.behzadi@uke.de [Department of Diagnostic and Interventional Radiology and Nuclearmedicine, University Medical Center Hamburg-Eppendorf, Hamburg, 20246 (Germany); Welsch, G.H. [Department of Sports Medicine, University Medical Center Hamburg-Eppendorf, Hamburg, 20246 (Germany); Laqmani, A.; Henes, F.O.; Kaul, M.G. [Department of Diagnostic and Interventional Radiology and Nuclearmedicine, University Medical Center Hamburg-Eppendorf, Hamburg, 20246 (Germany); Schoen, G. [Department of Medical Biometry and Epidemiology, University Medical Center, Hamburg-Eppendorf, Hamburg, 20246 (Germany); Adam, G.; Regier, M. [Department of Diagnostic and Interventional Radiology and Nuclearmedicine, University Medical Center Hamburg-Eppendorf, Hamburg, 20246 (Germany)

    2017-01-15

    Objective: Recent investigation has underlined the potential of quantitative MR imaging to be used as a complementary tool for the diagnosis of cartilage degeneration at an early state. The presented study analyses T2* relaxation times of articular cartilage of the knee in professional athletes and compares the results to age- and BMI (Body Mass Index)-matched healthy amateur athletes. Materials and methods: 22 professional football players and 22 age- and BMI-matched individuals were underwent knee Magnetic Resonance Imaging (MRI) at 3T including qualitative and quantitative analysis. Qualitative analysis included e.g. meniscal tears, joint effusion and bone edema. For quantitative analysis T2* (22 ET: 4.6-53.6 ms) measurements in 3D data acquisition were performed. Deep and superficial layers of 22 predefined cartilage segments were analysed. All data sets were postprocessed using a dedicated software tool. Statistical analysis included Student t-test, confidence intervals and a random effects model. Results: In both groups, T2* relaxation times were significantly higher in the superficial compared to the deep layers (p < 0.001). Professional athletes had significantly higher relaxation times in eight superficial and three deep cartilage layers in the predefined cartilage segments (p < 0.05). Highly significant differences were found in the weight-bearing segments of the lateral superficial femoral condyle (p < 0.001). Conclusion: Elevated T2* values in cartilage layers of professional football players compared to amateur athletes were noted. The effects seem to predominate in superficial cartilage layers.

  17. Comparison of T2* relaxation times of articular cartilage of the knee in elite professional football players and age-and BMI-matched amateur athletes

    International Nuclear Information System (INIS)

    Behzadi, C.; Welsch, G.H.; Laqmani, A.; Henes, F.O.; Kaul, M.G.; Schoen, G.; Adam, G.; Regier, M.

    2017-01-01

    Objective: Recent investigation has underlined the potential of quantitative MR imaging to be used as a complementary tool for the diagnosis of cartilage degeneration at an early state. The presented study analyses T2* relaxation times of articular cartilage of the knee in professional athletes and compares the results to age- and BMI (Body Mass Index)-matched healthy amateur athletes. Materials and methods: 22 professional football players and 22 age- and BMI-matched individuals were underwent knee Magnetic Resonance Imaging (MRI) at 3T including qualitative and quantitative analysis. Qualitative analysis included e.g. meniscal tears, joint effusion and bone edema. For quantitative analysis T2* (22 ET: 4.6-53.6 ms) measurements in 3D data acquisition were performed. Deep and superficial layers of 22 predefined cartilage segments were analysed. All data sets were postprocessed using a dedicated software tool. Statistical analysis included Student t-test, confidence intervals and a random effects model. Results: In both groups, T2* relaxation times were significantly higher in the superficial compared to the deep layers (p < 0.001). Professional athletes had significantly higher relaxation times in eight superficial and three deep cartilage layers in the predefined cartilage segments (p < 0.05). Highly significant differences were found in the weight-bearing segments of the lateral superficial femoral condyle (p < 0.001). Conclusion: Elevated T2* values in cartilage layers of professional football players compared to amateur athletes were noted. The effects seem to predominate in superficial cartilage layers.

  18. An open-source software tool for the generation of relaxation time maps in magnetic resonance imaging

    International Nuclear Information System (INIS)

    Messroghli, Daniel R; Rudolph, Andre; Abdel-Aty, Hassan; Wassmuth, Ralf; Kühne, Titus; Dietz, Rainer; Schulz-Menger, Jeanette

    2010-01-01

    In magnetic resonance (MR) imaging, T1, T2 and T2* relaxation times represent characteristic tissue properties that can be quantified with the help of specific imaging strategies. While there are basic software tools for specific pulse sequences, until now there is no universal software program available to automate pixel-wise mapping of relaxation times from various types of images or MR systems. Such a software program would allow researchers to test and compare new imaging strategies and thus would significantly facilitate research in the area of quantitative tissue characterization. After defining requirements for a universal MR mapping tool, a software program named MRmap was created using a high-level graphics language. Additional features include a manual registration tool for source images with motion artifacts and a tabular DICOM viewer to examine pulse sequence parameters. MRmap was successfully tested on three different computer platforms with image data from three different MR system manufacturers and five different sorts of pulse sequences: multi-image inversion recovery T1; Look-Locker/TOMROP T1; modified Look-Locker (MOLLI) T1; single-echo T2/T2*; and multi-echo T2/T2*. Computing times varied between 2 and 113 seconds. Estimates of relaxation times compared favorably to those obtained from non-automated curve fitting. Completed maps were exported in DICOM format and could be read in standard software packages used for analysis of clinical and research MR data. MRmap is a flexible cross-platform research tool that enables accurate mapping of relaxation times from various pulse sequences. The software allows researchers to optimize quantitative MR strategies in a manufacturer-independent fashion. The program and its source code were made available as open-source software on the internet

  19. An open-source software tool for the generation of relaxation time maps in magnetic resonance imaging

    Directory of Open Access Journals (Sweden)

    Kühne Titus

    2010-07-01

    Full Text Available Abstract Background In magnetic resonance (MR imaging, T1, T2 and T2* relaxation times represent characteristic tissue properties that can be quantified with the help of specific imaging strategies. While there are basic software tools for specific pulse sequences, until now there is no universal software program available to automate pixel-wise mapping of relaxation times from various types of images or MR systems. Such a software program would allow researchers to test and compare new imaging strategies and thus would significantly facilitate research in the area of quantitative tissue characterization. Results After defining requirements for a universal MR mapping tool, a software program named MRmap was created using a high-level graphics language. Additional features include a manual registration tool for source images with motion artifacts and a tabular DICOM viewer to examine pulse sequence parameters. MRmap was successfully tested on three different computer platforms with image data from three different MR system manufacturers and five different sorts of pulse sequences: multi-image inversion recovery T1; Look-Locker/TOMROP T1; modified Look-Locker (MOLLI T1; single-echo T2/T2*; and multi-echo T2/T2*. Computing times varied between 2 and 113 seconds. Estimates of relaxation times compared favorably to those obtained from non-automated curve fitting. Completed maps were exported in DICOM format and could be read in standard software packages used for analysis of clinical and research MR data. Conclusions MRmap is a flexible cross-platform research tool that enables accurate mapping of relaxation times from various pulse sequences. The software allows researchers to optimize quantitative MR strategies in a manufacturer-independent fashion. The program and its source code were made available as open-source software on the internet.

  20. The time-dependence of exchange-induced relaxation during modulated radio frequency pulses.

    Science.gov (United States)

    Sorce, Dennis J; Michaeli, Shalom; Garwood, Michael

    2006-03-01

    The problem of the relaxation of identical spins 1/2 induced by chemical exchange between spins with different chemical shifts in the presence of time-dependent RF irradiation (in the first rotating frame) is considered for the fast exchange regime. The solution for the time evolution under the chemical exchange Hamiltonian in the tilted doubly rotating frame (TDRF) is presented. Detailed derivation is specified to the case of a two-site chemical exchange system with complete randomization between jumps of the exchanging spins. The derived theory can be applied to describe the modulation of the chemical exchange relaxation rate constants when using a train of adiabatic pulses, such as the hyperbolic secant pulse. Theory presented is valid for quantification of the exchange-induced time-dependent rotating frame longitudinal T1rho,ex and transverse T2rho,ex relaxations in the fast chemical exchange regime.

  1. An analysis of the NMR-CT image by the measurement of proton-relaxation times in tissue

    International Nuclear Information System (INIS)

    Naruse, Shoji; Horikawa, Yoshiharu; Tanaka, Chuzo; Hirakawa, Kimiyoshi; Nishikawa, Hiroyasu; Shimizu, Koji; Kiri, Motosada.

    1984-01-01

    NMR-CT images were analyzed by measuring the proton-relaxation times in tissues. The NMR-CT images were obtained in 10 normal volunteers and 16 patients with brain tumors with a prototype superconducting magnet (Shimadzu Corp., Japan) operating at 0.2 T and 0.375 T. A smooth T 1 relaxation curve was obtained in each part of the brain and the brain tumor by the use of the data of the NMR-CT image; consequently, the in vivo T 1 value was proved to be reliable. The in vivo T 1 value showed the specific value corresponding to each region of the normal brain in all cases. Cerebral gray matter normally had the longest T 1 value, followed by the medulla oblongata, the pons, and white matter. The T 1 value of each region of the brain varied to the same degree in proportion to the strength of the static magnetic field. The in vivo T 1 values of the brain tumor varied with the histological type. All were longer than any part of the brain parenchyma, being between 480 and 780 msec at 0.2 T. The prolongation of the T 1 value does not always correspond to the degree of the malignancy in a tumor. The in vitro T 1 and T 2 values were also prolonged in all tumors. Although the absolute value of T 1 did not coincide between the in vitro and in vivo data, the tendency of the prolongation was the same between them. This result indicated that the NMR-CT images could be analysed by the use of the data of the in vitro T 1 and T 2 values in the tumor tissues. It is important to analyse the NMR-CT image by both in vivo and in vitro examinations of the relaxation times. (J.P.N.)

  2. Muon spin relaxation in ferromagnets. Pt. 1

    International Nuclear Information System (INIS)

    Lovesey, S.W.; Karlsson, E.B.

    1991-04-01

    Expressions for the dipolar and hyperfine contributions to the relaxation rate of muons implanted in a ferromagnet are presented and analysed using the Heisenberg model of spin-waves including dipolar and Zeeman energies. Calculations for EuO indicate that relaxation is likely to be dominated by the hyperfine mechanism, even if the ratio of the hyperfine and dipolar coupling constants is small. The hyperfine mechanism is sensitive to the dipolar energy of the atomic spins, whereas the dipolar mechanisms depend essentially on the exchange energy. For both mechanisms there is an almost quadratic dependence on temperature, throughout much of the ordered magnetic phase, which reflects two-spin-wave difference events from the Raman-type relaxation processes. (author)

  3. Repeatability of magnetic resonance fingerprinting T1 and T2 estimates assessed using the ISMRM/NIST MRI system phantom.

    Science.gov (United States)

    Jiang, Yun; Ma, Dan; Keenan, Kathryn E; Stupic, Karl F; Gulani, Vikas; Griswold, Mark A

    2017-10-01

    The purpose of this study was to evaluate accuracy and repeatability of T 1 and T 2 estimates of a MR fingerprinting (MRF) method using the ISMRM/NIST MRI system phantom. The ISMRM/NIST MRI system phantom contains multiple compartments with standardized T 1 , T 2 , and proton density values. Conventional inversion-recovery spin echo and spin echo methods were used to characterize the T 1 and T 2 values in the phantom. The phantom was scanned using the MRF-FISP method over 34 consecutive days. The mean T 1 and T 2 values were compared with the values from the spin echo methods. The repeatability was characterized as the coefficient of variation of the measurements over 34 days. T 1 and T 2 values from MRF-FISP over 34 days showed a strong linear correlation with the measurements from the spin echo methods (R 2  = 0.999 for T 1 ; R 2  = 0.996 for T 2 ). The MRF estimates over the wide ranges of T 1 and T 2 values have less than 5% variation, except for the shortest T 2 relaxation times where the method still maintains less than 8% variation. MRF measurements of T 1 and T 2 are highly repeatable over time and across wide ranges of T 1 and T 2 values. Magn Reson Med 78:1452-1457, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  4. MR imaging of patellar cartilage degeneration at 0.02 T

    International Nuclear Information System (INIS)

    Koskinen, S.K.; Komu, M.; Aho, H.J.; Kormano, M.; Turku University Hospital

    1991-01-01

    MR imaging with a 0.02 T resistive magnet was used to establish the correlation between the histologic grading of patellar cartilage degeneration and fat water separation images or T1- and T2-relaxation times. We examined 23 cadaveric patellae. There was a positive correlation between histologically graded cartilage degeneration and T1-relaxation time. Patellar cartilage was well differentiated from surrounding structures on chemical shift water proton images, and an evaluation of cartilage degeneration was possible. No correlation was found between cartilage degeneration damage and T2-relaxation time. Chemical shift imaging at 0.02 T is easy to perform and gives further information of cartilage disorders. (orig.)

  5. Thermal dissociation and relaxation in vinyl fluoride, 1,1-difluoroethane and 1,3,5-triazine

    Science.gov (United States)

    Xu, Hui

    This study reports measurements of the thermal dissociation of 1,1-difluoroethane in the shock tube. The experiments employ laser schlieren measurements of rate for the dominant HF elimination using 10% 1,1-difluoroethane in Kr over 1500--2000 K and 43 difluoroethane based on a G3B3 calculation of barrier and other properties fits the experiments but requires a very large down of 1600cm-1 . Dissociation of vinyl fluoride has two parallel HF eliminations both three-center and four-center with nearly equal barriers. An RRKM fit to the observed falloff again requires an unusually large down and the experiments actually support a slightly reduced barrier. Both 1,3,5-triazine and pyrazine relax extremely rapidly with energy transfer in a few collisions, any incubation delay can be confidently discounted in dissociation. 1,3,5-triazine dissociation experiments show fall-off with a clear pressure dependence. The three body product dissociation mechanism models this dissociation perfectly. Experimental data agree well with an RRKM calculation using a down of 1200cm-1 and a barrier E0 = 84.66 kcal/mol. Dyakov et al. suggested lower barrier of E0 = 81 kcal/mole. The new RRKM calculation using this barrier seems a better fit to the experiments. The falloff is now fit well with a down of the more usual form 126(T/298) 0-9 cm-1.

  6. NMR relaxation times in human brain tumors (preliminary results)

    International Nuclear Information System (INIS)

    Benoist, L.; Certaines, J. de; Chatel, M.; Menault, F.

    1981-01-01

    Since the early work of Damadian in 1971, proton NMR studies of tumors has been well documented. Present study concerns the spin-lattice T 1 and spin-spin T 2 relaxation times of normal dog brain according to the histological differentiation and of 35 human benignant or malignant tumors. The results principally show T 2 important variations between white and gray substance in normal brain but no discrimination between malignant and benignant tumors [fr

  7. Complex methyl groups dynamics in [(CH3)4P]3Sb2Br9 (PBA) from low to high temperatures by proton spin-lattice relaxation and narrowing of proton NMR spectrum.

    Science.gov (United States)

    Latanowicz, L; Medycki, W; Jakubas, R

    2009-11-01

    Molecular dynamics of a polycrystalline sample of [(CH(3))(4)P](3)Sb(2)Br(9) (PBA) has been studied on the basis of the T(1) (24.7 MHz) relaxation time measurement, the proton second moment of NMR and the earlier published T(1) (90 MHz) relaxation times. The study was performed in a wide range of temperatures (30-337 K). The tunnel splitting omega(T) of the methyl groups was estimated as of low frequency (from kHz to few MHz). The proton spin pairs of the methyl group are known to perform a complex internal motion being a resultant of four components. Three of them involve mass transportation over and through the potential barrier and are characterized by the correlation times tau(3) and tau(T)of the jumps over the barrier and tunnel jumps in the threefold potential of the methyl group and tau(iso) the correlation time of isotropic rotation of the whole TMP cation. For tau(3) and tau(iso) the Arrhenius temperature dependence was assumed, while for tau(T)--the Schrödinger one. The fourth motion causes fluctuations of the tunnel splitting frequency, omega(T), and it is related to the lifetime of the methyl spin at the energy level. The correlation function for this fourth motion (tau(omega) correlation time) has been proposed by Müller-Warmuth et al. In this paper a formula for the correlation function and spectral density of the complex motion made of the above-mentioned four components was derived and used in interpretation of the T(1) relaxation time. The second moment of proton NMR line at temperatures below 50K is four times lower than its value for the rigid structure. The three components of the internal motion characterized by tau(T), tau(H), and tau(iso) were proved to reduce the second moment of the NMR line. The tunnel jumps of the methyl group reduce M(2) at almost 0K, the classical jumps over the barrier reduce M(2) in the vicinity of 50K, while the isotropic motion near 150K. Results of the study on the dynamics of CH(3) groups of TMP cation based on

  8. Bacterial contamination of platelet components not detected by BacT/ALERT®.

    Science.gov (United States)

    Abela, M A; Fenning, S; Maguire, K A; Morris, K G

    2018-02-01

    To investigate the possible causes for false negative results in BacT/ALERT ® 3D Signature System despite bacterial contamination of platelet units. The Northern Ireland Blood Transfusion Service (NIBTS) routinely extends platelet component shelf life to 7 days. Components are sampled and screened for bacterial contamination using an automated microbial detection system, the BacT/ALERT ® 3D Signature System. We report on three platelet components with confirmed bacterial contamination, which represent false negative BacT/ALERT ® results and near-miss serious adverse events. NIBTS protocols for risk reduction of bacterial contamination of platelet components are described. The methodology for bacterial detection using BacT/ALERT ® is outlined. Laboratory tests, relevant patient details and relevant follow-up information are analysed. In all three cases, Staphylococcus aureus was isolated from the platelet residue and confirmed on terminal sub-culture using BacT/ALERT ® . In two cases, S. aureus with similar genetic makeup was isolated from the donors. Risk reduction measures for bacterial contamination of platelet components are not always effective. Automated bacterial culture detection does not eliminate the risk of bacterial contamination. Visual inspection of platelet components prior to release, issue and administration remains an important last line of defence. © 2017 British Blood Transfusion Society.

  9. Assessing the effects of subject motion on T2 relaxation under spin tagging (TRUST) cerebral oxygenation measurements using volume navigators.

    Science.gov (United States)

    Stout, Jeffrey N; Tisdall, M Dylan; McDaniel, Patrick; Gagoski, Borjan; Bolar, Divya S; Grant, Patricia Ellen; Adalsteinsson, Elfar

    2017-12-01

    Subject motion may cause errors in estimates of blood T 2 when using the T 2 -relaxation under spin tagging (TRUST) technique on noncompliant subjects like neonates. By incorporating 3D volume navigators (vNavs) into the TRUST pulse sequence, independent measurements of motion during scanning permit evaluation of these errors. The effects of integrated vNavs on TRUST-based T 2 estimates were evaluated using simulations and in vivo subject data. Two subjects were scanned with the TRUST+vNav sequence during prescribed movements. Mean motion scores were derived from vNavs and TRUST images, along with a metric of exponential fit quality. Regression analysis was performed between T 2 estimates and mean motion scores. Also, motion scores were determined from independent neonatal scans. vNavs negligibly affected venous blood T 2 estimates and better detected subject motion than fit quality metrics. Regression analysis showed that T 2 is biased upward by 4.1 ms per 1 mm of mean motion score. During neonatal scans, mean motion scores of 0.6 to 2.0 mm were detected. Motion during TRUST causes an overestimate of T 2 , which suggests a cautious approach when comparing TRUST-based cerebral oxygenation measurements of noncompliant subjects. Magn Reson Med 78:2283-2289, 2017. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  10. Evaluation of MRI sequences for quantitative T1 brain mapping

    Science.gov (United States)

    Tsialios, P.; Thrippleton, M.; Glatz, A.; Pernet, C.

    2017-11-01

    T1 mapping constitutes a quantitative MRI technique finding significant application in brain imaging. It allows evaluation of contrast uptake, blood perfusion, volume, providing a more specific biomarker of disease progression compared to conventional T1-weighted images. While there are many techniques for T1-mapping there is a wide range of reported T1-values in tissues, raising the issue of protocols reproducibility and standardization. The gold standard for obtaining T1-maps is based on acquiring IR-SE sequence. Widely used alternative sequences are IR-SE-EPI, VFA (DESPOT), DESPOT-HIFI and MP2RAGE that speed up scanning and fitting procedures. A custom MRI phantom was used to assess the reproducibility and accuracy of the different methods. All scans were performed using a 3T Siemens Prisma scanner. The acquired data processed using two different codes. The main difference was observed for VFA (DESPOT) which grossly overestimated T1 relaxation time by 214 ms [126 270] compared to the IR-SE sequence. MP2RAGE and DESPOT-HIFI sequences gave slightly shorter time than IR-SE (~20 to 30ms) and can be considered as alternative and time-efficient methods for acquiring accurate T1 maps of the human brain, while IR-SE-EPI gave identical result, at a cost of a lower image quality.

  11. Cartilage quality in rheumatoid arthritis: comparison of T2* mapping, native T1 mapping, dGEMRIC, ΔR1 and value of pre-contrast imaging

    International Nuclear Information System (INIS)

    Buchbender, Christian; Scherer, Axel; Kroepil, Patric; Quentin, Michael; Reichelt, Dorothea C.; Lanzman, Rotem S.; Mathys, Christian; Blondin, Dirk; Wittsack, Hans-Joerg; Antoch, Gerald; Miese, Falk; Koerbl, Birthe; Bittersohl, Bernd; Zilkens, Christoph; Hofer, Matthias; Schneider, Matthias; Ostendorf, Benedikt

    2012-01-01

    To prospectively evaluate four non-invasive markers of cartilage quality - T2* mapping, native T1 mapping, dGEMRIC and ΔR1 - in healthy volunteers and rheumatoid arthritis (RA) patients. Cartilage of metacarpophalangeal (MCP) joints II were imaged in 28 consecutive subjects: 12 healthy volunteers [9 women, mean (SD) age 52.67 (9.75) years, range 30-66] and 16 RA patients with MCP II involvement [12 women, mean (SD) age 58.06 (12.88) years, range 35-76]. Sagittal T2* mapping was performed with a multi-echo gradient-echo on a 3 T MRI scanner. For T1 mapping the dual flip angle method was applied prior to native T1 mapping and 40 min after gadolinium application (delayed gadolinium-enhanced MRI of cartilage, dGEMRIC, T1 Gd ). The difference in the longitudinal relaxation rate induced by gadolinium (ΔR1) was calculated. The area under the receiver operating characteristic curve (AROC) was used to test for differentiation of RA patients from healthy volunteers. dGEMRIC (AUC 0.81) and ΔR1 (AUC 0.75) significantly differentiated RA patients from controls. T2* mapping (AUC 0.66) and native T1 mapping (AUC 0.66) were not significantly different in RA patients compared to controls. The data support the use of dGEMRIC for the assessment of MCP joint cartilage quality in RA. T2* and native T1 mapping are of low diagnostic value. Pre-contrast T1 mapping for the calculation of ΔR1 does not increase the diagnostic value of dGEMRIC. (orig.)

  12. Cartilage quality in rheumatoid arthritis: comparison of T2* mapping, native T1 mapping, dGEMRIC, {delta}R1 and value of pre-contrast imaging

    Energy Technology Data Exchange (ETDEWEB)

    Buchbender, Christian; Scherer, Axel; Kroepil, Patric; Quentin, Michael; Reichelt, Dorothea C.; Lanzman, Rotem S.; Mathys, Christian; Blondin, Dirk; Wittsack, Hans-Joerg; Antoch, Gerald; Miese, Falk [University Duesseldorf, Department of Diagnostic and Interventional Radiology, Medical Faculty, Duesseldorf (Germany); Koerbl, Birthe [Heinrich-Heine-University, Department of Endocrinology, Diabetology and Rheumatology, Medical Faculty, Duesseldorf (Germany); Heinrich-Heine-University, Leibniz Centre for Diabetes Research, Institute of Biometrics and Epidemiology, German Diabetes Centre, Duesseldorf (Germany); Bittersohl, Bernd; Zilkens, Christoph [Heinrich-Heine-University, Department of Orthopaedics, Medical Faculty, Duesseldorf (Germany); Hofer, Matthias [Heinrich-Heine-University, Medical Education Group, Medical School, Duesseldorf (Germany); Schneider, Matthias; Ostendorf, Benedikt [Heinrich-Heine-University, Department of Endocrinology, Diabetology and Rheumatology, Medical Faculty, Duesseldorf (Germany)

    2012-06-15

    To prospectively evaluate four non-invasive markers of cartilage quality - T2* mapping, native T1 mapping, dGEMRIC and {delta}R1 - in healthy volunteers and rheumatoid arthritis (RA) patients. Cartilage of metacarpophalangeal (MCP) joints II were imaged in 28 consecutive subjects: 12 healthy volunteers [9 women, mean (SD) age 52.67 (9.75) years, range 30-66] and 16 RA patients with MCP II involvement [12 women, mean (SD) age 58.06 (12.88) years, range 35-76]. Sagittal T2* mapping was performed with a multi-echo gradient-echo on a 3 T MRI scanner. For T1 mapping the dual flip angle method was applied prior to native T1 mapping and 40 min after gadolinium application (delayed gadolinium-enhanced MRI of cartilage, dGEMRIC, T1{sub Gd}). The difference in the longitudinal relaxation rate induced by gadolinium ({delta}R1) was calculated. The area under the receiver operating characteristic curve (AROC) was used to test for differentiation of RA patients from healthy volunteers. dGEMRIC (AUC 0.81) and {delta}R1 (AUC 0.75) significantly differentiated RA patients from controls. T2* mapping (AUC 0.66) and native T1 mapping (AUC 0.66) were not significantly different in RA patients compared to controls. The data support the use of dGEMRIC for the assessment of MCP joint cartilage quality in RA. T2* and native T1 mapping are of low diagnostic value. Pre-contrast T1 mapping for the calculation of {delta}R1 does not increase the diagnostic value of dGEMRIC. (orig.)

  13. The spin relaxation of nitrogen donors in 6H SiC crystals as studied by the electron spin echo method

    Energy Technology Data Exchange (ETDEWEB)

    Savchenko, D., E-mail: dariyasavchenko@gmail.com [Institute of Physics of the Czech Academy of Sciences, Prague 182 21 (Czech Republic); National Technical University of Ukraine “Kyiv Polytechnic Institute,” Kyiv 03056 (Ukraine); Shanina, B.; Kalabukhova, E. [V.E. Lashkaryov Institute of Semiconductor Physics, NASU, Kyiv 03028 (Ukraine); Pöppl, A. [Institute of Experimental Physics II, Leipzig University, Leipzig D-04103 (Germany); Lančok, J. [Institute of Physics of the Czech Academy of Sciences, Prague 182 21 (Czech Republic); Mokhov, E. [A.F. Ioffe Physical Technical Institute, RAS, St. Petersburg 194021 (Russian Federation); Saint-Petersburg National Research University of Information Technologies, Mechanics and Optics, St. Petersburg 19710 (Russian Federation)

    2016-04-07

    We present the detailed study of the spin kinetics of the nitrogen (N) donor electrons in 6H SiC wafers grown by the Lely method and by the sublimation “sandwich method” (SSM) with a donor concentration of about 10{sup 17 }cm{sup −3} at T = 10–40 K. The donor electrons of the N donors substituting quasi-cubic “k1” and “k2” sites (N{sub k1,k2}) in both types of the samples revealed the similar temperature dependence of the spin-lattice relaxation rate (T{sub 1}{sup −1}), which was described by the direct one-phonon and two-phonon processes induced by the acoustic phonons proportional to T and to T{sup 9}, respectively. The character of the temperature dependence of the T{sub 1}{sup −1} for the donor electrons of N substituting hexagonal (“h”) site (N{sub h}) in both types of 6H SiC samples indicates that the donor electrons relax through the fast-relaxing centers by means of the cross-relaxation process. The observed enhancement of the phase memory relaxation rate (T{sub m}{sup −1}) with the temperature increase for the N{sub h} donors in both types of the samples, as well as for the N{sub k1,k2} donors in Lely grown 6H SiC, was explained by the growth of the free electron concentration with the temperature increase and their exchange scattering at the N donor centers. The observed significant shortening of the phase memory relaxation time T{sub m} for the N{sub k1,k2} donors in the SSM grown sample with the temperature lowering is caused by hopping motion of the electrons between the occupied and unoccupied states of the N donors at N{sub h} and N{sub k1,k2} sites. The impact of the N donor pairs, triads, distant donor pairs formed in n-type 6H SiC wafers on the spin relaxation times was discussed.

  14. Measurement of the exchange rate of waters of hydration in elastin by 2D T{sub 2}-T{sub 2} correlation nuclear magnetic resonance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Sun Cheng; Boutis, Gregory S, E-mail: gboutis@brooklyn.cuny.edu [Brooklyn College, Department of Physics, 2900 Bedford Avenue, Brooklyn, NY 11210 (United States)

    2011-02-15

    We report on a direct measurement of the exchange rate of waters of hydration in elastin by T{sub 2}-T{sub 2} exchange spectroscopy. The exchange rates in bovine nuchal ligament elastin and aortic elastin at temperatures near, below and at the physiological temperature are reported here. Using an inverse Laplace transform (ILT) algorithm, we are able to identify four components in the relaxation times. While three of the components are in good agreement with previous measurements that used multi-exponential fitting, the ILT algorithm distinguishes a fourth component having relaxation times close to that of free water and is identified as water between fibers. With the aid of scanning electron microscopy, a model is proposed that allows for the application of a two-site exchange analysis between any two components for the determination of exchange rates between reservoirs. The results of the measurements support a model (described by Urry and Parker 2002 J. Muscle Res. Cell Motil. 23 543-59) wherein the net entropy of waters of hydration should increase with increasing temperature in the inverse temperature transition.

  15. Nicotine impairs cyclooxygenase-2-dependent kinin-receptor-mediated murine airway relaxations

    International Nuclear Information System (INIS)

    Xu, Yuan; Cardell, Lars-Olaf

    2014-01-01

    Introduction: Cigarette smoke induces local inflammation and airway hyperreactivity. In asthmatics, it worsens the symptoms and increases the risk for exacerbation. The present study investigates the effects of nicotine on airway relaxations in isolated murine tracheal segments. Methods: Segments were cultured for 24 h in the presence of vehicle, nicotine (10 μM) and/or dexamethasone (1 μM). Airway relaxations were assessed in myographs after pre-contraction with carbachol (1 μM). Kinin receptors, cyclooxygenase (COX) and inflammatory mediator expressions were assessed by real-time PCR and confocal-microscopy-based immunohistochemistry. Results: The organ culture procedure markedly increased bradykinin- (selective B 2 receptor agonist) and des-Arg 9 -bradykinin- (selective B 1 receptor agonist) induced relaxations, and slightly increased relaxation induced by isoprenaline, but not that induced by PGE 2 . The kinin receptor mediated relaxations were epithelium-, COX-2- and EP2-receptor-dependent and accompanied by drastically enhanced mRNA levels of kinin receptors, as well as inflammatory mediators MCP-1 and iNOS. Increase in COX-2 and mPGES-1 was verified both at mRNA and protein levels. Nicotine selectively suppressed the organ-culture-enhanced relaxations induced by des-Arg 9 -bradykinin and bradykinin, at the same time reducing mPGES-1 mRNA and protein expressions. α7-nicotinic acetylcholine receptor inhibitors α-bungarotoxin and MG624 both blocked the nicotine effects on kinin B 2 receptors, but not those on B 1 . Dexamethasone completely abolished kinin-induced relaxations. Conclusion: It is tempting to conclude that a local inflammatory process per se could have a bronchoprotective component by increasing COX-2 mediated airway relaxations and that nicotine could impede this safety mechanism. Dexamethasone further reduced airway inflammation together with relaxations. This might contribute to the steroid resistance seen in some patients with asthma

  16. Nicotine impairs cyclooxygenase-2-dependent kinin-receptor-mediated murine airway relaxations

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Yuan, E-mail: yuan.xu@ki.se; Cardell, Lars-Olaf

    2014-02-15

    Introduction: Cigarette smoke induces local inflammation and airway hyperreactivity. In asthmatics, it worsens the symptoms and increases the risk for exacerbation. The present study investigates the effects of nicotine on airway relaxations in isolated murine tracheal segments. Methods: Segments were cultured for 24 h in the presence of vehicle, nicotine (10 μM) and/or dexamethasone (1 μM). Airway relaxations were assessed in myographs after pre-contraction with carbachol (1 μM). Kinin receptors, cyclooxygenase (COX) and inflammatory mediator expressions were assessed by real-time PCR and confocal-microscopy-based immunohistochemistry. Results: The organ culture procedure markedly increased bradykinin- (selective B{sub 2} receptor agonist) and des-Arg{sup 9}-bradykinin- (selective B{sub 1} receptor agonist) induced relaxations, and slightly increased relaxation induced by isoprenaline, but not that induced by PGE{sub 2}. The kinin receptor mediated relaxations were epithelium-, COX-2- and EP2-receptor-dependent and accompanied by drastically enhanced mRNA levels of kinin receptors, as well as inflammatory mediators MCP-1 and iNOS. Increase in COX-2 and mPGES-1 was verified both at mRNA and protein levels. Nicotine selectively suppressed the organ-culture-enhanced relaxations induced by des-Arg{sup 9}-bradykinin and bradykinin, at the same time reducing mPGES-1 mRNA and protein expressions. α7-nicotinic acetylcholine receptor inhibitors α-bungarotoxin and MG624 both blocked the nicotine effects on kinin B{sub 2} receptors, but not those on B{sub 1}. Dexamethasone completely abolished kinin-induced relaxations. Conclusion: It is tempting to conclude that a local inflammatory process per se could have a bronchoprotective component by increasing COX-2 mediated airway relaxations and that nicotine could impede this safety mechanism. Dexamethasone further reduced airway inflammation together with relaxations. This might contribute to the steroid resistance seen in

  17. Alterations of the cerebellum and basal ganglia in bipolar disorder mood states detected by quantitative T1ρ mapping.

    Science.gov (United States)

    Johnson, Casey P; Christensen, Gary E; Fiedorowicz, Jess G; Mani, Merry; Shaffer, Joseph J; Magnotta, Vincent A; Wemmie, John A

    2018-01-07

    Quantitative mapping of T1 relaxation in the rotating frame (T1ρ) is a magnetic resonance imaging technique sensitive to pH and other cellular and microstructural factors, and is a potentially valuable tool for identifying brain alterations in bipolar disorder. Recently, this technique identified differences in the cerebellum and cerebral white matter of euthymic patients vs healthy controls that were consistent with reduced pH in these regions, suggesting an underlying metabolic abnormality. The current study built upon this prior work to investigate brain T1ρ differences across euthymic, depressed, and manic mood states of bipolar disorder. Forty participants with bipolar I disorder and 29 healthy control participants matched for age and gender were enrolled. Participants with bipolar disorder were imaged in one or more mood states, yielding 27, 12, and 13 imaging sessions in euthymic, depressed, and manic mood states, respectively. Three-dimensional, whole-brain anatomical images and T1ρ maps were acquired for all participants, enabling voxel-wise evaluation of T1ρ differences between bipolar mood state and healthy control groups. All three mood state groups had increased T1ρ relaxation times in the cerebellum compared to the healthy control group. Additionally, the depressed and manic groups had reduced T1ρ relaxation times in and around the basal ganglia compared to the control and euthymic groups. The study implicated the cerebellum and basal ganglia in the pathophysiology of bipolar disorder and its mood states, the roles of which are relatively unexplored. These findings motivate further investigation of the underlying cause of the abnormalities, and the potential role of altered metabolic activity in these regions. © 2018 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. 1.48 GHz (34.8 T) ^1H NMR measurements of SDW fluctuations in (TMTSF)_2PF_6

    Science.gov (United States)

    Clark, W. G.; Vonlanthen, P.; Goto, A.; Tanaka, K. B.; Alavi, B.; Kuhns, P.; Reyes, A. P.; Moulton, W. G.

    2001-03-01

    We report ^1H spin-lattice relaxation rate (T_1-1) measurements that probe the spin-density-wave (SDW) fluctuations in the quasi 1-d system (TMTSF)_2PF6 up to 1.48 GHz (34.8 T) in the NHMFL hybrid magnet. In the critical regime above the SDW transition near 12 K, T_1-1 has no frequency dependence and the angular dependence of T_1-1 attributed to the spin-flop condition in the ordered phase is absent. These results indicate that amplitude fluctuations of the SDW drive T_1-1 in the critical regime and that the SDW critical fluctuation correlation time is <1× 10-10 s. Somewhat below the transition, T_1-1 continues the decrease with increasing NMR frequency observed at lower frequencies. We attribute it to the power spectrum of the SDW phason fluctuations. The dependence of T_1-1 upon the field orientation in this phase reflects the spin-flop condition, but with parameters that are different from the expected ones. The UCLA part of this work was supported by NSF Grants DMR-9705369 and DMR-0072524.

  19. Continuous monitoring of the zinc-phosphate acid-base cement setting reaction by proton nuclear magnetic relaxation

    International Nuclear Information System (INIS)

    Apih, T.; Lebar, A.; Pawlig, O.; Trettin, R.

    2001-01-01

    Proton nuclear magnetic relaxation is a well-established technique for continuous and non destructive monitoring of hydration of conventional Portland building cements. Here, we demonstrate the feasibility of nuclear magnetic resonance (NMR) monitoring of the setting reaction of zinc-phosphate acid-base dental cements, which harden in minutes as compared to days, as in the case of Portland cements. We compare the setting of cement powder (mainly, zinc oxide) prepared with clinically used aluminum-modified orthophosphoric acid solution with the setting of a model system where cement powder is mixed with pure orthophosphoric acid solution. In contrast to previously published NMR studies of setting Portland cements, where a decrease of spin-lattice relaxation time is attributed to enhanced relaxation at the growing internal surface, spin-lattice relaxation time T 1 increases during the set of clinically used zinc-phosphate cement. Comparison of these results with a detailed study of diffusion, viscosity, and magnetic-field dispersion of T 1 in pure and aluminum-modified orthophosphoric acid demonstrates that the increase of T 1 in the setting cement is connected with the increase of molecular mobility in the residual phosphoric acid solution. Although not taken into account so far, such effects may also significantly influence the relaxation times in setting Portland cements, particularly when admixtures with an effect on water viscosity are used. [copyright] 2001 American Institute of Physics

  20. Multi-Phonon Relaxation of H^- Local Modes in CaF_2

    Science.gov (United States)

    Davison, C. P.; Happek, U.; Campbell, J. A.; Engholm, J. R.; Schwettman, H. A.

    1998-03-01

    Local modes play an important role in the relaxation of vibrational modes of small molecules in solids (J.R. Engholm, C.W. Rella, H.A. Schwettman, and U. Happek; Phys. Rev. Lett. 77), 1302 (1996)., but only few attempts have been reported to study the relaxation of these local modes. Here we report on experiments to investigate the non-radiative relaxation of H^- local modes in CaF_2. Using a pump-probe technique, saturation experiments on the H^- local modes, both interstitial and substitutional, were performed at the Stanford Free Electron Laser Center. At low temperature we find a relaxation time T1 of 45 psec for the substitutional H^- local mode, and a more rapid relaxation for the interstitial H^- local modes next to La^3+ and Lu^3+ impurities. Information on the decay channels of the local modes are obtained from the characteristic temperature dependence of the relaxation rates. This work is supported in part by the ONR, Grant No. N00014-94-1024.

  1. Quantitative Renal Cortical Perfusion in Human Subjects with Magnetic Resonance Imaging Using Iron-Oxide Nanoparticles: Influence of T1 Shortening

    Energy Technology Data Exchange (ETDEWEB)

    Morell, A.; Ahlstrom, H.; Schoenberg, S.O.; Abildgaard, A.; Bock, M.; Bjoernerud, A. (Dept. of Diagnostic Radiology, Uppsala Univ. Hospital, Uppsala (Sweden))

    2008-10-15

    Background: Using conventional contrast agents, the technique of quantitative perfusion by observing the transport of a bolus with magnetic resonance imaging (MRI) is limited to the brain due to extravascular leakage. Purpose: To perform quantitative perfusion measurements in humans with an intravascular contrast agent, and to estimate the influence of the T1 relaxivity of the contrast agent on the first-pass response. Material and Methods: Renal cortical perfusion was measured quantitatively in six patients with unilateral renal artery stenosis using a rapid gradient double-echo sequence in combination with an intravenous bolus injection of NC100150 Injection, an intravascular contrast agent based on iron-oxide nanoparticles. The influence of T1 relaxivity was measured by comparing perfusion results based on single- and double-echo data. Results: The mean values of cortical blood flow, cortical blood volume, and mean transit time in the normal kidneys were measured to 339+-60 ml/min/100 g, 41+-8 ml/100 g, and 7.3+-1.0 s, respectively, based on double-echo data. The corresponding results based on single-echo data, which are not compensated for the T1 relaxivity, were 254+-47 ml/min/100 g, 27+-3 ml/100 g, and 6+-1.2 s, respectively. Conclusion: The use of a double-echo sequence enabled elimination of confounding T1 effects and consequent systematic underestimation of the perfusion.

  2. Upregulation of SK3 and IK1 channels contributes to the enhanced endothelial calcium signaling and the preserved coronary relaxation in obese Zucker rats.

    Directory of Open Access Journals (Sweden)

    Belén Climent

    Full Text Available Endothelial small- and intermediate-conductance KCa channels, SK3 and IK1, are key mediators in the endothelium-derived hyperpolarization and relaxation of vascular smooth muscle and also in the modulation of endothelial Ca2+ signaling and nitric oxide (NO release. Obesity is associated with endothelial dysfunction and impaired relaxation, although how obesity influences endothelial SK3/IK1 function is unclear. Therefore we assessed whether the role of these channels in the coronary circulation is altered in obese animals.In coronary arteries mounted in microvascular myographs, selective blockade of SK3/IK1 channels unmasked an increased contribution of these channels to the ACh- and to the exogenous NO- induced relaxations in arteries of Obese Zucker Rats (OZR compared to Lean Zucker Rats (LZR. Relaxant responses induced by the SK3/IK1 channel activator NS309 were enhanced in OZR and NO- endothelium-dependent in LZR, whereas an additional endothelium-independent relaxant component was found in OZR. Fura2-AM fluorescence revealed a larger ACh-induced intracellular Ca2+ mobilization in the endothelium of coronary arteries from OZR, which was inhibited by blockade of SK3/IK1 channels in both LZR and OZR. Western blot analysis showed an increased expression of SK3/IK1 channels in coronary arteries of OZR and immunohistochemistry suggested that it takes place predominantly in the endothelial layer.Obesity may induce activation of adaptive vascular mechanisms to preserve the dilator function in coronary arteries. Increased function and expression of SK3/IK1 channels by influencing endothelial Ca2+ dynamics might contribute to the unaltered endothelium-dependent coronary relaxation in the early stages of obesity.

  3. Nuclear spin-lattice relaxation in n -type insulating and metallic GaAs single crystals

    Science.gov (United States)

    Lu, J.; Hoch, M. J. R.; Kuhns, P. L.; Moulton, W. G.; Gan, Z.; Reyes, A. P.

    2006-09-01

    The coupling of electron and nuclear spins in n-GaAs changes significantly as the donor concentration n increases through the insulator-metal critical concentration nC˜1.2×1016cm-3 . The present measurements of the Ga71 relaxation rates W made as a function of magnetic field (1-13T) and temperature (1.5-300K) for semi-insulating GaAs and for three doped n-GaAs samples with donor concentrations n=5.9×1015 , 7×1016 , and 2×1018cm-3 , show marked changes in the relaxation behavior with n . Korringa-like relaxation is found in both metallic samples for T30K phonon-induced nuclear quadrupolar relaxation is dominant. The relaxation rate measurements permit determination of the electron probability density at Ga71 sites. A small Knight shift of -3.3ppm was measured on the most metallic (2×1018cm-3) sample using magic-angle spinning at room temperature. For the n=5.9×1015cm-3 sample, a nuclear relaxation model involving the Fermi contact hyperfine interaction, rapid spin diffusion, and exchange coupled local moments is proposed. While the relaxation rate behavior with temperature for the weakly metallic sample, n=7×1016cm-3 , is similar to that found for the just-insulating sample, the magnetic field dependence is quite different. For the 5.9×1015cm-3 sample, increasing the magnetic field leads to a decrease in the relaxation rate, while for the 7×1016cm-3 sample this results in an increase in the relaxation rate ascribed to an increase in the density of states at the Fermi level as the Landau level degeneracy is increased.

  4. Relaxation time of normal breast tissues. Changes with age and variations during the menstrual cycle

    International Nuclear Information System (INIS)

    Dean, K.I.; Majurin, M.L.; Komu, M.

    1994-01-01

    The influence of age on the relaxation times of normal breast parenchyma and its surrounding fatty tissue were evaluated, and the variations during a normal menstrual cycle were analyzed using an ultra low field 0.02 T imager. Thirty-nine healthy volunteers aged 21 to 59 years were examined to determine T1 and T2 relaxation times, and 8 of these volunteers were studied once weekly during one menstrual cycle. The only significant trend was an increase in the T2 of breast parenchyma with increasing age. During the menstrual cycle there was a slight but insignificant (p=0.10) increase in T1 of the breast parenchyma values during the latter half of the menstrual cycle, and a corresponding increase in T2 values between the 2nd and 3rd weeks of the menstrual cycle, which was significant. (orig.)

  5. Relaxation time of normal breast tissues. Changes with age and variations during the menstrual cycle

    Energy Technology Data Exchange (ETDEWEB)

    Dean, K.I. (University Central Hospital, Turku (Finland). Dept. of Diagnostic Radiology); Majurin, M.L. (University Central Hospital, Turku (Finland). Dept. of Diagnostic Radiology); Komu, M. (University Central Hospital, Turku (Finland). Dept. of Diagnostic Radiology)

    1994-05-01

    The influence of age on the relaxation times of normal breast parenchyma and its surrounding fatty tissue were evaluated, and the variations during a normal menstrual cycle were analyzed using an ultra low field 0.02 T imager. Thirty-nine healthy volunteers aged 21 to 59 years were examined to determine T1 and T2 relaxation times, and 8 of these volunteers were studied once weekly during one menstrual cycle. The only significant trend was an increase in the T2 of breast parenchyma with increasing age. During the menstrual cycle there was a slight but insignificant (p=0.10) increase in T1 of the breast parenchyma values during the latter half of the menstrual cycle, and a corresponding increase in T2 values between the 2nd and 3rd weeks of the menstrual cycle, which was significant. (orig.).

  6. The influence of microvascular injury on native T1 and T2* relaxation values after acute myocardial infarction: implications for non-contrast-enhanced infarct assessment.

    Science.gov (United States)

    Robbers, Lourens F H J; Nijveldt, Robin; Beek, Aernout M; Teunissen, Paul F A; Hollander, Maurits R; Biesbroek, P Stefan; Everaars, Henk; van de Ven, Peter M; Hofman, Mark B M; van Royen, Niels; van Rossum, Albert C

    2018-02-01

    Native T1 mapping and late gadolinium enhancement (LGE) imaging offer detailed characterisation of the myocardium after acute myocardial infarction (AMI). We evaluated the effects of microvascular injury (MVI) and intramyocardial haemorrhage on local T1 and T2* values in patients with a reperfused AMI. Forty-three patients after reperfused AMI underwent cardiovascular magnetic resonance imaging (CMR) at 4 [3-5] days, including native MOLLI T1 and T2* mapping, STIR, cine imaging and LGE. T1 and T2* values were determined in LGE-defined regions of interest: the MI core incorporating MVI when present, the core-adjacent MI border zone (without any areas of MVI), and remote myocardium. Average T1 in the MI core was higher than in the MI border zone and remote myocardium. However, in the 20 (47%) patients with MVI, MI core T1 was lower than in patients without MVI (MVI 1048±78ms, no MVI 1111±89ms, p=0.02). MI core T2* was significantly lower in patients with MVI than in those without (MVI 20 [18-23]ms, no MVI 31 [26-39]ms, pvalues. T2* mapping suggested that this may be the result of intramyocardial haemorrhage. These findings have important implications for the interpretation of native T1 values shortly after AMI. • Microvascular injury after acute myocardial infarction affects local T1 and T2* values. • Infarct zone T1 values are lower if microvascular injury is present. • T2* mapping suggests that low infarct T1 values are likely haemorrhage. • T1 and T2* values are complimentary for correctly assessing post-infarct myocardium.

  7. Relaxation time measurements of white and grey matter in multiple sclerosis patients

    International Nuclear Information System (INIS)

    Rinck, P.A.; Appel, B.; Moens, E.; Academisch Ziekenhuis Middelheim, Antwerp

    1987-01-01

    In a patient population of some 450 with definite, probable, and possible multiple sclerosis referred to us for MRI, some 40 suffering from definite MS were chosen randomly for relaxation time measurements of plaque-free grey and white matter. T 1 values could not be used for diagnostic purposes owing to their broad standard deviation. Overall white matter T 2 was slightly higher in MS patients than in a non-MS population (94 ms versus 89 ms). Because these changes are not visible in MR images, relaxation time measurements may prove valuable for differential diagnosis. (orig.) [de

  8. 31-P Relaxation times of metabolic compounds in tumors grafted in nude mice

    International Nuclear Information System (INIS)

    Remy, C.; Benabid, A.L.; Jacrot, M.; Riondel, J.; Albrand, J.P.; Decorps, M.

    1985-08-01

    The observation that water proton relaxation rates were longer in tumors than in normal tissues provided a basis for the detection of human tumors by the NMR imaging technique. To evaluate the potentiality of 31-P NMR spectroscopy as a diagnostic tool of the pathological state of tissues, T1 and T2 relaxation times have been measured for the phosphates of ATP, inorganic phosphate (Pi), phosphomonoesters (PME) and phosphocreatine (PCr) in the 31-P NMR spectra obtained in vivo for normal rat brain and rat brain tumors implanted in nude mice

  9. Stress Relaxation in Entangled Polymer Melts

    DEFF Research Database (Denmark)

    Hou, Ji-Xuan; Svaneborg, Carsten; Everaers, Ralf

    2010-01-01

    We present an extensive set of simulation results for the stress relaxation in equilibrium and step-strained bead-spring polymer melts. The data allow us to explore the chain dynamics and the shear relaxation modulus, G(t), into the plateau regime for chains with Z=40 entanglements...... and into the terminal relaxation regime for Z=10. Using the known (Rouse) mobility of unentangled chains and the melt entanglement length determined via the primitive path analysis of the microscopic topological state of our systems, we have performed parameter-free tests of several different tube models. We find...

  10. Cardiac MOLLI T1 mapping at 3.0 T: comparison of patient-adaptive dual-source RF and conventional RF transmission.

    Science.gov (United States)

    Rasper, Michael; Nadjiri, Jonathan; Sträter, Alexandra S; Settles, Marcus; Laugwitz, Karl-Ludwig; Rummeny, Ernst J; Huber, Armin M

    2017-06-01

    To prospectively compare image quality and myocardial T 1 relaxation times of modified Look-Locker inversion recovery (MOLLI) imaging at 3.0 T (T) acquired with patient-adaptive dual-source (DS) and conventional single-source (SS) radiofrequency (RF) transmission. Pre- and post-contrast MOLLI T 1 mapping using SS and DS was acquired in 27 patients. Patient wise and segment wise analysis of T 1 times was performed. The correlation of DS MOLLI measurements with a reference spin echo sequence was analysed in phantom experiments. DS MOLLI imaging reduced T 1 standard deviation in 14 out of 16 myocardial segments (87.5%). Significant reduction of T 1 variance could be obtained in 7 segments (43.8%). DS significantly reduced myocardial T 1 variance in 16 out of 25 patients (64.0%). With conventional RF transmission, dielectric shading artefacts occurred in six patients causing diagnostic uncertainty. No according artefacts were found on DS images. DS image findings were in accordance with conventional T 1 mapping and late gadolinium enhancement (LGE) imaging. Phantom experiments demonstrated good correlation of myocardial T 1 time between DS MOLLI and spin echo imaging. Dual-source RF transmission enhances myocardial T 1 homogeneity in MOLLI imaging at 3.0 T. The reduction of signal inhomogeneities and artefacts due to dielectric shading is likely to enhance diagnostic confidence.

  11. Tension and relaxation in the individual.

    Science.gov (United States)

    Newbury, C R

    1979-06-01

    Increasing materialism in society is resulting in more wide spread nervous tension in all age groups. While some degree of nervous tension is necessary in everyday living, its adverse effects require that we must learn to bring it under control. Total tension is shown to have two components: a controllable element arising from factors in the environment and the inbuilt uncontrollable residue which is basic in the individual temperament. The effects of excessive or uncontrolled stress can be classified as 1) emotional reactions such as neurotic behaviour (anxiety hypochondria, hysteria, phobia, depression obsessions and compulsions) or psychotic behaviour and 2) psychosomatic reactions (nervous asthma, headache, insomnia, heart attack). Nervous energy can be wastefully expended by such factors as loss of temper, wrong attitudes to work, job frustration and marital strains. Relaxation is the only positive way to control undesirable nervous tension and its techniques require to be learned. A number of techniques (progressive relaxation, differential relaxation, hypnosis, the use of biofeedback, Yoga and Transcendental Meditation) are described and their application to dental practice is discussed.

  12. Nuclear magnetic relaxation induced by exchange-mediated orientational randomization: longitudinal relaxation dispersion for spin I = 1.

    Science.gov (United States)

    Nilsson, Tomas; Halle, Bertil

    2012-08-07

    The frequency dependence of the longitudinal relaxation rate, known as the magnetic relaxation dispersion (MRD), can provide a frequency-resolved characterization of molecular motions in complex biological and colloidal systems on time scales ranging from 1 ns to 100 μs. The conformational dynamics of immobilized proteins and other biopolymers can thus be probed in vitro or in vivo by exploiting internal water molecules or labile hydrogens that exchange with a dominant bulk water pool. Numerous water (1)H and (2)H MRD studies of such systems have been reported, but the widely different theoretical models currently used to analyze the MRD data have resulted in divergent views of the underlying molecular motions. We have argued that the essential mechanism responsible for the main dispersion is the exchange-mediated orientational randomization (EMOR) of anisotropic nuclear (electric quadrupole or magnetic dipole) couplings when internal water molecules or labile hydrogens escape from orientationally confining macromolecular sites. In the EMOR model, the exchange process is thus not just a means of mixing spin populations but it is also the direct cause of spin relaxation. Although the EMOR theory has been used in several studies to analyze water (2)H MRD data from immobilized biopolymers, the fully developed theory has not been described. Here, we present a comprehensive account of a generalized version of the EMOR theory for spin I = 1 nuclides like (2)H. As compared to a previously described version of the EMOR theory, the present version incorporates three generalizations that are all essential in applications to experimental data: (i) a biaxial (residual) electric field gradient tensor, (ii) direct and indirect effects of internal motions, and (iii) multiple sites with different exchange rates. In addition, we describe and assess different approximations to the exact EMOR theory that are useful in various regimes. In particular, we consider the experimentally

  13. In vivo 1D and 2D correlation MR spectroscopy of the soleus muscle at 7T

    Science.gov (United States)

    Ramadan, Saadallah; Ratai, Eva-Maria; Wald, Lawrence L.; Mountford, Carolyn E.

    2010-05-01

    AimThis study aims to (1) undertake and analyse 1D and 2D MR correlation spectroscopy from human soleus muscle in vivo at 7T, and (2) determine T1 and T2 relaxation time constants at 7T field strength due to their importance in sequence design and spectral quantitation. MethodSix healthy, male volunteers were consented and scanned on a 7T whole-body scanner (Siemens AG, Erlangen, Germany). Experiments were undertaken using a 28 cm diameter detunable birdcage coil for signal excitation and an 8.5 cm diameter surface coil for signal reception. The relaxation time constants, T1 and T2 were recorded using a STEAM sequence, using the 'progressive saturation' method for the T1 and multiple echo times for T2. The 2D L-Correlated SpectroscopY (L-COSY) method was employed with 64 increments (0.4 ms increment size) and eight averages per scan, with a total time of 17 min. ResultsT1 and T2 values for the metabolites of interest were determined. The L-COSY spectra obtained from the soleus muscle provided information on lipid content and chemical structure not available, in vivo, at lower field strengths. All molecular fragments within multiple lipid compartments were chemically shifted by 0.20-0.26 ppm at this field strength. 1D and 2D L-COSY spectra were assigned and proton connectivities were confirmed with the 2D method. ConclusionIn vivo 1D and 2D spectroscopic examination of muscle can be successfully recorded at 7T and is now available to assess lipid alterations as well as other metabolites present with disease. T1 and T2 values were also determined in soleus muscle of male healthy volunteers.

  14. Evidence for power-law spin-correlation decay from muon spin relaxation in AgMn spin-glass

    International Nuclear Information System (INIS)

    MacLaughlin, D.E.; Gupta, L.C.; Cooke, D.W.; Heffner, R.H.; Leon, M.; Schillaci, M.E.

    1983-01-01

    Muon spin relaxation measurements have been carried out below the ''glass'' temperature T/sub g/ in AgMn spin-glasses. The muon spin-lattice relaxation rate varies with field H as H/sup -0.46plus-or-minus0.05/ for 0.30< or =T/T/sub g/< or =0.66. This suggests that impurity-spin correlations decay with time as t/sup -nu/, νapprox. =0.54 +- 0.05, in contrast to the more usual exponential decay. The present data therefore agree quantitatively with the prediction νapprox. =(1/2) of mean-field dynamic theories

  15. Curie-type paramagnetic NMR relaxation in the aqueous solution of Ni(II).

    Science.gov (United States)

    Mareš, Jiří; Hanni, Matti; Lantto, Perttu; Lounila, Juhani; Vaara, Juha

    2014-04-21

    Ni(2+)(aq) has been used for many decades as a model system for paramagnetic nuclear magnetic resonance (pNMR) relaxation studies. More recently, its magnetic properties and also nuclear magnetic relaxation rates have been studied computationally. We have calculated electron paramagnetic resonance and NMR parameters using quantum-mechanical (QM) computation of molecular dynamics snapshots, obtained using a polarizable empirical force field. Statistical averages of hyperfine coupling, g- and zero-field splitting tensors, as well as the pNMR shielding terms, are compared to the available experimental and computational data. In accordance with our previous work, the isotropic hyperfine coupling as well as nuclear shielding values agree well with experimental measurements for the (17)O nuclei of water molecules in the first solvation shell of the nickel ion, whereas larger deviations are found for (1)H centers. We report, for the first time, the Curie-type contribution to the pNMR relaxation rate using QM calculations together with Redfield relaxation theory. The Curie relaxation mechanism is analogous to chemical shift anisotropy relaxation, well-known in diamagnetic NMR. Due to the predominance of other types of paramagnetic relaxation mechanisms for this system, it is possible to extract the Curie term only computationally. The Curie mechanism alone would result in around 16 and 20 s(-1) of relaxation rates (R1 and R2 respectively) for the (1)H nuclei of water molecules bonded to the Ni(2+) center, in a magnetic field of 11.7 T. The corresponding (17)O relaxation rates are around 33 and 38 s(-1). We also report the Curie contribution to the relaxation rate for molecules beyond the first solvation shell in a 1 M solution of Ni(2+) in water.

  16. Thermal Fluctuations in the Magnetic Ground State of the Molecular Cluster Mn12O12 Acetate from μSR and Proton NMR Relaxation

    International Nuclear Information System (INIS)

    Lascialfari, A.; Borsa, F.; Carretta, P.; Jang, Z.H.; Borsa, F.; Gatteschi, D.

    1998-01-01

    Measurements of the spin-lattice relaxation rate are reported for muons and protons as a function of temperature for different values of the applied magnetic field in the Mn 12 O 12 molecular cluster. Strongly field dependent maxima in the relaxation rate versus temperature are observed below 50thinspthinspK. The results are explained in terms of thermal fluctuations of the total magnetization of the cluster among the different orientations with respect to the anisotropy axis. The lifetimes of the different m components of the total spin, S T =10 , of the molecule are obtained from the experiment and shown to be consistent with the ones expected from a spin-phonon coupling mechanism. No clear evidence for macroscopic quantum tunneling was observed in the field dependence of the proton relaxation rate at low T . copyright 1998 The American Physical Society

  17. What is the most suitable MR signal index for quantitative evaluation of placental function using Half-Fourier acquisition single-shot turbo spin-echo compared with T2-relaxation time?

    Science.gov (United States)

    Kameyama, Kyoko Nakao; Kido, Aki; Himoto, Yuki; Moribata, Yusaku; Minamiguchi, Sachiko; Konishi, Ikuo; Togashi, Kaori

    2018-06-01

    Background Half-Fourier acquisition single-shot turbo spin-echo (HASTE) imaging is now widely used for placental and fetal imaging because of its rapidity and low sensitivity to fetal movement. If placental dysfunction is also predicted by quantitative value obtained from HASTE image, then it might be beneficial for evaluating placental wellbeing. Purpose To ascertain the most suitable magnetic resonance (MR) signal indexes reflecting placental function using HASTE imaging. Material and Methods This retrospective study included 37 consequent patients who had given informed consent to MR imaging (MRI) examinations. All had undergone MRI examinations between February 2014 and June 2015. First, the correlation between T2-relaxation time of normal placenta and gestational age (GA) was examined. Second, correlation between signal intensity ratios (SIRs) using HASTE imaging and placental T2-relaxation time were assessed. The SIRs were calculated using placental signal intensity (SI) relative to the SI of the amniotic fluid, fetal ocular globes, gastric fluid, bladder, maternal psoas major muscles, and abdominal subcutaneous adipose tissue. Results Among the 37 patients, the correlation between T2-relaxation time of the 25 normal placentas and GA showed a moderately strong correlation (Spearman rho = -0.447, P = 0.0250). The most significant correlation with placental T2-relaxation time was observed with the placental SIR relative to the maternal psoas major muscles (SIR pl./psoas muscle ) (Spearman rho = -0.531, P = 0.0007). Conclusion This study revealed that SIR pl./psoas muscle showed the best correlation to placental T2-relaxation time. Results show that SIR pl./psoas muscle might be optimal as a clinically available quantitative index of placental function.

  18. A statistical correlation investigation for the role of surface spins to the spin relaxation of nitrogen vacancy centers

    Energy Technology Data Exchange (ETDEWEB)

    Song, Xuerui; Zhang, Jian; Feng, Fupan; Wang, Junfeng; Zhang, Wenlong; Lou, Liren; Zhu, Wei; Wang, Guanzhong, E-mail: gzwang@ustc.edu.cn [Hefei National Laboratory for Physical Science at Microscale, and Department of Physics, University of Science and Technology of China, Hefei, Anhui, 230026 (China)

    2014-04-15

    We investigated the influence of spins on surface of nanodiamonds (NDs) to the longitudinal relaxation time (T{sub 1}) and transverse relaxation time (T{sub 2}) of nitrogen vacancy (NV) centers in ND. A spherical model of the NDs was suggested to account for the experimental results of T{sub 1} and T{sub 2}, and the density of surface spins was roughly estimated based on the statistical analysis of experimental results of 72 NDs containing a single NV center. For NDs studied here, the T{sub 1} of NV center inside is highly dependent to the surface spins of the NDs. However, for the T{sub 2} of NV center, intrinsic contributions must be much pronounced than that by surface spins. In other words, T{sub 1} of an NV center in NDs is more sensitive to the change of the surface spin density than T{sub 2}.

  19. A statistical correlation investigation for the role of surface spins to the spin relaxation of nitrogen vacancy centers

    Directory of Open Access Journals (Sweden)

    Xuerui Song

    2014-04-01

    Full Text Available We investigated the influence of spins on surface of nanodiamonds (NDs to the longitudinal relaxation time (T1 and transverse relaxation time (T2 of nitrogen vacancy (NV centers in ND. A spherical model of the NDs was suggested to account for the experimental results of T1 and T2, and the density of surface spins was roughly estimated based on the statistical analysis of experimental results of 72 NDs containing a single NV center. For NDs studied here, the T1 of NV center inside is highly dependent to the surface spins of the NDs. However, for the T2 of NV center, intrinsic contributions must be much pronounced than that by surface spins. In other words, T1 of an NV center in NDs is more sensitive to the change of the surface spin density than T2.

  20. Follow-up of regional myocardial T2 relaxation times in patients with myocardial infarction evaluated with magnetic resonance imaging

    International Nuclear Information System (INIS)

    Krauss, X.H.; Wall, E. van der; Laarse, A. van der; Dijkman, P.R.M. van; Bruschke, A.V.G.; Doornbos, J.; Roos, A. de; Voorthuisen, A.E. van

    1990-01-01

    Multi-echo spin-echo cardiac magnetic resonance imaging studies (echo times 30, 60, 90 and 120 ms) were performed in 19 patients with a 7-14-day (mean 10) old myocardial infarction and were repeated in 13 patients 4-7 months (mean 6) later. Also, 10 normal subjects were studied with magnetic resonance imaging. T2 relaxation times of certain left ventricular segments were calculated from the signal intensities at echo times of 30 and 90 ms. Compared to normal individuals, the mean T2 values on the early magnetic resonance images of the patients with inferior infarction showed significantly prolonged T2 times in the inferiorly localized segments, while on the follow-up magnetic resonance images the T2 times had almost returned to the normal range. Also the patients with anterior infarction showed significantly prolonged T2 times in the anteriorly localized segments on the early nuclear magnetic resonance images, but the T2 times remained prolonged at the follow-up magnetic resonance images. For every patient a myocardial damage score was determined, which was defined as the sum of the segmental T2 values in the patients minus the upper limit of normal T2 values obtained from the normal volunteers (= mean normal+2SD). The damage score on both the early and late magnetic resonance imaging study correlated well with the infarction size determined by myocardial enzyme release. Only the patients with an inferior infarction showed a significant decrease in damage score at follow-up magnetic resonance imaging. It is concluded that the regional T2 relaxation times are increased in infarcted myocardial regions and may remain prolonged for at least up to 7 months after the acute event, particularly in patients with an anterior infarction. These findings demonstrate the clinical potential of T2-weighted magnetic resonance imaging studies for detecting myocardial infarction, and estimating infarct size for an extended period after acute myocardial infarction. (author). 29 refs

  1. Relaxation therapy and anxiety, self-esteem, and emotional regulation among adults with intellectual disabilities: A randomized controlled trial.

    Science.gov (United States)

    Bouvet, Cyrille; Coulet, Aurélie

    2016-09-01

    This pilot study is a randomized controlled trial on the effects of relaxation on anxiety, self-esteem, and emotional regulation in adults with intellectual disabilities (ID) working in a center of supported employment in France. We studied 30 adults with mild or moderate ID who were split at random into a relaxation group (RG, 15 subjects), who completed 10 sessions of relaxation therapy, and a control group (CG, 15 subjects), who were on a waiting list. The method used is the pretest and posttest. Variables were assessed by the State-Trait Anxiety Inventory form Y scale, the Rosenberg Self-Esteem scale, and the Emotion Regulation Questionnaire. We found that in the RG, relaxation significantly reduced state anxiety, t(14, 15) = 17.8***, d = -0.72, and improved self-esteem, t(14, 15) = -7.7***, d = 1.03, and cognitive reappraisal, t(14, 15) = -6.3***, d = 1.3, while the CG showed no change for these variables. We conclude that relaxation seems to be an interesting therapeutic option for reducing anxiety in people with ID in a supported employment setting. © The Author(s) 2015.

  2. Towards quantitative measurements of relaxation times and other parameters in the brain

    International Nuclear Information System (INIS)

    Tofts, P.S.; Du Boulay, E.P.G.H.

    1990-01-01

    The nature and physical significance of the relaxation times T1 and T2 and of proton density are described. Methods of measuring T1 and T2 are discussed with emphasis on the establishment of precision and the maintenance of accuracy. Reported standards of success are briefly reviewed. We expect sensitivities of the order of 1% to be achievable in serial studies. Although early hopes of disease diagnosis by tissue characterisation were not realised, strict scientific method and careful calibration have made it pracitcable to apply relaxation time measurement to research into disease process. Serial measurements in patients and correlation with similar studies in animal models, biopsy results and autopsy material taken together have provided new knowledge about cerebral oedema, water compartmentation, alcoholism and the natural history of multiple sclerosis. There are prospects of using measurement to monitor treatment in other diseases with diffuse brain abnormalities invisible on the usual images. Secondarily derived parameters and notably the quantification of blood-brain barrier defect after injection of Gadolinium-DTPA also offer prospects of valuable data. (orig.)

  3. Evaluation of PHB/Clay nanocomposite by spin-lattice relaxation time

    Directory of Open Access Journals (Sweden)

    Mariana Bruno

    2008-12-01

    Full Text Available Poly(3-hydroxybutyrate (PHB based on nanocomposites containing different amounts of a commercial organically modified clay (viscogel B7 were prepared employing solution intercalation method. Three solvents, such as: CHCl3, dimethylchloride (DMC and tetrahydrofuran (THF were used. The relationship among the processing conditions; molecular structure and intermolecular interaction, between both nanocomposite components, were investigated using a nuclear magnetic resonance (NMR, as a part of characterization methodology, which has been used by Tavares et al. It involves the hydrogen spin-lattice relaxation time, T1H, by solid state nuclear magnetic resonance, employing low field NMR. X ray diffraction was also employed because it is a conventional technique, generally used to obtain the first information on nanocomposite formation. Changes in PHB crystallinity were observed after the organophilic nanoclay had been incorporated in the polymer matrix. These changes, in the microstructure, were detected by the variation of hydrogen nuclear relaxation time values and by X ray, which showed an increase in the clay interlamelar space due to the intercalation of the polymer in the clay between lamellae. It was also observed, for both techniques, that the solvents affect directly the organization of the crystalline region, promoting a better intercalation, considering that they behave like a plasticizer.

  4. $^{11}$B and $^{27}$Al NMR spin-lattice relaxation and Knight shift study of Mg$_{1-x}$Al$_x$B$_2$. Evidence for anisotropic Fermi surface

    OpenAIRE

    Papavassiliou, G.; Pissas, M.; Karayanni, M.; Fardis, M.; Koutandos, S.; Prassides, K.

    2002-01-01

    We report a detailed study of $^{11}$B and $^{27}$Al NMR spin-lattice relaxation rates ($1/T_1$), as well as of $^{27}$Al Knight shift (K) of Mg$_{1-x}$Al$_x$B$_2$, $0\\leq x\\leq 1$. The obtained ($1/T_1T$) and K vs. x plots are in excellent agreement with ab initio calculations. This asserts experimentally the prediction that the Fermi surface is highly anisotropic, consisting mainly of hole-type 2-D cylindrical sheets from bonding $2p_{x,y}$ boron orbitals. It is also shown that the density ...

  5. Detection of early gamma-postirradiation effects in murine spleen by proton NMR relaxation times.

    Science.gov (United States)

    Zebrowska, G; Lewa, C J; Ramee, M P; Husson, F; De Certaines, J D

    2001-01-01

    It was our aim to evaluate the potential of proton relaxation times for the early detection of radiation-induced spleen changes. Female Swiss mice were irradiated with doses ranging from 0.05 Gy to 4 Gy. The body weight, the spleen weight and the spleen water content of single animals were determined. Measurements of longitudinal (T1) and transversal (T2) proton relaxation times of the spleen samples were performed in a 0.47 T spectrometer. Histological examinations of the control and irradiated organs were performed. NMR measurements during the first five days after irradiation showed that total body gamma-irradiation with doses from 1.5 Gy to 4 Gy results in decreasing T1 of the murine spleen. Significant shortening in T2 was observed for the spleen of animals irradiated with a dose of 4 Gy. Histological examinations demonstrated subnormal architecture in slices derived from animals irradiated with 2 Gy and 4 Gy. The fluctuations of the spleen T1 and T2 of irradiated mice are correlated with relative spleen weight and can be used to estimate radiation induced changes in this organ.

  6. Spin-Relaxation Anisotropy in a GaAs Quantum Dot

    NARCIS (Netherlands)

    Scarlino, P.; Kawakami, E.; Stano, P.; Shafiei, M.; Reichl, C.; Wegscheider, W.; Vandersypen, L.M.K.

    2014-01-01

    We report that the electron spin-relaxation time T1 in a GaAs quantum dot with a spin-1/2 ground state has a 180° periodicity in the orientation of the in-plane magnetic field. This periodicity has been predicted for circular dots as being due to the interplay of Rashba and Dresselhaus spin orbit

  7. Magnetization and 13C NMR spin-lattice relaxation of nanodiamond powder

    Energy Technology Data Exchange (ETDEWEB)

    Levin, E.M.; Fang, X.W.; Bud' ko, S.L.; Straszheim, W.E.; McCallum, R.W.; Schmidt-Rohr, K.

    2008-02-15

    The bulk magnetization at temperatures of 1.8-400 K and in magnetic fields up to 70 kOe, the ambient temperature {sup 13}C NMR spin-lattice relaxation, T{sub 1,c}, and the elemental composition of three nanodiamond powder samples have been studied. The total magnetization of nanodiamond can be explained in terms of contributions from (1) the diamagnetic effect of carbon, (2) the paramagnetic effect of unpaired electrons present in nanodiamond grains, and (3) ferromagnetic-like and (4) superparamagnetic contributions from Fe-containing particles detected in spatially resolved energy-dispersive spectroscopy. Contributions (1) and (2) are intrinsic to nanodiamond, while contributions (3) and (4) arise from impurities naturally present in detonation nanodiamond samples. {sup 13}C NMR T{sub 1,c} relaxation would be unaffected by the presence of the ferromagnetic particles with the bulk magnetization of {approx} 0.01 emu/g at 300 K. Thus, a reduction of T{sub 1,c} by 3 orders of magnitude compared to natural and synthetic microdiamonds confirms the presence of unpaired electrons in the nanodiamond grains. The spin concentration in nanodiamond powder corresponds to {approx}30 unpaired electrons per {approx}4.6 nm diameter nanodiamond grain.

  8. Coaxial helicity injection and n=1 relaxation activity in the HIST spherical torus

    International Nuclear Information System (INIS)

    Nagata, M.; Oguro, T.; Kagei, Y.

    2003-01-01

    In order to understand comprehensively the role of the n=1 instability and relaxation on current generation processes in helicity-driven spherical systems, we have investigated dynamics of ST plasmas produced in the HIST device by decreasing the external toroidal field (TF) and reversing its sign in time. In result, we have discovered that the ST relaxes towards flipped ST configurations through formation of reversed-field pinches (RFPs)-like magnetic field profiles. Surprisingly, it has been observed that not only toroidal flux but also poloidal flux reverses sign spontaneously during the relaxation process. The dynamics associated to self-reversal of the magnetic fields is presently investigated by using three-dimensional magnetohydrodynamic (MHD) numerical simulations. Furthermore, we have first demonstrated that a flipped ST plasma can be successfully sustained by CHI. The n=1 relaxation activity is found to be essential in the current sustainment of the flipped ST as well as the spheromak and the unflipped ST. (author)

  9. Proton spin-lattice relaxation in a liquid crystal-Aerosil complex above the bulk isotropization temperature

    Energy Technology Data Exchange (ETDEWEB)

    Anoardo, E.; Grinberg, F.; Vilfan, M.; Kimmich, R

    2004-02-16

    We present a study of the molecular dynamics in an octylcyanobiphenyl (8CB)-Aerosil complex above the bulk isotropization temperature. Using proton nuclear magnetic relaxation experiments in the laboratory frame (T{sub 1}{sup -1}) and in the rotating-frame (T{sub 1{rho}}{sup -1}), we found a notable increase of the relaxation rates in the kHz frequency range as compared to the bulk 8CB liquid crystal at the same temperature. The field-cycling technique was used for the laboratory frame experiments while a conventional apparatus was used for the rotating frame method. The observed behavior is analyzed with the aid of Monte Carlo simulations on the basis of a two-phase fast-exchange model distinguishing surface-ordered and bulk phases. Two processes affecting the low frequency relaxation could be identified: reorientation mediated by translational displacements, accounting for molecular reorientations, and exchange losses of molecules from the surface to the bulk.

  10. Influence of Free Radicals on the Intrinsic MRI Relaxation Properties.

    Science.gov (United States)

    Tain, Rong-Wen; Scotti, Alessandro M; Li, Weiguo; Zhou, Xiaohong Joe; Cai, Kejia

    2017-01-01

    Free radicals are critical contributors in various conditions including normal aging, Alzheimer's disease, cancer, and diabetes. Currently there is no non-invasive approach to image tissue free radicals based on endogenous contrast due to their extremely short lifetimes and low in vivo concentrations. In this study we aim at characterizing the influence of free radicals on the MRI relaxation properties. Phantoms containing free radicals were created by treating egg white with various H 2 O 2 concentrations and scanned on a 9.4 T MRI scanner at room temperature. T 1 and T 2 relaxation maps were generated from data acquired with an inversion recovery sequence with varied inversion times and a multi-echo spin echo sequence with varied echo times (TEs), respectively. Results demonstrated that free radicals express a strong shortening effect on T 1 , which was proportional to the H 2 O 2 concentration, and a relatively small reduction in T 2 (free radicals was estimated to be in the pM range that is within the physiological range of in vivo free radical expression. In conclusion, the free radicals show a strong paramagnetic effect that may be utilized as an endogenous MRI contrast for its non-invasive in vivo imaging.

  11. The influence of microvascular injury on native T1 and T2* relaxation values after acute myocardial infarction. Implications for non-contrast-enhanced infarct assessment

    Energy Technology Data Exchange (ETDEWEB)

    Robbers, Lourens F.H.J.; Nijveldt, Robin; Beek, Aernout M.; Teunissen, Paul F.A.; Hollander, Maurits R.; Biesbroek, P.S.; Everaars, Henk; Royen, Niels van; Rossum, Albert C. van [VU University Medical Centre, Department of Cardiology, Amsterdam (Netherlands); Ven, Peter M. van de [VU University Medical Centre, Department of Clinical Epidemiology and Biostatistics, Amsterdam (Netherlands); Hofman, Mark B.M. [VU University Medical Centre, Department of Physics and Medical Technology, Amsterdam (Netherlands)

    2018-02-15

    Native T1 mapping and late gadolinium enhancement (LGE) imaging offer detailed characterisation of the myocardium after acute myocardial infarction (AMI). We evaluated the effects of microvascular injury (MVI) and intramyocardial haemorrhage on local T1 and T2* values in patients with a reperfused AMI. Forty-three patients after reperfused AMI underwent cardiovascular magnetic resonance imaging (CMR) at 4 [3-5] days, including native MOLLI T1 and T2* mapping, STIR, cine imaging and LGE. T1 and T2* values were determined in LGE-defined regions of interest: the MI core incorporating MVI when present, the core-adjacent MI border zone (without any areas of MVI), and remote myocardium. Average T1 in the MI core was higher than in the MI border zone and remote myocardium. However, in the 20 (47%) patients with MVI, MI core T1 was lower than in patients without MVI (MVI 1048±78ms, no MVI 1111±89ms, p=0.02). MI core T2* was significantly lower in patients with MVI than in those without (MVI 20 [18-23]ms, no MVI 31 [26-39]ms, p<0.001). The presence of MVI profoundly affects MOLLI-measured native T1 values. T2* mapping suggested that this may be the result of intramyocardial haemorrhage. These findings have important implications for the interpretation of native T1 values shortly after AMI. (orig.)

  12. PDE1A inhibition elicits cGMP-dependent relaxation of rat mesenteric arteries

    DEFF Research Database (Denmark)

    Khammy, Makhala Michell; Dalsgaard, Thomas; Larsen, Peter Hjorringgaard

    2017-01-01

    (EC50 = 32 nM). Inhibition of NOS with L-NAME, soluble GC with ODQ, or PKG with Rp-8-Br-PET-cGMP all attenuated PDE1 inhibition-induced relaxation, whereas PKA inhibition with H89 had no effect. CONCLUSION AND IMPLICATIONS: Pde1a was the dominant PDE1 isoform present in VSMC and relaxation mediated...... by PDE1A-inhibition was predominantly driven by enhanced cGMP signalling. These results imply that isoform-selective PDE1 inhibitors are powerful investigative tools allowing examination of physiological and pathological roles of PDE1 isoforms....

  13. Stretched exponential relaxation in molecular and electronic glasses

    International Nuclear Information System (INIS)

    Phillips, J.C.

    1996-01-01

    Stretched exponential relaxation, exp[-(t/τ) β ], fits many relaxation processes in disordered and quenched electronic and molecular systems, but it is widely believed that this function has no microscopic basis, especially in the case of molecular relaxation. For electronic relaxation the appearance of the stretched exponential is often described in the context of dispersive transport, where β is treated as an adjustable parameter, but in almost all cases it is generally assumed that no microscopic meaning can be assigned to 0 g , a glass transition temperature. We show that for molecular relaxation β(T g ) can be understood, providing that one separates extrinsic and intrinsic effects, and that the intrinsic effects are dominated by two magic numbers, β SR =3/5 for short-range forces, and β K =3/7 for long-range Coulomb forces, as originally observed by Kohlrausch for the decay of residual charge on a Leyden jar. Our mathematical model treats relaxation kinetics using the Lifshitz-Kac-Luttinger diffusion to traps depletion model in a configuration space of effective dimensionality, the latter being determined using axiomatic set theory and Phillips-Thorpe constraint theory. The experiments discussed include ns neutron scattering experiments, particularly those based on neutron spin echoes which measure S(Q, t) directly, and the traditional linear response measurements which span the range from μs to s, as collected and analysed phenomenologically by Angell, Ngai, Boehmer and others. The electronic materials discussed include a-Si:H, granular C 60 , semiconductor nanocrystallites, charge density waves in TaS 3 , spin glasses, and vortex glasses in high-temperature semiconductors. The molecular materials discussed include polymers, network glasses, electrolytes and alcohols, Van der Waals supercooled liquids and glasses, orientational glasses, water, fused salts, and heme proteins. In the intrinsic cases the theory of β(T g ) is often accurate to 2%, which

  14. Determination of intra-axial brain tumors cellularity through the analysis of T2 Relaxation time of brain tumors before surgery using MATLAB software.

    Science.gov (United States)

    Abdolmohammadi, Jamil; Shafiee, Mohsen; Faeghi, Fariborz; Arefan, Douman; Zali, Alireza; Motiei-Langroudi, Rouzbeh; Farshidfar, Zahra; Nazarlou, Ali Kiani; Tavakkoli, Ali; Yarham, Mohammad

    2016-08-01

    Timely diagnosis of brain tumors could considerably affect the process of patient treatment. To do so, para-clinical methods, particularly MRI, cannot be ignored. MRI has so far answered significant questions regarding tumor characteristics, as well as helping neurosurgeons. In order to detect the tumor cellularity, neuro-surgeons currently have to sample specimens by biopsy and then send them to the pathology unit. The aim of this study is to determine the tumor cellularity in the brain. In this cross-sectional study, 32 patients (18 males and 14 females from 18-77 y/o) were admitted to the neurosurgery department of Shohada-E Tajrish Hospital in Tehran, Iran from April 2012 to February 2014. In addition to routine pulse sequences, T2W Multi echo pulse sequences were taken and the images were analyzed using the MATLAB software to determine the brain tumor cellularity, compared with the biopsy. These findings illustrate the need for more T2 relaxation time decreases, the higher classes of tumors will stand out in the designed table. In this study, the results show T2 relaxation time with a 85% diagnostic weight, compared with the biopsy, to determine the brain tumor cellularity (p<0.05). Our results indicate that the T2 relaxation time feature is the best method to distinguish and present the degree of intra-axial brain tumors cellularity (85% accuracy compared to biopsy). The use of more data is recommended in order to increase the percent accuracy of this techniques.

  15. Crossover between cooperative and fractal relaxation in complex glass-formers

    International Nuclear Information System (INIS)

    Golovchak, R; Kozdras, A; Shpotyuk, O; Balitska, V

    2016-01-01

    Kinetics of physical aging at different temperatures is studied in situ in arsenic selenide glasses using high-precision differential scanning calorimetry technique. A well-expressed step-like behaviour in the enthalpy recovery kinetics is recorded for low aging temperatures. These fine features disappear when the aging temperature (T a ) approaches the glass transition temperature (T g ). The overall kinetics is described by stretched exponential function with stretching exponent close to 3/5 at T a   >  ∼0.95 T g almost independent on glass composition, and 3/7 when the aging temperature drops to ∼0.9 T g . These values are consistent with the prediction of Phillips’ diffusion-to-traps model. Further decrease in aging temperature to ∼0.85 T g leads to the appearance of step-like behaviour and stretching exponent of 1/3 for the overall kinetics, which is the limiting value predicted by random walk on the fractal model. Such behavior is explained as crossover from homogeneous cooperative relaxation of non-percolating structural units to high-dimensional fractal relaxation within hierarchically-arranged two-stage physical aging model. (paper)

  16. COMPARATIVE ASSESSMENT OF NUCLEAR MAGNETIC RELAXATION CHARACTERISTICS OF SUNFLOWER AND RAPESEED LECITHIN

    OpenAIRE

    Lisovaya E. V.; Victorova E. P.; Agafonov O. S.; Kornen N. N.; Shahray T. A.

    2015-01-01

    The article presents a comparative assessment and peculiarities of nuclear magnetic relaxation characteristics of rapeseed and sunflower lecithin. It was established, that lecithin’s nuclear magnetic relaxation characteristics, namely, protons’ spin-spin relaxation time and amplitudes of nuclear magnetic relaxation signals of lecithin components, depend on content of oil’s fat acids and phospholipids, contained in the lecithin. Comparative assessment of protons’ spin-spin relaxation time of r...

  17. Evaluation of thermometric monitoring for intradiscal laser ablation in an open 1.0 T MR scanner.

    Science.gov (United States)

    Wonneberger, Uta; Schnackenburg, Bernhard; Wlodarczyk, Waldemar; Rump, Jens; Walter, Thula; Streitparth, Florian; Teichgräber, Ulf Karl Mart

    2010-01-01

    The purpose of this study was to evaluate different methods of magnetic resonance thermometry (MRTh) for the monitoring of intradiscal laser ablation therapy in an open 1.0 Tesla magnetic resonance (MR) scanner. MRTh methods based on the two endogenous MR temperature indicators of spin-lattice relaxation time T1 and water proton resonance frequency (PRF) shift were optimised and compared in vitro. For the latter, we measured the effective spin-spin relaxation times T2* in intervertebral discs of volunteers. Then we compared four gradient echo-based imaging techniques to monitor laser ablations in human disc specimens. Criteria of assessment were outline of anatomic detail, immunity against needle artefacts, signal-to-noise ratio (SNR) and accuracy of the calculated temperature. T2* decreased in an inverse and almost linear manner with the patients' age (r = 0.9) from 70 to 30 ms (mean of 49 ms). The optimum image quality (anatomic details, needle artefacts, SNR) and temperature accuracy (+/-1.09 degrees C for T1-based and +/-1.11 degrees C for PRF-based MRTh) was achieved with a non-spoiled gradient-echo sequence with an echo time of TE = 10 ms. Combination of anatomic and thermometric non-invasive monitoring of laser ablations in the lumbar spine is feasible. The temperature accuracy of the investigated T1- and PRF-based MRTh methods in vitro is high enough and promises to be reliable in vivo as well.

  18. Carboxylated magnetic nanoparticles as MRI contrast agents: Relaxation measurements at different field strengths

    Energy Technology Data Exchange (ETDEWEB)

    Jedlovszky-Hajdu, Angela, E-mail: angela.hajdu@net.sote.hu [Laboratory of Nanochemistry, Department of Biophysics and Radiation Biology, Semmelweis University, Nagyvarad Sq 4, H-1089 Budapest (Hungary); Tombacz, Etelka, E-mail: tombacz@chem.u-szeged.hu [Department of Physical Chemistry and Material Science, University of Szeged, Aradi Vt. Sq 1, Szeged 6720 (Hungary); Banyai, Istvan, E-mail: banyai.istvan@science.unideb.hu [Department of Colloid and Environmental Chemistry, University of Debrecen (Hungary); Babos, Magor, E-mail: babosmagor@yahoo.com [Euromedic Diagnostics Szeged Ltd., Semmelweis St 6, Szeged 6720 (Hungary); Palko, Andras, E-mail: palko@radio.szote.u-szeged.hu [Faculty of Medicine, Department of Radiology, University of Szeged (Hungary)

    2012-09-15

    At the moment the biomedical applications of magnetic fluids are the subject of intensive scientific interest. In the present work, magnetite nanoparticles (MNPs) were synthesized and stabilized in aqueous medium with different carboxylic compounds (citric acid (CA), polyacrylic acid (PAA), and sodium oleate (NaOA)), in order to prepare well stabilized magnetic fluids (MFs). The magnetic nanoparticles can be used in the magnetic resonance imaging (MRI) as contrast agents. Magnetic resonance relaxation measurements of the above MFs were performed at different field strengths (i.e., 0.47, 1.5 and 9.4 T) to reveal the field strength dependence of their magnetic responses, and to compare them with that of ferucarbotran, a well-known superparamagnetic contrast agent. The measurements showed characteristic differences between the tested magnetic fluids stabilized by carboxylic compounds and ferucarbotran. It is worthy of note that our magnetic fluids have the highest r2 relaxivities at the field strength of 1.5 T, where the most of the MRI works in worldwide. - Highlights: Black-Right-Pointing-Pointer Magnetic resonance relaxation measurements were done at different field strengths. Black-Right-Pointing-Pointer Results show characteristic differences between the tested carboxylated MFs. Black-Right-Pointing-Pointer r1 and r2 relaxivities depend on the thickness of the protecting layer. Black-Right-Pointing-Pointer MFs have high r2/r1 ratios at each magnetic field.

  19. 31P spin-lattice relaxation time measurements in biological systems

    International Nuclear Information System (INIS)

    Suzuki, Eiji; Maeda, Munehiro; Kuki, Satoru; Tsukamoto, Kenji; Kawakami, Tsuyoshi; Seo, Yoshiteru; Murakami, Masataka; Watari, Hiroshi

    1989-01-01

    Spin-lattice relaxation time (T 1 ) of phosphorus compounds in the perfused heart, liver, kidney and erythrocytes of rats were measured by the DESPOT (Driven-equilibrium single-pulse observation of T 1 ) method at 8.45 T. This method is a rapid and accurate technique for the measurement of T 1 values. T 1 values of phosphomonoesters (PME), 2, 3-diphosphoglycerate (DPG), inorganic phosphate (Pi), phosphodiesters (PDE), phosphocreatine (PCr) and three phosphates of ATP were ranged from 0.15±0.02 sec (β-ATP in the liver) to 8.5±1.6 sec (PDE in the kidney). T 1 value of β-ATP in the liver was 1/4-1/5 of those in the mandibular gland, heart, erythrocytes and kidney. T 1 values obtained from biological materials are useful for selecting the optimal pulse repetition times and pulse angles to maximize the signal-to-noise ratio of 13 P spectra, and for correcting distortions of signal intensities in the spectra. (author)

  20. Intra-individual comparison of image contrast in SPIO-enhanced liver MRI at 1.5T and 3.0T

    International Nuclear Information System (INIS)

    Falkenhausen, Marcus von; Meyer, Carsten; Lutterbey, Goetz; Morakkabati, Nuschin; Bloemer, Renate; Willinek, Winfried A.; Kuhl, Christiane K.; Schild, Hans H.; Walter, Oliver; Gieseke, Juergen

    2007-01-01

    The purpose of the study was to examine if the higher susceptibility at 3.0 Tesla (T) compared to 1.5 T will affect the contrast in MR imaging of the liver after application of superparamagnetic iron oxide particles (SPIO). The study was approved by our institutional review board and informed consent was obtained. Seventeen healthy volunteers were examined in a prospective, intra-individual comparative study within one day on a 1.5 T and a 3.0 T MRI system. T2 weighted TSE sequences were acquired after bolus injection of a SPIO contrast agent. Image contrast and signal to noise ratio (SNR) were compared between the field strengths. Image contrast was calculated between the liver tissue and the kidneys / spleen / muscles and fluids. The students'T-test was used for statistical analysis. No influence of the higher field strength could be observed on image contrast except for the liver / muscle contrast. This was due to a distinct SNR increase of the muscle tissue at 3.0 T as a result of their relaxation properties. The higher susceptibility at 3.0 T compared to 1.5 T does not translate into a stronger signal attenuation of the SPIO enhanced liver parenchyma. (orig.)

  1. Intra-individual comparison of image contrast in SPIO-enhanced liver MRI at 1.5T and 3.0T

    Energy Technology Data Exchange (ETDEWEB)

    Falkenhausen, Marcus von; Meyer, Carsten; Lutterbey, Goetz; Morakkabati, Nuschin; Bloemer, Renate; Willinek, Winfried A.; Kuhl, Christiane K.; Schild, Hans H. [University of Bonn, Department of Radiology, Bonn (Germany); Walter, Oliver [Leibniz-Institute for Science Education, Kiel (Germany); Gieseke, Juergen [University of Bonn, Department of Radiology, Bonn (Germany); Philips Medical Systems, Hamburg (Germany)

    2007-05-15

    The purpose of the study was to examine if the higher susceptibility at 3.0 Tesla (T) compared to 1.5 T will affect the contrast in MR imaging of the liver after application of superparamagnetic iron oxide particles (SPIO). The study was approved by our institutional review board and informed consent was obtained. Seventeen healthy volunteers were examined in a prospective, intra-individual comparative study within one day on a 1.5 T and a 3.0 T MRI system. T2 weighted TSE sequences were acquired after bolus injection of a SPIO contrast agent. Image contrast and signal to noise ratio (SNR) were compared between the field strengths. Image contrast was calculated between the liver tissue and the kidneys / spleen / muscles and fluids. The students'T-test was used for statistical analysis. No influence of the higher field strength could be observed on image contrast except for the liver / muscle contrast. This was due to a distinct SNR increase of the muscle tissue at 3.0 T as a result of their relaxation properties. The higher susceptibility at 3.0 T compared to 1.5 T does not translate into a stronger signal attenuation of the SPIO enhanced liver parenchyma. (orig.)

  2. Relaxation of magnetization in spinel CuCrZrS4

    International Nuclear Information System (INIS)

    Ito, Masakazu; Furuta, Tatsuya; Terada, Norio; Ebisu, Shuji; Nagata, Shoichi

    2012-01-01

    We studied time t dependence of magnetization M(t) of thiospinel CuCrZrS 4 which has a spin-glass freezing. The relaxation of M is observed below T f ≃6K and shows a logarithmic time dependence. This means that a relaxation time τ of CuCrZrS 4 is distributed in a wide time range. Randomness of an arrangement of the Cr and Zr ions in CuCrZrS 4 probably gives rise to a distribution of τ. Temperature T dependence of magnetic viscosity β(T) is understood by a conventional after-effect model with a box-type distribution function of τ.

  3. Diffusion processes in the relaxed cross sections for the reaction 107109Ag+20Ne

    International Nuclear Information System (INIS)

    Babinet, R.; Moretto, L.G.; Galin, J.; Jared, R.; Moulton, J.; Thompson, S.G.

    1976-01-01

    The fragments emitted in the reaction 107 109 Ag+ 20 Ne at 175 and 252 MeV bombarding energy have been identified in charge up to Z=32. Kinetic energy distributions, cross sections and angular distributions have been measured for each Z. The kinetic energy spectra show the two usual components: the quasielastic component and the relaxed component. The Z-distribution of the latter is fairly flat, slowly decreasing up to Z approximately 15 and then rising again up to Z=30. The variations in the Z-distribution are more pronounced at the lower bombarding energy. The angular distributions associated with the relaxed component are forward peaked for Z-values close to that of the projectile and behave like 1/sintheta for larger Z-values. The forward peaking is very substantial for Z 10 the forward peaking in excess of 1/sintheta disappears around Z=15. These features are interpreted in terms of a diffusion process along the asymmetry coordinate of a short-lived intermediate complex. (Auth.)

  4. Structure of the two-dimensional relaxation spectra seen within the eigenmode perturbation theory and the two-site exchange model.

    Science.gov (United States)

    Bytchenkoff, Dimitri; Rodts, Stéphane

    2011-01-01

    The form of the two-dimensional (2D) NMR-relaxation spectra--which allow to study interstitial fluid dynamics in diffusive systems by correlating spin-lattice (T(1)) and spin-spin (T(2)) relaxation times--has given rise to numerous conjectures. Herein we find analytically a number of fundamental structural properties of the spectra: within the eigen-modes formalism, we establish relationships between the signs and intensities of the diagonal and cross-peaks in spectra obtained by various 1 and 2D NMR-relaxation techniques, reveal symmetries of the spectra and uncover interdependence between them. We investigate more specifically a practically important case of porous system that has sets of T(1)- and T(2)-eigenmodes and eigentimes similar to each other by applying the perturbation theory. Furthermore we provide a comparative analysis of the application of the, mathematically more rigorous, eigen-modes formalism and the, rather more phenomenological, first-order two-site exchange model to diffusive systems. Finally we put the results that we could formulate analytically to the test by comparing them with computer-simulations for 2D porous model systems. The structural properties, in general, are to provide useful clues for assignment and analysis of relaxation spectra. The most striking of them--the presence of negative peaks--underlines an urgent need for improvement of the current 2D Inverse Laplace Transform (ILT) algorithm used for calculation of relaxation spectra from NMR raw data. Copyright © 2010 Elsevier Inc. All rights reserved.

  5. Applications and limitations of electron correlation microscopy to study relaxation dynamics in supercooled liquids

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Pei; He, Li [Department of Materials Science and Engineering, University of Wisconsin-Madison, Madison, WI 53706 (United States); Besser, Matthew F. [Materials Science and Engineering, Ames Laboratory, Iowa State University, Ames, IA 50011 (United States); Liu, Ze; Schroers, Jan [Department of Mechanical Engineering and Materials Science, Yale University, New Haven, CT 06511 (United States); Kramer, Matthew J. [Materials Science and Engineering, Ames Laboratory, Iowa State University, Ames, IA 50011 (United States); Voyles, Paul M., E-mail: paul.voyles@wisc.edu [Department of Materials Science and Engineering, University of Wisconsin-Madison, Madison, WI 53706 (United States)

    2017-07-15

    Electron correlation microscopy (ECM) is a way to measure structural relaxation times, τ, of liquids with nanometer-scale spatial resolution using coherent electron scattering equivalent of photon correlation spectroscopy. We have applied ECM with a 3.5 nm diameter probe to Pt{sub 57.5}Cu{sub 14.7}Ni{sub 5.3}P{sub 22.5} amorphous nanorods and Pd{sub 40}Ni{sub 40}P{sub 20} bulk metallic glass (BMG) heated inside the STEM into the supercooled liquid region. These data demonstrate that the ECM technique is limited by the characteristics of the time series, which must be at least 40τ to obtain a well-converged correlation function g{sub 2}(t), and the time per frame, which must be less than 0.1τ to obtain sufficient sampling. A high-speed direct electron camera enables fast acquisition and affords reliable g{sub 2}(t) data even with low signal per frame. - Highlights: • Electron Correlation Microscopy (ECM) technique was applied to measure structural relaxation times of supercooled liquids in metallic glass. • In Pt{sub 57.5}Cu{sub 14.7}Ni{sub 5.3}P{sub 22.5} nanowire, τ and β decreases over the measured supercooled liquid regime. • In Pd{sub 40}Ni{sub 40}P{sub 20} bulk alloy, τ decreases from T{sub g}+28 °C to T{sub g}+48 °C, then increases as the temperature approaches T{sub x}. • ECM experiment requires a length of time series at least 40 times the characteristic relaxation time and a time per diffraction pattern at most 0.1 times the relaxation time.

  6. Relaxation Processes and Time Scale Transformation.

    Science.gov (United States)

    1982-03-01

    the response function may be immediately recognized as being 14 of the Kubo - Green type in the classical regime. Given this general framework, it is now...b as a function of temperature is 24 equivalent to the Vogel-Beuche-Fulcher empirical law for viscosity or the Williams-Landel-Ferry empirical law...relaxation times. With the weighted sum in the form of an integral , one can write exp(-(t/T)b ] = f dT’g(r’) exp[-(t/T’)], O

  7. 13C solid state NMR investigation of natural resins components

    International Nuclear Information System (INIS)

    Tavares, Maria I.B.; Bathista, Andre L.B.S.; Silva, Emerson O.; Priante Filho, Nicolau; Nogueira, Jose S.

    2001-01-01

    The objective of this work is to establish and analytical methodology as a routine using solid state nuclear magnetic resonance (NMR) techniques to investigate the mainly chemical components presented in natural resins in bulk. And also to evaluate the molecular behaviour of these resins. The routine solid state techniques allow us to assign the main compounds presented in the resins. Therefore, applying specialised techniques, like variable contact time, delayed contact time, dephasing time and proton spin lattice relaxation time in the rotating frame (T 1 H ρ), more information about chemical structure and molecular dynamic is available

  8. Multidimensional dynamic piezoresponse measurements. Unraveling local relaxation behavior in relaxor-ferroelectrics via big data

    International Nuclear Information System (INIS)

    Vasudevan, Rama K.; Zhang, Shujun; Okatan, Mahmut Baris; Jesse, Stephen; Kalinin, Sergei V.; Bassiri-Gharb, Nazanin

    2015-01-01

    Compositional and charge disorder in ferroelectric relaxors lies at the heart of the unusual properties of these systems, such as aging and non-ergodicity, polarization rotations, and a host of temperature and field-driven phase transitions. However, much information about the field-dynamics of the polarization in the prototypical ferroelectric relaxor (1-x)Pb(Mg 1/3 Nb 2/3 )O 3-x PbTiO 3 (PMN-xPT) remains unprobed at the mesoscopic level. We use a piezoresponse force microscopy-based dynamic multimodal relaxation spectroscopy technique, enabling the study of ferroelectric switching and polarization relaxation at mesoscopic length scales, and carry out measurements on a PMN-0.28PT sample with minimal polishing. Results indicate that beyond a threshold DC bias the average relaxation increases as the system attempts to relax to the previous state. Phenomenological fitting reveals the presence of mesoscale heterogeneity in relaxation amplitudes and clearly suggests the presence of two distinct amplitudes. Independent component analysis reveals the presence of a disorder component of the relaxation, which is found to be strongly anti-correlated with the maximum piezoresponse at that location, suggesting smaller disorder effects where the polarization reversal is large and vice versa. The disorder in the relaxation amplitudes is postulated to arise from rhombohedral and field-induced tetragonal phase in the crystal, with each phase associated with its own relaxation amplitude. As a result, these studies highlight the crucial importance of the mixture of ferroelectric phases in the compositions in proximity of the morphotropic phase boundary in governing the local response and further highlight the ability of PFM voltage and time spectroscopies, in conjunction with big-data multivariate analyses, to locally map disorder and correlate it with parameters governing the dynamic behavior

  9. Real-time observation of cascaded electronic relaxation processes in p-Fluorotoluene

    Science.gov (United States)

    Hao, Qiaoli; Deng, Xulan; Long, Jinyou; Wang, Yanmei; Abulimiti, Bumaliya; Zhang, Bing

    2017-08-01

    Ultrafast electronic relaxation processes following two photoexcitation of 400 nm in p-Fluorotoluene (pFT) have been investigated utilizing time-resolved photoelectron imaging coupled with time-resolved mass spectroscopy. Cascaded electronic relaxation processes started from the electronically excited S2 state are directly imaged in real time and well characterized by two distinct time constants of 85 ± 10 fs and 2.4 ± 0.3 ps. The rapid component corresponds to the lifetime of the initially excited S2 state, including the structure relaxation from the Franck-Condon region to the conical intersection of S2/S1 and the subsequent internal conversion to the highly excited S1 state. While, the slower relaxation constant is attributed to the further internal conversion to the high levels of S0 from the secondarily populated S1 locating in the channel three region. Moreover, dynamical differences with benzene and toluene of analogous structures, including, specifically, the slightly slower relaxation rate of S2 and the evidently faster decay of S1, are also presented and tentatively interpreted as the substituent effects. In addition, photoelectron kinetic energy and angular distributions reveal the feature of accidental resonances with low-lying Rydberg states (the 3p, 4s and 4p states) during the multi-photon ionization process, providing totally unexpected but very interesting information for pFT.

  10. Simultaneous multislice triple-echo steady-state (SMS-TESS) T1 , T2 , PD, and off-resonance mapping in the human brain.

    Science.gov (United States)

    Heule, Rahel; Celicanin, Zarko; Kozerke, Sebastian; Bieri, Oliver

    2018-02-21

    To investigate the ability of simultaneous multislice triple-echo steady-state (SMS-TESS) imaging to provide quantitative maps of multiple tissue parameters, i.e., longitudinal and transverse relaxation times (T 1 and T 2 ), proton density (PD), and off-resonance (ΔB 0 ), in the human brain at 3T from a single scan. TESS acquisitions were performed in 2D mode to reduce motion sensitivity and accelerated by an SMS excitation scheme (CAIPIRINHA) with SENSE reconstruction. SMS-acceleration factors (R) of 2 and 4 were evaluated. The in vitro and in vivo validation process included standard reference scans to analyze the accuracy of T 1 , T 2 , and ΔB 0 estimates, as well as single-slice TESS measurements. For R = 2, the quantification of T 1 , T 2 , PD, and ΔB 0 was overall reliable with marginal noise enhancement. T 1 and T 2 values were in good agreement with the reference measurements and single-slice TESS. For R = 4, the agreement of ΔB 0 with the standard reference was excellent and the determination of T 1 , T 2 , and PD was reproducible; however, increased variations in T 1 and T 2 values with respect to single-slice TESS were observed. SMS-TESS has shown potential to offer rapid simultaneous T 1 , T 2 , PD, and ΔB 0 mapping of human brain tissues. © 2018 International Society for Magnetic Resonance in Medicine.

  11. F-center mechanism of long-term relaxation in lead zirconate-titanate-based piezoelectric ceramics. 1. After-heating relaxation

    Directory of Open Access Journals (Sweden)

    V. M. Ishchuk

    2015-12-01

    The oxygen vacancies-based model for description of the long-time relaxation processes is suggested. The model takes into account oxygen vacancies on the sample’s surface ends, their conversion into F+- and F0-centers under external effects (due to the liberation of the pyroelectric charge and subsequent relaxation of these centers into the simple oxygen vacancies after the actions termination. The initial sample’s state is electroneutrality one. F-center formation leads to the violation of the original sample’s electroneutrality, and generates DC electric field into the sample. Relaxation of F-centers is accompanied by decreasing of electric field, induced by them, and dielectric constant relaxation as consequent effect.

  12. Disruptive chemical doping in a ferritin-based iron oxide nanoparticle to decrease r2 and enhance detection with T1-weighted MRI.

    Science.gov (United States)

    Clavijo Jordan, M Veronica; Beeman, Scott C; Baldelomar, Edwin J; Bennett, Kevin M

    2014-01-01

    Inorganic doping was used to create flexible, paramagnetic nanoparticle contrast agents for in vivo molecular magnetic resonance imaging (MRI) with low transverse relaxivity (r2). Most nanoparticle contrast agents formed from superparamagnetic metal oxides are developed with high r2. While sensitive, they can have limited in vivo detection due to a number of constraints with T2 or T2*-weighted imaging. T1-weighted imaging is often preferred for molecular MRI, but most T1-shortening agents are small chelates with low metal payload or are nanoparticles that also shorten T2 and limit the range of concentrations detectable with T1-weighting. Here we used tungsten and iron deposition to form doped iron oxide crystals inside the apoferritin cavity to form a WFe nanoparticle with a disordered crystal and un-coupled atomic magnetic moments. The atomic magnetic moments were thus localized, resulting in a principally paramagnetic nanoparticle. The WFe nanoparticles had no coercivity or saturation magnetization at 5 K and sweeping up to ± 20,000 Oe, while native ferritin had a coercivity of 3000 Oe and saturation at ± 20,000 Oe. This tungsten-iron crystal paramagnetism resulted in an increased WFe particle longitudinal relaxivity (r1) of 4870 mm(-1) s(-1) and a reduced transverse relaxivity (r2) of 9076 mm(-1) s(-1) compared with native ferritin. The accumulation of the particles was detected with T1-weighted MRI in concentrations from 20 to 400 nm in vivo, both injected in the rat brain and targeted to the rat kidney glomerulus. The WFe apoferritin nanoparticles were not cytotoxic up to 700 nm particle concentrations, making them potentially important for targeted molecular MRI. Copyright © 2014 John Wiley & Sons, Ltd.

  13. Quantitative effects of cell internalization of two types of ultrasmall superparamagnetic iron oxide nanoparticles at 4.7 T and 7 T

    International Nuclear Information System (INIS)

    Brisset, J.C.; Desestret, V.; Chauveau, F.; Nighoghossian, N.; Berthezene, Y.; Wiart, M.; Marcellino, S.; Lagarde, F.; Devillard, E.; Nataf, S.

    2010-01-01

    MRI coupled with the intravenous injection of ultrasmall superparamagnetic particles of iron oxides (USPIOs) is a promising tool for the study of neuroinflammation. Quantification of the approximate number of magnetically labelled macrophages may provide an effective and efficient method for monitoring inflammatory cells. The purpose of the present study was to characterise the relaxation properties of macrophages labelled with two types of USPIOs, at 4.7 T and 7 T. USPIO-labelled bone-marrow-derived macrophage phantoms were compared with phantoms of free dispersed USPIOs with the same global iron concentration, using multi-parametric (T1, T2 and T2*) quantitative MRI. The same protocol was then evaluated in living mice after intracerebral injection of iron-labelled macrophages vs free iron oxide. A linear relationship was observed among R1, R2 and R2* values and iron concentration in vitro at 4.7 T and at 7 T. At a given field, T1 and T2 relaxivities of both types of USPIOs decreased following internalisation into macrophages, while T2* relaxivities increased. There was fair overall agreement between the theoretical number of injected cells and the number estimated from T2 quantification and in vitro calibration curves, supporting the validity of the present in vitro calibration curves for in vivo investigation. (orig.)

  14. Magnetic Inflation and Stellar Mass. I. Revised Parameters for the Component Stars of the Kepler Low-mass Eclipsing Binary T-Cyg1-12664

    Energy Technology Data Exchange (ETDEWEB)

    Han, Eunkyu; Muirhead, Philip S. [Department of Astronomy and Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Swift, Jonathan J. [The Thacher School, 5025 Thacher Road Ojai, CA 93023 (United States); Baranec, Christoph; Atkinson, Dani [Institute for Astronomy, University of Hawaiì at Mānoa, Hilo, HI 96720-2700 (United States); Law, Nicholas M. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599-3255 (United States); Riddle, Reed [California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Mace, Gregory N. [McDonald Observatory and The University of Texas, 2515 Speedway, Stop C1400, Austin, TX 78712-1205 (United States); DeFelippis, Daniel, E-mail: eunkyuh@bu.edu [Department of Astronomy, Columbia University, 550 West 120th Street, New York, NY 10027 (United States)

    2017-09-01

    Several low-mass eclipsing binary stars show larger than expected radii for their measured mass, metallicity, and age. One proposed mechanism for this radius inflation involves inhibited internal convection and starspots caused by strong magnetic fields. One particular eclipsing binary, T-Cyg1-12664, has proven confounding to this scenario. Çakırlı et al. measured a radius for the secondary component that is twice as large as model predictions for stars with the same mass and age, but a primary mass that is consistent with predictions. Iglesias-Marzoa et al. independently measured the radii and masses of the component stars and found that the radius of the secondary is not in fact inflated with respect to models, but that the primary is, which is consistent with the inhibited convection scenario. However, in their mass determinations, Iglesias-Marzoa et al. lacked independent radial velocity measurements for the secondary component due to the star’s faintness at optical wavelengths. The secondary component is especially interesting, as its purported mass is near the transition from partially convective to a fully convective interior. In this article, we independently determined the masses and radii of the component stars of T-Cyg1-12664 using archival Kepler data and radial velocity measurements of both component stars obtained with IGRINS on the Discovery Channel Telescope and NIRSPEC and HIRES on the Keck Telescopes. We show that neither of the component stars is inflated with respect to models. Our results are broadly consistent with modern stellar evolutionary models for main-sequence M dwarf stars and do not require inhibited convection by magnetic fields to account for the stellar radii.

  15. Spin relaxation in semiconductor quantum rings and dots--a comparative study.

    Science.gov (United States)

    Zipper, Elżbieta; Kurpas, Marcin; Sadowski, Janusz; Maśka, Maciej M

    2011-03-23

    We calculate spin relaxation times due to spin-orbit-mediated electron-phonon interactions for experimentally accessible semiconductor quantum ring and dot architectures. We elucidate the differences between the two systems due to different confinement. The estimated relaxation times (at B = 1 T) are in the range between a few milliseconds to a few seconds. This high stability of spin in a quantum ring allows us to test it as a spin qubit. A brief discussion of quantum state manipulations with such a qubit is presented.

  16. NMR relaxation rates and Knight shifts in MgB2 and AlB2: theory versus experiments

    International Nuclear Information System (INIS)

    Pavarini, E; Baek, S H; Suh, B J; Borsa, F; Bud'ko, S L; Canfield, P C

    2003-01-01

    We have performed 11 B NMR measurements in 11 B enriched MgB 2 powder sample in the normal phase. The Knight shift was accurately determined by using the magic angle spinning technique. Results for 11 B and 27 Al Knight shifts (K) and relaxation rates (1/T 1 ) are also reported for AlB 2 . The data show a dramatic decrease of both K and 1/T 1 for 11 B in AlB 2 with respect to MgB 2 . We compare experimental results with ab initio calculated NMR relaxation rates and Knight shifts. The experimental values for 1/T 1 and K are in most cases in good agreement with the theoretical results. We show that the decrease of K and 1/T 1 for 11 B is consistent with a drastic drop of the density of states at the boron site in AlB 2 with respect to MgB 2

  17. Communication: Vibrational relaxation of CO(1Σ) in collision with Ar(1S) at temperatures relevant to the hypersonic flight regime.

    Science.gov (United States)

    Denis-Alpizar, Otoniel; Bemish, Raymond J; Meuwly, Markus

    2017-03-21

    Vibrational energy relaxation (VER) of diatomics following collisions with the surrounding medium is an important elementary process for modeling high-temperature gas flow. VER is characterized by two parameters: the vibrational relaxation time τ vib and the state relaxation rates. Here the vibrational relaxation of CO(ν=0←ν=1) in Ar is considered for validating a computational approach to determine the vibrational relaxation time parameter (pτ vib ) using an accurate, fully dimensional potential energy surface. For lower temperatures, comparison with experimental data shows very good agreement whereas at higher temperatures (up to 25 000 K), comparisons with an empirically modified model due to Park confirm its validity for CO in Ar. Additionally, the calculations provide insight into the importance of Δν>1 transitions that are ignored in typical applications of the Landau-Teller framework.

  18. The effects of progressive muscle relaxation and autogenic relaxation on young soccer players' mood states.

    Science.gov (United States)

    Hashim, Hairul Anuar; Hanafi Ahmad Yusof, Hazwani

    2011-06-01

    This study was designed to compare the effects of two different relaxation techniques, namely progressive muscle relaxation (PMR) and autogenic relaxation (AGR) on moods of young soccer players. sixteen adolescent athletes (mean age: 14.1 ± 1.3) received either PMR or AGR training. Using Profile of Mood States- Adolescents, their mood states were measured one week before relaxation training, before the first relaxation session, and after the twelfth relaxation session. Mixed ANOVA revealed no significant interaction effects and no significant main effects in any of the subscales. However, significant main effects for testing sessions were found for confusion, depression, fatigue, and tension subscales. Post hoc tests revealed post-intervention reductions in the confusion, depression, fatigue, and tension subscale scores. These two relaxation techniques induce equivalent mood responses and may be used to regulate young soccer players' mood states.

  19. Evaluation of crosstalk effect on spin-echo images at 1.5 and 3 T

    International Nuclear Information System (INIS)

    Kajisako, Masaaki; Taniguchi, Masahiro; Koizumi, Koji; Hiraga, Akira; Miyati, Tosiaki; Syakudo, Yuko; Miki, Yukio

    2011-01-01

    The purpose of this study is to evaluate the crosstalk effect on spin-echo (SE) images at 1.5 and 3 T MRI. We examined the influence of crosstalk by comparing the full width at half-maximum (FWHM) and slice profile of images of a wedge-shaped phantom for various slice gaps. We also assessed crosstalk effect in the brain by comparing image contrast among healthy volunteers (n=8). Among the subjects, the shapes of the slice profiles at 1.5 T were similar to those at 3 T for long repetition times (TRs); however, at shorter TRs, differences in slice profiles were observed among the subjects and were more apparent at 3 than at 1.5 T. The relative contrast between white matter and gray matter on T 1 -weighted images was lower at 3 than at 1.5 T. The crosstalk effect was strongest when the TR of the excitation pulse was short. The influence of the adjacent excitation pulse is important in the process of T 1 relaxation because T 1 values are greater at 3 T. In conclusion, the influence of crosstalk on SE T 1 -weighted images is greater at 3 than at 1.5 T. (author)

  20. Local Postseismic Relaxation Observed After the 1992 Landers (M=7.3), 1999 Hector Mine (M=7.1), 2002 Denali (M=7.9), and 2003 San Simeon (M=6.5) Earthquakes

    Science.gov (United States)

    Svarc, J. L.; Savage, J. C.

    2004-12-01

    The U. S. Geological Survey has observed the local postseismic deformation following the 1992 Landers (M=7.3), 1999 Hector Mine (M=7.1), 2002 Denali (M=7.9), and 2003 San Simeon (M=6.5) earthquakes. The observations consist of repeated campaign-style GPS surveys of geodetic arrays (aperture ˜ 50 km) in the epicentral area of each earthquake. The data span the intervals from 0.037 to 5.6, 0.0025 to 4.5, 0.022 to 1.6, and 0.005 to 0.55 yr postearthquake for the Landers, Hector Mine, Denali, and San Simeon earthquakes, respectively. We have reduced the observations to positions of the monuments measured relative to another monument within the array. The temporal dependence of the relative displacements for each monument can be approximated by a+bt+c(1-exp[-t/d]) where a, b, c, and d are constants particular to that monument and t is the time after the earthquake. The relaxation times d were found to be 0.367±0.062, 0.274±0.024, 0.145±0.017, and 0.032±0.002 yr for the Landers, Hector Mine, Denali, and San Simeon earthquakes, respectively. The observed increase in d with the duration of the time series fit suggests that the relaxation process involves more than a single relaxation time. An alternative function a'+b't+c'log(1+t/d') where a', b', c', and d' are constants particular to each monument furnishes a better fit to the data. This logarithmic form of the relaxation (Lomnitz creep function), identical to the calculated response of a simple spring-slider system subject to rate-state friction [Marone et al., 1991], contains a continuous spectrum of relaxation times. In fitting data the time constant d' is determined by observations within the first few days postseismic and consequently is poorly defined. Adequate fits to the data are found by simply setting d'=0.001 yr and determining a', b', and c' by linear least squares. That the temporal dependence is so readily fit by both exponential and logarithmic functions suggests that the temporal dependence by itself

  1. Influence of pudendal nerve blockade on stress relaxation in the female urethra

    DEFF Research Database (Denmark)

    Thind, P; Bagi, P; Mieszczak, C

    1996-01-01

    The urethral pressure decay following a sudden and sustained dilatation corresponds to stress relaxation. Urethral stress relaxation can be described by the equation Pt = Pequ + P alpha e-t/tau alpha + P beta e-t/tau beta, where Pt is the pressure at time t, Pequ is the equilibrium pressure after...... dilatation, P alpha and P beta are pressure decay, and tau alpha and tau beta are time constants. The time constants have previously proved independent of the way the dilatation is performed. The urethral stress relaxation obtained in 10 healthy women before and after pudendal nerve blockade was analysed...... by the mathematical model and the pressure parameters and time constants determined. The fast time constant, tau beta, was reduced by the nerve blockade, whereas tau alpha was unaffected, however, both P alpha and P beta were reduced. No single stress relaxation parameter can therefore be related to the muscle...

  2. The Effects of Progressive Muscle Relaxation and Autogenic Relaxation on Young Soccer Players’ Mood States

    Science.gov (United States)

    Hashim, Hairul Anuar; Hanafi@Ahmad Yusof, Hazwani

    2011-01-01

    Purpose This study was designed to compare the effects of two different relaxation techniques, namely progressive muscle relaxation (PMR) and autogenic relaxation (AGR) on moods of young soccer players. Methods Sixteen adolescent athletes (mean age: 14.1 ± 1.3) received either PMR or AGR training. Using Profile of Mood States- Adolescents, their mood states were measured one week before relaxation training, before the first relaxation session, and after the twelfth relaxation session. Results Mixed ANOVA revealed no significant interaction effects and no significant main effects in any of the subscales. However, significant main effects for testing sessions were found for confusion, depression, fatigue, and tension subscales. Post hoc tests revealed post-intervention reductions in the confusion, depression, fatigue, and tension subscale scores. Conclusion These two relaxation techniques induce equivalent mood responses and may be used to regulate young soccer players’ mood states. PMID:22375225

  3. In vivo measurements of relaxation process in the human liver by MRI. The role of respiratory gating/triggering

    DEFF Research Database (Denmark)

    Thomsen, C; Henriksen, O; Ring, P

    1988-01-01

    In vivo estimation of relaxation processes in the liver by magnetic resonance imaging (MRI) may be helpful for characterization of various pathological conditions in the liver. However, such measurements may be significantly hampered by movement of the liver with the respiration. The effect...... of synchronization of data acquisition to the respiratory cycle on measured T1- and T2-relaxation curves was studied in normal subjects, patients with diffuse liver disease, and patients with focal liver pathology. Multi spin echo sequences with five different repetition times were used. The measurements were...... carried out with and without respiratory gating/triggering. In the healthy subjects as well as in the patients with diffuse liver diseases respiratory synchronization did not alter the obtained relaxation curves. However, in the patients with focal pathology the relaxation curves were significantly...

  4. Relaxation and particle diffusion in the Proto S-1/C spheromak

    International Nuclear Information System (INIS)

    Meyerhofer, D.D.

    1987-01-01

    The relationship between relaxation and particle diffusion in the Proto S-1C spheromak has been studied. The plasma was formed in a magnetic configuration which was not the minimum-energy Taylor state, and went through a period of relaxation before its magnetic configuration was that of the Taylor state. Early in the relaxation phase, the internal and external magnetic fluctuations were correlated and it was found that, at the time of peak amplitude, they had a radial structure of a tearing mode. After the reconnection of these modes, the plasma continued to evolve towards the Taylor state with only small magnetic fluctuations at the center of plasma. The local particle diffusion coefficient was measured in these Proto S-1C discharges, the technique used was to inject a delta-function source of impurities into the plasma and observe the motion of the impurities relative to the flux surface. It was found that, during the decay phase of the spheromak discharge, when the plasma was in a Taylor state, the carbon diffusion coefficient was explained classically. While the plasma was relaxing towards the Taylor state, the diffusion coefficient was 2 ∼ 4a times larger than classical. At this time, the plasma was not yet force-free. This nonclassical diffusion appears to have been caused by v/sub ExB/ velocities due to correlations between the fluctuating electric field and density. Because the v/sub ExB/ velocity acts on all of the plasma species similarly, the anomalous hydrogen-particle diffusion coefficient should have been as large as that of carbon

  5. Harsh corporal punishment is associated with increased T2 relaxation time in dopamine-rich regions.

    Science.gov (United States)

    Sheu, Yi-Shin; Polcari, Ann; Anderson, Carl M; Teicher, Martin H

    2010-11-01

    Harsh corporal punishment (HCP) was defined as frequent parental administration of corporal punishment (CP) for discipline, with occasional use of objects such as straps, or paddles. CP is linked to increased risk for depression and substance abuse. We examine whether long-term exposure to HCP acts as sub-traumatic stressor that contributes to brain alterations, particularly in dopaminergic pathways, which may mediate their increased vulnerability to drug and alcohol abuse. Nineteen young adults who experienced early HCP but no other forms of maltreatment and twenty-three comparable controls were studied. T2 relaxation time (T2-RT) measurements were performed with an echo planar imaging TE stepping technique and T2 maps were calculated and analyzed voxel-by-voxel to locate regional T2-RT differences between groups. Previous studies indicated that T2-RT provides an indirect index of resting cerebral blood volume. Region of interest (ROI) analyses were also conducted in caudate, putamen, nucleus accumbens, anterior cingulate cortex, dorsolateral prefrontal cortex, thalamus, globus pallidus and cerebellar hemispheres. Voxel-based relaxometry showed that HCP was associated with increased T2-RT in right caudate and putamen. ROI analyses also revealed increased T2-RT in dorsolateral prefrontal cortex, substantia nigra, thalamus and accumbens but not globus pallidus or cerebellum. There were significant associations between T2-RT measures in dopamine target regions and use of drugs and alcohol, and memory performance. Alteration in the paramagnetic or hemodynamic properties of dopaminergic cell body and projection regions were observed in subjects with HCP, and these findings may relate to their increased risk for drug and alcohol abuse. Copyright 2010 Elsevier Inc. All rights reserved.

  6. The relaxational behaviour of poly-(vinylidene fluoride) before and after gamma-irradiation

    International Nuclear Information System (INIS)

    Callens, A.

    The main purpose of this work was to investigate how molecular chain reorganization may affect the physical property of polymers. This may be done by the analysis of the as received and post-irradiation relaxation spectra of the semi-crystalline linear chain polymer polyvinylidene fluoride (PVDF), which has been gamma-irradiated up to doses of 1 grad. The effects of the irradiation on the material are primarly main chain cross-linking production of unsaturated bonds and crystallite degradation. To reach a complete interpretation of the relaxation spectra, it is necessary to incorporate a third phase into the analysis besides the amorphous viscoelastic region (AVR) and the crystalline viscoelastic region (CVR), the intermediate phase. The amorphous phase (AVR) is at the origin of the relaxation effects occurring in the temperature region below room temperature. The saturation like behaviour of the cross-linking in the amorphous phase is at the origin of the intensity decrease, temperature shift and peak broadening of the beta relaxation. There is a large amount of evidence that in the neighbourhood of the beta relaxation, relaxation effects are created through irradiation, as mainly revealed by TSD-spectra (thermalloy stimulated depolarisation). The intensity of the gamma relaxation, gradually increases with dose, which has been attributed to the production of disordered chain from the debris of radiation enhanced crystallite destruction. The relaxation effect, occuring at the temperatures between AVR and CVR, is assigned to the long amorphous chain segments attached partly to the crystallites, mainly from the consideration of the similarity of the dose enhanced decrease in intensity of both beta and βsub(μ)-effects. The increase with dose of the intensity of the α1 relaxation, which has been classified within CVR, confirms the grainboundary hypothesis. The second component of CVR (α2 relaxation) is due to relaxation effects of molecular chains belonging to the

  7. Deducting the temperature dependence of the structural relaxation time in equilibrium far below the nominal Tg by aging the decoupled conductivity relaxation to equilibrium.

    Science.gov (United States)

    Wojnarowska, Z; Ngai, K L; Paluch, M

    2014-05-07

    Using broadband dielectric spectroscopy we investigate the changes in the conductivity relaxation times τσ observed during the physical aging of the protic ionic conductor carvedilol dihydrogen phosphate (CP). Due to the large decoupling of ion diffusion from host molecule reorientation, the ion conductivity relaxation time τσ(Tage,tage) can be directly measured at temperatures Tage below Tg for exceedingly long aging times tage till τσ(Tage,tage) has reached the equilibrium value τσ(eq)(Tage). The dependence of τσ(Tage,tage) on tage is well described by the stretched exponential function, τσ(Tage, tage) = Aexp[-((tage)/(τage(Tage)))(β)] + τσ(eq)(Tage), where β is a constant and τage(Tage) can be taken as the structural α-relaxation time of the equilibrium liquid at T = Tage. The value of τσ(eq)(Tage) obtained after 63 days long annealing of CP, deviates from the Vogel-Fulcher-Tammann-Hesse (VFTHσ) dependence of τσ(T) determined from data taken above Tg and extrapolated down to Tage. Concurrently, τage(Tage) also deviates from the Vogel-Fulcher-Tammann-Hesse (VFTHα) dependence. The results help to answer the longstanding question of whether the VFTH dependence of τσ(T) as well as the structural α-relaxation time τα(T) holds or not in the equilibrium liquid state far below Tg.

  8. Comparison of Trifecta and Pentafecta Outcomes between T1a and T1b Renal Masses following Robot-Assisted Partial Nephrectomy (RAPN with Minimum One Year Follow Up: Can RAPN for T1b Renal Masses Be Feasible?

    Directory of Open Access Journals (Sweden)

    Dae Keun Kim

    Full Text Available To investigate the feasibility of RAPN on T1b renal mass by assessment of Trifecta and Pentafecta rate between T1a and T1b renal mass.We retrospectively reviewed the medical records of 277 cases of RPN performed from 2006 to 2015. Sixty patients with clinically T1b renal masses (> 4 cm and ≤ 7 cm were identified, and from 180 patients with clinically T1a renal mass, 60 patients were matched with T1b renal mass by propensity score. Tumor complexity was investigated according to R.E.N.A.L nephrometry score. "Pentafecta" was defined as achievement of Trifecta (negative surgical margin, no postoperative complications and warm ischemia time of ≤ 25 minutes with addition of over 90% estimated GFR preservation and no chronic kidney disease stage upgrading at 1 year postoperative period. Propensity score matching was performed by OneToManyMTCH. Logistic regression models were used to identify the variables which predict the Trifecta, and Pentafecta ac.Preoperative variables (age, sex, body mass index, ASA score were similar between T1a and T1b after propensity score matching. The median R.E.N.A.L. nephrometry score was 8 vs 9 for T1a and T1b respectively (p<0.001. The median warm ischemia time was 20.1 min vs 26.2 min (p<0.001. Positive surgical margin rate was 5% vs 6.6% (p = 0.729 and overall complication rate of 13.3%. vs 15% (p = 0.793. The rate of achievement of Trifecta rate were 65.3% vs 43.3% (p = 0.017 and Pentafecta rate were 38.3% vs 26.7% (p = 0.172. For achievement of Pentafecta, R.E.N.A.L nephrometry score (HR 0.80; 95% CI (0.67-0.97; p = 0.031 was significant predictor of achieving Pentafecta. Subanalyis to assess the component of R.E.N.A.L nephrometry score, L component (location relative to the polar lines, HR 0.63; 95% CI (0.38-1.03; P = 0.064 was relatively important component for Pentafecta achievement.The rate of Pentafecta after RAPN was comparable between T1a and T1b renal masses. RAPN is a feasible modality with excellent

  9. Simultaneous Imaging of CBF Change and BOLD with Saturation-Recovery-T1 Method.

    Directory of Open Access Journals (Sweden)

    Xiao Wang

    Full Text Available A neuroimaging technique based on the saturation-recovery (SR-T1 MRI method was applied for simultaneously imaging blood oxygenation level dependence (BOLD contrast and cerebral blood flow change (ΔCBF, which is determined by CBF-sensitive T1 relaxation rate change (ΔR1CBF. This technique was validated by quantitatively examining the relationships among ΔR1CBF, ΔCBF, BOLD and relative CBF change (rCBF, which was simultaneously measured by laser Doppler flowmetry under global ischemia and hypercapnia conditions, respectively, in the rat brain. It was found that during ischemia, BOLD decreased 23.1±2.8% in the cortical area; ΔR1CBF decreased 0.020±0.004s-1 corresponding to a ΔCBF decrease of 1.07±0.24 ml/g/min and 89.5±1.8% CBF reduction (n=5, resulting in a baseline CBF value (=1.18 ml/g/min consistent with the literature reports. The CBF change quantification based on temperature corrected ΔR1CBF had a better accuracy than apparent R1 change (ΔR1app; nevertheless, ΔR1app without temperature correction still provides a good approximation for quantifying CBF change since perfusion dominates the evolution of the longitudinal relaxation rate (R1app. In contrast to the excellent consistency between ΔCBF and rCBF measured during and after ischemia, the BOLD change during the post-ischemia period was temporally disassociated with ΔCBF, indicating distinct CBF and BOLD responses. Similar results were also observed for the hypercapnia study. The overall results demonstrate that the SR-T1 MRI method is effective for noninvasive and quantitative imaging of both ΔCBF and BOLD associated with physiological and/or pathological changes.

  10. A systematic evaluation of three different cardiac T2-mapping sequences at 1.5 and 3T in healthy volunteers.

    Science.gov (United States)

    Baeßler, Bettina; Schaarschmidt, Frank; Stehning, Christian; Schnackenburg, Bernhard; Maintz, David; Bunck, Alexander C

    2015-11-01

    Previous studies showed that myocardial T2 relaxation times measured by cardiac T2-mapping vary significantly depending on sequence and field strength. Therefore, a systematic comparison of different T2-mapping sequences and the establishment of dedicated T2 reference values is mandatory for diagnostic decision-making. Phantom experiments using gel probes with a range of different T1 and T2 times were performed on a clinical 1.5T and 3T scanner. In addition, 30 healthy volunteers were examined at 1.5 and 3T in immediate succession. In each examination, three different T2-mapping sequences were performed at three short-axis slices: Multi Echo Spin Echo (MESE), T2-prepared balanced SSFP (T2prep), and Gradient Spin Echo with and without fat saturation (GraSEFS/GraSE). Segmented T2-Maps were generated according to the AHA 16-segment model and statistical analysis was performed. Significant intra-individual differences between mean T2 times were observed for all sequences. In general, T2prep resulted in lowest and GraSE in highest T2 times. A significant variation with field strength was observed for mean T2 in phantom as well as in vivo, with higher T2 values at 1.5T compared to 3T, regardless of the sequence used. Segmental T2 values for each sequence at 1.5 and 3T are presented. Despite a careful selection of sequence parameters and volunteers, significant variations of the measured T2 values were observed between field strengths, MR sequences and myocardial segments. Therefore, we present segmental T2 values for each sequence at 1.5 and 3T with the inherent potential to serve as reference values for future studies. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  11. NMR longitudinal relaxation enhancement in metal halides by heteronuclear polarization exchange during magic-angle spinning

    Energy Technology Data Exchange (ETDEWEB)

    Shmyreva, Anna A. [Center for Magnetic Resonance, St. Petersburg State University, St. Petersburg 198504 (Russian Federation); Safdari, Majid; Furó, István [Department of Chemistry, KTH Royal Institute of Technology, SE-10044 Stockholm (Sweden); Dvinskikh, Sergey V., E-mail: sergeid@kth.se [Department of Chemistry, KTH Royal Institute of Technology, SE-10044 Stockholm (Sweden); Laboratory of Biomolecular NMR, St. Petersburg State University, St. Petersburg 199034 (Russian Federation)

    2016-06-14

    Orders of magnitude decrease of {sup 207}Pb and {sup 199}Hg NMR longitudinal relaxation times T{sub 1} upon magic-angle-spinning (MAS) are observed and systematically investigated in solid lead and mercury halides MeX{sub 2} (Me = Pb, Hg and X = Cl, Br, I). In lead(II) halides, the most dramatic decrease of T{sub 1} relative to that in a static sample is in PbI{sub 2}, while it is smaller but still significant in PbBr{sub 2}, and not detectable in PbCl{sub 2}. The effect is magnetic-field dependent but independent of the spinning speed in the range 200–15 000 Hz. The observed relaxation enhancement is explained by laboratory-frame heteronuclear polarization exchange due to crossing between energy levels of spin-1/2 metal nuclei and adjacent quadrupolar-spin halogen nuclei. The enhancement effect is also present in lead-containing organometal halide perovskites. Our results demonstrate that in affected samples, it is the relaxation data recorded under non-spinning conditions that characterize the local properties at the metal sites. A practical advantage of fast relaxation at slow MAS is that spectral shapes with orientational chemical shift anisotropy information well retained can be acquired within a shorter experimental time.

  12. Thermal relaxation time of a mixture of relativistic electrons and neutrinos

    International Nuclear Information System (INIS)

    Herrera, M.A.; Hacyan, S.

    1987-01-01

    The interaction between the components of a relativistic binary mixture is studied by means of a fully covariant formalism. Assuming both components to differ slightly in temperature, an application of the relativistic Boltzmann equation yields general expressions for the energy transfer rate and for the relaxation time of the system. The resulting relation is then applied to a mixture of relativistic electrons and neutrinos to obtain numerical values of its relaxation time. (author)

  13. Charge imbalance: its relaxation, diffusion and oscillation

    International Nuclear Information System (INIS)

    Pethick, C.J.

    1981-01-01

    In this article, the authors use a model for charge density based on two charge components: the normal quasiparticle component and the superfluid/condensate component. Based on the quasiparticle Boltzmann equation, this two-component model, when used in nonequilibrium contexts, is fruitful in describing a variety of charge-imbalance phenomena in superconductors. The authors discuss various methods of generating charge-imbalances, charge-imbalance relaxation processes (such as phonons, impurity scattering and magnetic impurities) and applications of the two-component model of charge imbalance to spatially inhomogeneous conditions

  14. Evaluation of clinical state of patients with acute leukemia, multiple myeloma and malignant lymphoma by means of in vitro T1 and T2 measurements in serum

    International Nuclear Information System (INIS)

    Kuliszkiewicz-Janus, M.; Urbaniak-Kujda, D.; Burczak, K.

    1995-01-01

    A dynamic relaxation times T1 and T2 in vitro study has been performed in the human sera of patients with haematological malignant diseases to monitor their clinical state. Two hundred studies were performed in 20 healthy volunteers and in 180 patients with different malignancies, mostly: acute leukemia, Hodgkin's disease, non-Hodgkin's lymphomas, multiple myeloma. Determinations were performed in active phase of disease and in remission. Measurements were carried out on spectrometer Minispect PC 20B (Bruker; 20 MHz) in 27 C. Additionally, serum proteins of all patients were examined, including total protein content, serum electrophoresis and measurement of Ig classes. Remarkable increase of T1 values in active phase of the disease was found (compared to healthy volunteers) in all malignancies, except multiple myeloma. It was associated with the severeness of the illness, not with diagnose. During remission T1 values did not differ significantly from those of healthy persons. All sera of patients with multiple myeloma in active phase of the disease showed strongly reduced values of T1, associated with the high level of pathological proteins. In 45 patients the measurements were repeated up to 4 times before and during chemotherapy. During treatment resulting in remission, mean T1 values progressively decreased (from 1560 ms to 1394 ms) except of those patients with multiple myeloma. In persons non-responding to therapy these mean values were prolonged (from 1474 ms to 1620 ms) during therapy. In patients with multiple myeloma we noted the reverse changes of mean T1 values in comparison with other malignancies: those responding to the treatment revealed prolonged T1 (from 1165 to 1303 ms) while in those non-responding were decreased (from 1184 ms to 1158 ms). Statistically significant negative correlation was observed between the T1 and total protein content, percentage of gamma-globulin, especially of IgG class. Moreover, a remarkable positive correlation of T1

  15. Dicty_cDB: Contig-U08816-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( CT005263 |pid:none) Leishmania major strain Friedlin,... 59 4e-07 ( O14217 ) RecName: Full=Probable mitochondrial imp...cDN... 34 0.59 3 ( CN127549 ) RHOH1_23_D09.g3_A002 Acid- and alkaline-treated r... 38 0.65 2 ( CX584796 ) TTE00035466 Ampli...117 |pid:none) Anabaena variabilis ATCC 29413,... 53 3e-05 (Q9D4H7) RecName: Full=LON peptidase N-term... vidqfhiinldyllnhfkmhwnqlnwkliglkviielvkl*kn*ikkmkpsnimkkvf*l nqiinq*eml*ivf*mlvkkikkvkilplivnqivnqivkkkvnliqnli...54857 ) 1095462006001 Global-Ocean-Sampling_GS-31-01-01-1... 28 0.051 5 ( AC181373 ) Strongylocentrotus purp

  16. Magnetic resonance imaging (MRI) and relaxation time mapping of concrete

    Science.gov (United States)

    Beyea, Steven Donald

    2001-07-01

    The use of Magnetic Resonance Imaging (MRI) of water in concrete is presented. This thesis will approach the problem of MR imaging of concrete by attempting to design new methods, suited to concrete materials, rather than attempting to force the material to suit the method. A number of techniques were developed, which allow the spatial observation of water in concrete in up to three dimensions, and permits the determination of space resolved moisture content, as well as local NMR relaxation times. These methods are all based on the Single-Point Imaging (SPI) method. The development of these new methods will be described, and the techniques validated using phantom studies. The study of one-dimensional moisture transport in drying concrete was performed using SPI. This work examined the effect of initial mixture proportions and hydration time on the drying behaviour of concrete, over a period of three months. Studies of drying concrete were also performed using spatial mapping of the spin-lattice (T1) and effective spin-spin (T2*) relaxation times, thereby permitting the observation of changes in the water occupied pore surface-to-volume ratio (S/V) as a function of drying. Results of this work demonstrated changes in the S/V due to drying, hydration and drying induced microcracking. Three-dimensional MRI of concrete was performed using SPRITE (Single-Point Ramped Imaging with T1 Enhancement) and turboSPI (turbo Single Point Imaging). While SPRITE allows for weighting of MR images using T 1 and T2*, turboSPI allows T2 weighting of the resulting images. Using relaxation weighting it was shown to be possible to discriminate between water contained within a hydrated cement matrix, and water in highly porous aggregates, used to produce low-density concrete. Three dimensional experiments performed using SPRITE and turboSPI examined the role of self-dessication, drying, initial aggregate saturation and initial mixture conditions on the transport of moisture between porous

  17. T2 Relaxation Time Mapping of Proximal Tibiofibular Cartilage by 3-Tesla Magnetic Resonance Imaging

    International Nuclear Information System (INIS)

    Kwack, Kyu-Sung; Cho, Jae Hyun; Kim, Jun Man; Kim, Sun Yong; Min, Byoung-Hyun; Yoon, Seung-Hyun

    2009-01-01

    Background: The proximal tibiofibular joint (PTFJ) can be considered the fourth compartment of the knee joint. However, there have been no studies of the T2 values (T2 relaxation time) of PTFJ cartilage. Purpose: To assess the T2 values of PTFJ cartilage at 3T magnetic resonance imaging (MRI), and to show the clinical utility of T2 values of PTFJ cartilage for the diagnosis of osteoarthritis (OA). Material and Methods: 118 patients who had knee MR imaging and knee radiography were enrolled. MRI was performed using a 3T MRI scanner, and T2 maps were calculated from a sagittal multi-echo acquisition. Two regions of interest (ROIs) were positioned within PTFJ cartilage and medial femoral condyle (MFC) cartilage. The average T2 value and standard deviation (SD) of each ROI were recorded. Using PTFJ cartilage as a standard reference, the T2 index ((MFC/PTFJ)x100) and T2SD index ((MFCSD/PTFJSD)x100) were calculated. A paired t test was performed to compare the mean and SD of ROIs within PTFJ and MFC cartilage. Correlation analyses were performed among the parameters age, Kellgren-Lawrence (KL) score, means and SDs of ROIs within PTFJ and MFC cartilage, T2 index, and T2SD index. Results: PTFJ cartilage had a significantly shorter T2 value than did MFC cartilage (P<0.0001). ROIs within PTFJ cartilage showed significantly smaller SDs than did those within MFC cartilage (P<0.0001). The average T2 value and SD of MFC and the T2SD index showed a positive correlation to the KL score (P<0.05). The correlation coefficients for the average T2 value, SD, and T2SD index of MFC were R=0.203, 0.254, and 0.268, respectively. However, there was no significant correlation between T2 values of PTFJ cartilage and KL score (P=0.643). Conclusion: PTFJ cartilage showed shorter and more homogeneous T2 values with a small SD than did MFC cartilage, regardless of the degree of OA at femorotibial compartments. PTFJ cartilage may be a useful internal standard reference to diagnose OA and would be

  18. T2 Relaxation Time Mapping of Proximal Tibiofibular Cartilage by 3-Tesla Magnetic Resonance Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Kwack, Kyu-Sung; Cho, Jae Hyun; Kim, Jun Man; Kim, Sun Yong (Dept. of Radiology, Ajou Univ. Medical Center, Suwon (Korea)); Min, Byoung-Hyun; Yoon, Seung-Hyun (Cartilage Regeneration Center, Ajou Univ. Medical Center, Suwon (Korea))

    2009-11-15

    Background: The proximal tibiofibular joint (PTFJ) can be considered the fourth compartment of the knee joint. However, there have been no studies of the T2 values (T2 relaxation time) of PTFJ cartilage. Purpose: To assess the T2 values of PTFJ cartilage at 3T magnetic resonance imaging (MRI), and to show the clinical utility of T2 values of PTFJ cartilage for the diagnosis of osteoarthritis (OA). Material and Methods: 118 patients who had knee MR imaging and knee radiography were enrolled. MRI was performed using a 3T MRI scanner, and T2 maps were calculated from a sagittal multi-echo acquisition. Two regions of interest (ROIs) were positioned within PTFJ cartilage and medial femoral condyle (MFC) cartilage. The average T2 value and standard deviation (SD) of each ROI were recorded. Using PTFJ cartilage as a standard reference, the T2 index ((MFC/PTFJ)x100) and T2SD index ((MFCSD/PTFJSD)x100) were calculated. A paired t test was performed to compare the mean and SD of ROIs within PTFJ and MFC cartilage. Correlation analyses were performed among the parameters age, Kellgren-Lawrence (KL) score, means and SDs of ROIs within PTFJ and MFC cartilage, T2 index, and T2SD index. Results: PTFJ cartilage had a significantly shorter T2 value than did MFC cartilage (P<0.0001). ROIs within PTFJ cartilage showed significantly smaller SDs than did those within MFC cartilage (P<0.0001). The average T2 value and SD of MFC and the T2SD index showed a positive correlation to the KL score (P<0.05). The correlation coefficients for the average T2 value, SD, and T2SD index of MFC were R=0.203, 0.254, and 0.268, respectively. However, there was no significant correlation between T2 values of PTFJ cartilage and KL score (P=0.643). Conclusion: PTFJ cartilage showed shorter and more homogeneous T2 values with a small SD than did MFC cartilage, regardless of the degree of OA at femorotibial compartments. PTFJ cartilage may be a useful internal standard reference to diagnose OA and would be

  19. Three Treatments for Reducing the Worry and Emotionality Components of Test Anxiety with Undergraduate and Graduate College Students: Cognitive-Behavioral Hypnosis, Relaxation Therapy, and Supportive Counseling.

    Science.gov (United States)

    Sapp, Marty

    1996-01-01

    Examines the effects of 3 different types of therapy in reducing the worry and emotional components associated with test anxiety among undergraduate (n=45) and graduate (n=45) students. Relaxation therapy was more effective with graduate students, while undergraduates responded more to supportive counseling. (JPS)

  20. Picosecond intersubband hole relaxation in p-type quantum wells

    International Nuclear Information System (INIS)

    Xu, Z.; Fauchet, P.M.; Rella, C.W.; Schwettman, H.A.

    1995-01-01

    We report the first direct measurement of the relaxation time of holes in p-type quantum wells using tunable, subpicosecond mid-infrared laser pulses in a pump-probe arrangement. The QW layers consisted of 50 In 0.5 Ga 0.5 As/Al 0.5 Ga 0.5 As periods. The In 0.5 Ga 0.5 As well was 4 nm wide and the Al 0.5 Ga 0.5 As barrier was 8 nm wide. The dopant concentration was 10 19 CM -3 which corresponds to a sheet density of 1.2 x 10 13 CM -2 . The room temperature IR spectrum showed a 50 meV wide absorption peak at 5.25 μm (220 meV). This energy agrees with the calculated n=1 heavy hole to n=1 light hole transition energy of 240 meV (150 meV for strain and 90 meV for confinement). The large absorption width results from hole-hole scattering and the difference in dispersion relations between the two subbands. The equal-wavelength pump-probe transmission measurements were performed using the Stanford free electron laser (FEL). The FEL pulses were tuned between 4 and 6 μ m and their duration was less than 1 ps. The measurements were performed as a function of temperature, pump wavelength and intensity (from 0.3 to 10 GW/cm 2 ). In all our experiments, we find an increase of transmission (decrease of absorption or bleaching) following photopumping, which recovers as a single exponential with a time constant (relaxation time) of the order of 1 picosecond. The maximum change in transmission is linear with pump 2 intensity below 1 GW/cm 2 and saturates to ∼3% with a saturation intensity I sat of 3 GW/cm 2 . As the saturation regime is entered, the relaxation time increases from 0.8 ps to 1.8 ps. This relaxation time depends on the temperature T: it increases from 0.8 ps to 1.3 ps as T decreases from 300 K to 77 K. Finally, when we tune the laser through the absorption band, the magnitude of the signal changes but its temporal behavior does not change, within the accuracy of the measurements

  1. SU-E-I-64: Transverse Relaxation Time in Methylene Protons of Non-Alcoholic Fatty Liver Disease Rats

    Energy Technology Data Exchange (ETDEWEB)

    Song, K-H; Lee, D-W; Choe, B-Y [Department of Biomedical Engineering, Research Institute of Biomedical Engineering, College of Medicine, The Catholic University of Korea, Seoul, Seoul (Korea, Republic of)

    2015-06-15

    Purpose: The aim of this study was to evaluate transverse relaxation time of methylene resonance compared to other lipid resonances. Methods: The examinations were performed using a 3.0 T scanner with a point — resolved spectroscopy (PRESS) sequence. Lipid relaxation time in a lipid phantom filled with canola oil was estimated considering repetition time (TR) as 6000 msec and echo time (TE) as 40 — 550 msec. For in vivo proton magnetic resonance spectroscopy ({sup 1}H — MRS), eight male Sprague — Dawley rats were given free access to a normal - chow (NC) and eight other male Sprague-Dawley rats were given free access to a high — fat (HF) diet. Both groups drank water ad libitum. T{sub 2} measurements in the rats’ livers were conducted at a fixed TR of 6000 msec and TE of 40 – 220 msec. Exponential curve fitting quality was calculated through the coefficients of determination (R{sup 2}). Results: A chemical analysis of phantom and liver was not performed but a T{sub 2} decay curve was acquired. The T{sub 2} relaxation time of methylene resonance was estimated as follows: NC rats, 37.07 ± 4.32 msec; HF rats, 31.43 ± 1.81 msec (p < 0.05). The extrapolated M0 values were higher in HF rats than in NC rats (p < 0.005). Conclusion: This study of {sup 1}H-MRS led to sufficient spectral resolution and signal — to — noise ratio differences to characterize all observable resonances for yielding T{sub 2} relaxation times of methylene resonance. {sup 1}H — MRS relaxation times may be useful for quantitative characterization of various liver diseases, including fatty liver disease. This study was supported by grant (2012-007883 and 2014R1A2A1A10050270) from the Mid-career Researcher Program through the NRF funded by Ministry of Science. In addition, this study was supported by the Industrial R&D of MOTIE/KEIT (10048997, Development of the core technology for integrated therapy devices based on real-time MRI-guided tumor tracking)

  2. Relaxation of inservice test frequency requirement for Kori 1 ASME code pumps

    International Nuclear Information System (INIS)

    Sohn, Gap Heon; Choi, Hae Yoon; Min, Kyung Sung; Rim, Nam Jin

    1994-08-01

    The objective of this investigation is to evaluate the technical and regulational requirements to justify the relaxation of the test frequency of Kori 1 pumps through reviewing the related rules and codes and standards, technical specifications of Kori 1 and other similar plants, standard technical specifications, research results for tech. spec. improvements and site test records. It is concluded that the relaxation of test frequency to quarterly be justified based on the conformance with rules and codes and standard, quarterly test cases in similar plants and standard tech. spec., recommendations of research result and stable site test records. (Author) 16 refs., 26 figs., 13 tabs

  3. T2 mapping in patellar chondromalacia.

    Science.gov (United States)

    Ruiz Santiago, Fernando; Pozuelo Calvo, Rocío; Almansa López, Julio; Guzmán Álvarez, Luis; Castellano García, María Del Mar

    2014-06-01

    To study the correlation between the T2 relaxation times of the patellar cartilage and morphological MRI findings of chondromalacia. This prospective study comprises 50 patients, 27 men and 23 women suffering of anterior knee pain (mean age: 29.7, SD 8.3 years; range: 16-45 years). MRI of 97 knees were performed in these patients at 1.5T magnet including sagittal T1, coronal intermediate, axial intermediate fat sat and T2 mapping. Chondromalacia was assessed using a modified version of Noyes classification. The relaxation time, T2, was studied segmenting the full thickness of the patellar cartilage in 12 areas: 4 proximal (external facet-proximal-lateral (EPL), external facet-proximal-central (EPC), internal facet-proximal-central (IPC), internal facet-proximal-medial (IPM), 4 in the middle section (external facet-middle-lateral (EML), external facet-middle-central (EMC), internal facet-middle-central (IMC), internal facet-middle-medial (IMM) and 4 distal (external facet-distal-lateral (EDL), external facet-distal-central (EDC), internal facet-distal-central (IDC), internal facet-distal-medial (IDM). T2 values showed a significant increase in mild chondromalacia regarding normal cartilage in most of the cartilage areas (pchondromalacia was characterized by a fall of T2 relaxation times with loss of statistical significant differences in comparison with normal cartilage, except in EMC and IMC, where similar values as mild chondromalacia were maintained (pchondromalacia to more severe degrees is associated to a new drop of T2 relaxation times approaching basal values in most of the areas of the patellar cartilage, except in the central area of the middle section, where T2 values remain increased. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  4. Peroxynitrite-induced relaxation in isolated rat aortic rings and mechanisms of action

    International Nuclear Information System (INIS)

    Li Jianfeng; Li Wenyan; Altura, Bella T.; Altura, Burton M.

    2005-01-01

    The present study was designed to evaluate the effects of peroxynitrite (ONOO - ), the product of superoxide and nitric oxide, on isolated segments of rat aorta. In the absence of any vasoactive agent, ONOO - (from 10 -8 to 10 -4 M) failed to alter the basal tension. In phenylephrine (PE; 5 x 10 -7 M)-precontracted rat aortic rings (RAR), ONOO - elicited concentration-dependent relaxation at concentrations of from 10 -8 to 10 -4 M. The effective concentrations producing approximately 50% of maximal relaxation (ED 5 ) to ONOO - were 1.84 x 10 -5 M and 1.96 x 10 -5 M in intact and denuded RAR, respectively (P > 0.05). No significant differences in the relaxation responses were found between RAR with or without endothelium (P > 0.05). The presence of either 5 μM methylene blue (MB) or 5 μM 1H-[1,2,4]oxadiazolo-[4,3-α]quinoxalin-1-one (ODQ) significantly inhibited the relaxations induced by ONOO - . Sildenafil (10 -7 M), on the other hand, significantly potentiated the ONOO - -induced relaxations. Tetraethylammonium chloride (T-2265) significantly decreased the ONOO - -induced relaxations in a concentration-dependent manner. However, ONOO - had no effect on RAR precontracted by high KCL (40 mM, n = 6, P > 0.05). Addition of calyculin A also significantly decreased the ONOO - -induced relaxation in a dose-dependent manner. Furthermore, ONOO - significantly inhibited calcium-induced contractions of K + -depolarized aortic rings in a concentration-related manner. Lastly, a variety of other pharmacological agents and antagonists including L-NMMA, L-arginine, indomethacin, atropine, naloxone, diphenhydramine, cimetine, glibenclamide, haloperidol, superoxide dismutase (SOD), and catalase did not influence the relaxant effects of ONOO - on RAR. Our new results suggest that ONOO - -triggered relaxation on rat aortic rings is mediated by elevation of cGMP levels, membrane hyperpolarization via K + -channel activation, activation of myosin phosphatase activity, and

  5. Hyperhomocysteinemia potentiates diabetes-impaired EDHF-induced vascular relaxation: Role of insufficient hydrogen sulfide

    Directory of Open Access Journals (Sweden)

    Zhongjian Cheng

    2018-06-01

    Full Text Available Insufficient hydrogen sulfide (H2S has been implicated in Type 2 diabetic mellitus (T2DM and hyperhomocysteinemia (HHcy-related cardiovascular complications. We investigated the role of H2S in T2DM and HHcy-induced endothelial dysfunction in small mesenteric artery (SMA of db/db mice fed a high methionine (HM diet. HM diet (8 weeks induced HHcy in both T2DM db/db mice and non-diabetic db/+ mice (total plasma Hcy: 48.4 and 31.3 µM, respectively, and aggravated the impaired endothelium-derived hyperpolarization factor (EDHF-induced endothelium-dependent relaxation to acetylcholine (ACh, determined by the presence of eNOS inhibitor N(ω-nitro-L-arginine methyl ester (L-NAME and prostacyclin (PGI2 inhibitor indomethacin (INDO, in SMA from db/db mice but not that from db/+ mice. A non-selective Ca2+-active potassium channel (KCa opener NS309 rescued T2DM/HHcy-impaired EDHF-mediated vascular relaxation to ACh. EDHF-induced relaxation to ACh was inhibited by a non-selective KCa blocker TEA and intermediate-conductance KCa blocker (IKCa Tram-34, but not by small-conductance KCa (SKCa blocker Apamin. HHcy potentiated the reduction of free sulfide, H2S and cystathionine γ-lyase protein, which converts L-cysteine to H2S, in SMA of db/db mice. Importantly, a stable H2S donor DATS diminished the enhanced O2- production in SMAs and lung endothelial cells of T2DM/HHcy mice. Antioxidant PEG-SOD and DATS improved T2DM/HHcy impaired relaxation to ACh. Moreover, HHcy increased hyperglycemia-induced IKCa tyrosine nitration in human micro-vascular endothelial cells. EDHF-induced vascular relaxation to L-cysteine was not altered, whereas such relaxation to NaHS was potentiated by HHcy in SMA of db/db mice which was abolished by ATP-sensitive potassium channel blocker Glycolamide but not by KCa blockers. Conclusions: Intermediate HHcy potentiated H2S reduction via CSE-downregulation in microvasculature of T2DM mice. H2S is justified as an EDHF. Insufficient H2S

  6. Experimental comparison of diffusional nuclear magnetic relaxation theories using ZrHsub(1.684)

    International Nuclear Information System (INIS)

    Korn, C.; Goren, S.

    1984-01-01

    The spin-lattice relaxation time of hydrogen in ZrHsub(1.684) was measured at a resonance frequency of 16.69 MHz as a function of temperature in a temperature range where the major relaxation mechanism was hydrogen diffusion. This parameter was used to calculate the hydrogen jump frequencies using the theories of Bloembergen, Purcell and Pound (BPP), of Bustard and of Barton and Sholl. A comparison shows that the BPP theory gives results closest to Arrhenius-type behaviour. The diffusional activation energy was found to be 13.3 kcal mol -1 . (Auth.)

  7. Time-Dependent Changes in T1 during Fracture Healing in Juvenile Rats: A Quantitative MR Approach.

    Directory of Open Access Journals (Sweden)

    Katharina Baron

    Full Text Available Quantitative magnetic resonance imaging (qMRI offers several advantages in imaging and determination of soft tissue alterations when compared to qualitative imaging techniques. Although applications in brain and muscle tissues are well studied, its suitability to quantify relaxation times of intact and injured bone tissue, especially in children, is widely unknown. The objective observation of a fracture including its age determination can become of legal interest in cases of child abuse or maltreatment. Therefore, the aim of this study is the determination of time dependent changes in intact and corresponding injured bones in immature rats via qMRI, to provide the basis for an objective and radiation-free approach for fracture dating. Thirty-five MR scans of 7 Sprague-Dawley rats (male, 4 weeks old, 100 ± 5 g were acquired on a 3T MRI scanner (TimTrio, Siemens AG, Erlangen, Germany after the surgical infliction of an epiphyseal fracture in the tibia. The images were taken at days 1, 3, 7, 14, 28, 42 and 82 post-surgery. A proton density-weighted and a T1-weighted 3D FLASH sequence were acquired to calculate the longitudinal relaxation time T1 of the fractured region and the surrounding tissues. The calculation of T1 in intact and injured bone resulted in a quantitative observation of bone development in intact juvenile tibiae as well as the bone healing process in the injured tibiae. In both areas, T1 decreased over time. To evaluate the differences in T1 behaviour between the intact and injured bone, the relative T1 values (bone-fracture were calculated, showing clear detectable alterations of T1 after fracture occurrence. These results indicate that qMRI has a high potential not only for clinically relevant applications to detect growth defects or developmental alterations in juvenile bones, but also for forensically relevant applications such as the dating of fractures in cases of child abuse or maltreatment.

  8. Relaxation of photoconductivity and persistent photoconductivity in TiO2 nanotubes

    International Nuclear Information System (INIS)

    Enachi, Mihail; Braniste, Tudor; Borodin, Eugeniu; Postolache, Vitalie

    2013-01-01

    Relaxation of photoconductivity is investigated in titania nanotubes produced by electrochemical treatment of Ti foils in organic electrolytes with subsequent thermal treatment at 400 degrees Celsius in air. The photoconductivity was excited both in air and in vacuum with the radiation from a xenon lamp passed through different filters to vary the excitation intensity and wavelength. It was found that the photoconductivity relaxation process consists of two components, i. e. a fast component a slow one. These two components behave differently in air and in the vacuum. The fast component is even faster under vacuum, while the slow component in vacuum is much slower, therefore leading to persistent photoconductivity. The possibility of removing the persistent photoconductivity state by exposure to air is investigated. (authors)

  9. Residual stresses relaxation in surface-hardened half-space under creep conditions

    Directory of Open Access Journals (Sweden)

    Vladimir P. Radchenko

    2015-09-01

    Full Text Available We developed the method for solving the problem of residual stresses relaxation in surface-hardened layer of half-space under creep conditions. At the first stage we made the reconstruction of stress-strain state in half-space after plastic surface hardening procedure based on partial information about distribution for one residual stress tensor component experimentally detected. At the second stage using a numerical method we solve the problem of relaxation of self-balanced residual stresses under creep conditions. To solve this problem we introduce the following Cartesian system: x0y plane is aligned with hardened surface of half-space and 0z axis is directed to the depth of hardened layer. We also introduce the hypotheses of plane sections parallel to x0z and y0z planes. Detailed analysis of the problem has been done. Comparison of the calculated data with the corresponding test data was made for plane specimens (rectangular parallelepipeds made of EP742 alloy during T=650°C after the ultrasonic hardening with four hardening modes. We use half-space to model these specimens because penetration's depth of residual stresses is less than specimen general size in two digit exponent. There is enough correspondence of experimental and calculated data. It is shown that there is a decay (in modulus of pressing residual stresses under creep in 1.4–1.6 times.

  10. Enhanced relaxation of strained Ge{sub x}Si{sub 1-x} layers induced by Co/Ge{sub x}Si{sub 1-x} thermal reaction

    Energy Technology Data Exchange (ETDEWEB)

    Ridgway, M.C.; Elliman, R.G.; Rao, M.R. [Australian National Univ., Canberra, ACT (Australia); Baribeau, J.M. [National Research Council of Canada, Ottawa, ON (Canada)

    1993-12-31

    Enhanced relaxation of strained Ge{sub x}Si{sub l-x} layers during the formation of CoSi{sub 2} by Co/Ge{sub x}Si{sub 1-x} thermal reaction has been observed. Raman spectroscopy and transmission electron microscopy were used to monitor the extent of relaxation. Possible mechanisms responsible for the enhanced relaxation, including metal-induced dislocation nucleation, chemical and/or structural inhomogeneities at the reacted layer/Ge{sub x}Si{sub 1-x} interface and point defect injection due to silicide formation will be discussed. Also, methodologies for inhibiting relaxation will be presented. 11 refs., 1 fig.

  11. Enhanced relaxation of strained Ge{sub x}Si{sub 1-x} layers induced by Co/Ge{sub x}Si{sub 1-x} thermal reaction

    Energy Technology Data Exchange (ETDEWEB)

    Ridgway, M C; Elliman, R G; Rao, M R [Australian National Univ., Canberra, ACT (Australia); Baribeau, J M [National Research Council of Canada, Ottawa, ON (Canada)

    1994-12-31

    Enhanced relaxation of strained Ge{sub x}Si{sub l-x} layers during the formation of CoSi{sub 2} by Co/Ge{sub x}Si{sub 1-x} thermal reaction has been observed. Raman spectroscopy and transmission electron microscopy were used to monitor the extent of relaxation. Possible mechanisms responsible for the enhanced relaxation, including metal-induced dislocation nucleation, chemical and/or structural inhomogeneities at the reacted layer/Ge{sub x}Si{sub 1-x} interface and point defect injection due to silicide formation will be discussed. Also, methodologies for inhibiting relaxation will be presented. 11 refs., 1 fig.

  12. Nuclear magnetic relaxation of methyl group in liquids

    International Nuclear Information System (INIS)

    Blicharska, B.

    1986-01-01

    The theoretical description of the relaxation process of methyl group in liquids and some results of the measurements of relaxation function and relaxation times for cryoprotective solutions are presented. Starting from the application of the operator formalism the general equation for spin operators e.g. components of the nuclear spin and magnetization is founded. Next, the spin Hamiltonian is presented as contraction of the symmetry adapted spherical tensors as well as the correlation functions and spectral densities. On the basis of extended and modified Woessner model of motion the correlation functions and spectral densities are calculated for methyl group in liquids. Using these functions the relaxation matrix elements, the spin-spin and spin-lattice relaxation times can be expressed. The prediction of the theory agrees with author's previous experiments on cryoprotective solutions. The observed dependence on temperature, frequency and isotopic dilution in methanol-water, methanol-dimethyl sulfoxide (DMSO) and DMSO-water solutions is in a satisfactory agreement with theoretical equations. 34 refs. (author)

  13. ASXL2 mutations are frequently found in pediatric AML patients with t(8;21)/ RUNX1-RUNX1T1 and associated with a better prognosis.

    Science.gov (United States)

    Yamato, Genki; Shiba, Norio; Yoshida, Kenichi; Shiraishi, Yuichi; Hara, Yusuke; Ohki, Kentaro; Okubo, Jun; Okuno, Haruna; Chiba, Kenichi; Tanaka, Hiroko; Kinoshita, Akitoshi; Moritake, Hiroshi; Kiyokawa, Nobutaka; Tomizawa, Daisuke; Park, Myoung-Ja; Sotomatsu, Manabu; Taga, Takashi; Adachi, Souichi; Tawa, Akio; Horibe, Keizo; Arakawa, Hirokazu; Miyano, Satoru; Ogawa, Seishi; Hayashi, Yasuhide

    2017-05-01

    ASXL2 is an epigenetic regulator involved in polycomb repressive complex regulation or recruitment. Clinical features of pediatric acute myeloid leukemia (AML) patients with ASXL2 mutations remain unclear. Thus, we investigated frequencies of ASXL1 and ASXL2 mutations, clinical features of patients with these mutations, correlations of these mutations with other genetic alterations including BCOR/BCORL1 and cohesin complex component genes, and prognostic impact of these mutations in 369 pediatric patients with de novo AML (0-17 years). We identified 9 (2.4%) ASXL1 and 17 (4.6%) ASXL2 mutations in 25 patients. These mutations were more common in patients with t(8;21)(q22;q22)/RUNX1-RUNX1T1 (ASXL1, 6/9, 67%, P = 0.02; ASXL2, 10/17, 59%, P = 0.01). Among these 25 patients, 4 (27%) of 15 patients with t(8;21) and 6 (60%) of 10 patients without t(8;21) relapsed. However, most patients with relapse were rescued using stem cell transplantation irrespective of t(8;21). The overall survival (OS) and event-free survival (EFS) rates showed no differences among pediatric AML patients with t(8;21) and ASXL1 or ASXL2 mutations and ASXL wild-type (5-year OS, 75% vs. 100% vs. 91% and 5-year EFS, 67% vs. 80% vs. 67%). In 106 patients with t(8;21) AML, the coexistence of mutations in tyrosine kinase pathways and chromatin modifiers and/or cohesin complex component genes had no effect on prognosis. These results suggest that ASXL1 and ASXL2 mutations play key roles as cooperating mutations that induce leukemogenesis, particularly in pediatric AML patients with t(8;21), and these mutations might be associated with a better prognosis than that reported previously. © 2017 Wiley Periodicals, Inc.

  14. Relaxation in the XX quantum chain

    International Nuclear Information System (INIS)

    Platini, Thierry; Karevski, Dragi

    2007-01-01

    We present the results obtained on the magnetization relaxation properties of an XX quantum chain in a transverse magnetic field. We first consider an initial thermal kink-like state where half of the chain is initially thermalized at a very high temperature T b while the remaining half, called the system, is put at a lower temperature T s . From this initial state, we derive analytically the Green function associated with the dynamical behaviour of the transverse magnetization. Depending on the strength of the magnetic field and on the temperature of the system, different regimes are obtained for the magnetic relaxation. In particular, with an initial droplet-like state, that is a cold subsystem of the finite size in contact at both ends with an infinite temperature environment, we derive analytically the behaviour of the time-dependent system magnetization

  15. Spin-lattice relaxation of individual solid-state spins

    Science.gov (United States)

    Norambuena, A.; Muñoz, E.; Dinani, H. T.; Jarmola, A.; Maletinsky, P.; Budker, D.; Maze, J. R.

    2018-03-01

    Understanding the effect of vibrations on the relaxation process of individual spins is crucial for implementing nanosystems for quantum information and quantum metrology applications. In this work, we present a theoretical microscopic model to describe the spin-lattice relaxation of individual electronic spins associated to negatively charged nitrogen-vacancy centers in diamond, although our results can be extended to other spin-boson systems. Starting from a general spin-lattice interaction Hamiltonian, we provide a detailed description and solution of the quantum master equation of an electronic spin-one system coupled to a phononic bath in thermal equilibrium. Special attention is given to the dynamics of one-phonon processes below 1 K where our results agree with recent experimental findings and analytically describe the temperature and magnetic-field scaling. At higher temperatures, linear and second-order terms in the interaction Hamiltonian are considered and the temperature scaling is discussed for acoustic and quasilocalized phonons when appropriate. Our results, in addition to confirming a T5 temperature dependence of the longitudinal relaxation rate at higher temperatures, in agreement with experimental observations, provide a theoretical background for modeling the spin-lattice relaxation at a wide range of temperatures where different temperature scalings might be expected.

  16. The Effect of Relaxation Interventions on Cortisol Levels in HIV-Sero-Positive Women

    Science.gov (United States)

    Jones, Deborah; Owens, Mary; Kumar, Mahendra; Cook, Ryan; Weiss, Stephen M.

    2016-01-01

    Purpose Activation of the hypothalamic–pituitary–adrenal axis, assessed in terms of cortisol levels, may enhance the ability of HIV to infect lymphocytes and downregulate the immune system, accelerating disease progression. This study sought to determine the effects of relaxation techniques on cortisol levels in HIV-sero-positive women. Methods Women (n = 150) were randomized to a group cognitive–behavioral stress management (CBSM) condition or an individual information condition and underwent 3 types of relaxation training (progressive muscle relaxation, imagery, and autogenic training). Cortisol levels were obtained pre- and postrelaxation. Results Guided imagery was effective in reducing cortisol in the group condition (t = 3.90, P < .001), and muscle relaxation reduced cortisol in the individual condition (t = 3.11, P = .012). Among participants in the group condition attending all sessions, the magnitude of pre- to postsession reduction became greater over time. Conclusions Results suggest that specific relaxation techniques may be partially responsible for cortisol decreases associated with relaxation and CBSM. PMID:23715264

  17. Anisotropic temperature relaxation of plasmas in an external magnetic field

    International Nuclear Information System (INIS)

    Hassan, M.H.A.

    1977-01-01

    The magnetized kinetic equation derived in an earlier paper (Hassan and Watson, 1977) is used to study the problem of relaxation of anisotropic electron and ion temperatures in a magnetized plasma. In the case of anisotropic electron temperature relaxation, it is shown that for small anisotropies the exchange of energy within the electrons between the components parallel and perpendicular to the magnetic field direction determine the relaxation rate. For anisotropic ion temperature relaxation it is shown that the essential mechanism for relaxation is provided by energy transfer between ions and electrons, and that the expression for the relaxation rate perpendicular to the magnetic field contains a significant term proportional to ln eta 0 ln (msub(e)/msub(i)) (where eta 0 = Ωsub(e)/ksub(D)Vsub(e perpendicular to)), in addition to the term proportional to the Coulomb logarithm. (author)

  18. TEACHING NEUROMUSCULAR RELAXATION.

    Science.gov (United States)

    NORRIS, JEANNE E.; STEINHAUS, ARTHUR H.

    THIS STUDY ATTEMPTED TO FIND OUT WHETHER (1) THE METHODS FOR ATTAINING NEUROMUSCULAR RELAXATION THAT HAVE PROVED FRUITFUL IN THE ONE-TO-ONE RELATIONSHIP OF THE CLINIC CAN BE SUCCESSFULLY ADAPTED TO THE TEACHER-CLASS RELATIONSHIP OF THE CLASSROOM AND GYMNASIUM, AND (2) NEUROMUSCULAR RELAXATION CAN BE TAUGHT SUCCESSFULLY BY AN APPROPRIATELY TRAINED…

  19. Effects of alloying elements on the Snoek-type relaxation in Ti–Nb–X–O alloys (X = Al, Sn, Cr, and Mn)

    International Nuclear Information System (INIS)

    Lu, H.; Li, C.X.; Yin, F.X.; Fang, Q.F.; Umezawa, O.

    2012-01-01

    Highlights: ► The O Snoek-type relaxation in the Ti–Nb–X–O alloys was investigated. ► The dipole shape factor (δλ) and critical temperature T c were deduced from the peak. ► The δλ and T c were analyzed in terms of the d-orbital energy level (Md). ► With decreasing Md, the δλ increases and saturates at last while the T c decreases. ► The Md can be taken as a key parameter in designing high damping β-Ti alloys. - Abstract: The effect of alloying elements on the oxygen Snoek-type relaxation in the Ti–24Nb–X–1.7O alloys (X = 1Al, 2Al, 1Sn, 2Sn, 2Cr, 2Mn) was investigated in order to develop high damping materials based on point defect relaxation process. The relaxation strength of the Ti–Nb–Al–O and Ti–Nb–Sn–O alloys is the highest while that of the Ti–Nb–Mn–O and Ti–Nb–Cr–O alloys is the lowest. The dipole shape factor (δλ) and critical temperature T c , which are intrinsic to the Snoek-type relaxation, were figured out and analyzed in terms of the d-orbital energy level (Md) for each alloy based on the measured damping peak. With the decreasing Md, the δλ increases and saturates at last when the Md decreases to a certain value (about 2.435 eV), while the critical temperature T c decreases linearly. The parameter Md can be taken as a key parameter in designing high damping β-Ti alloys, that is, to design an intermediate value of Md at which the values of both δλ and T c are as high as possible.

  20. Exciton-relaxation dynamics in lead halides

    International Nuclear Information System (INIS)

    Iwanaga, Masanobu; Hayashi, Tetsusuke

    2003-01-01

    We survey recent comprehensive studies of exciton relaxation in the crystals of lead halides. The luminescence and electron-spin-resonance studies have revealed that excitons in lead bromide spontaneously dissociate and both electrons and holes get self-trapped individually. Similar relaxation has been also clarified in lead chloride. The electron-hole separation is ascribed to repulsive correlation via acoustic phonons. Besides, on the basis of the temperature profiles of self-trapped states, we discuss the origin of luminescence components which are mainly induced under one-photon excitation into the exciton band in lead fluoride, lead chloride, and lead bromide

  1. Transport relaxation measurements and glassy state effects in superconducting MgB2

    International Nuclear Information System (INIS)

    Olutas, M.; Yetis, H.; Altinkok, A.; Kilic, A.; Kilic, K.

    2008-01-01

    Time dependent effects in superconducting MgB 2 have been studied systematically for the first time by transport relaxation measurements (V-t curves) as a function of transport current (I), temperature (T) and external magnetic field (H). At very low dissipation levels (below ∼1 μV), it was observed that the sample voltage grows up smoothly in time by exhibiting the details of initial stage of relaxation process. At high dissipation levels, steady state corresponding to constant flow rate is maintained within a very short time and monitoring of details of flux dynamic evolving along sample becomes difficult on long time scales. Another interesting behavior is the appearance of voltage peak when the transport current was reduced to a finite value. After peak, it was observed that the sample voltage relaxes smoothly by leveling off within a very short time. The evolution of V-t curves suggests that formation of resistive flow channels along sample develops easily, which is quite similar to that of obtained for the superconducting ceramic samples whose grain boundaries are improved. Time dependent effects were also observed in magnetovoltage measurements (V-H curves) as the field sweep rate (dH/dt) varies. The observations were interpreted mainly in terms of flux trapping in grains

  2. Real-time relaxation and kinetics in hot scalar QED: Landau damping

    International Nuclear Information System (INIS)

    Boyanovsky, D.; Vega, H.J. de; Holman, R.; Kumar, S.P.; Pisarski, R.D.

    1998-01-01

    The real time evolution of non-equilibrium expectation values with soft length scales ∼k -1 >(eT) -1 is solved in hot scalar electrodynamics, with a view towards understanding relaxational phenomena in the QGP and the electroweak plasma. We find that the gauge invariant non-equilibrium expectation values relax via power laws to asymptotic amplitudes that are determined by the quasiparticle poles. The long time relaxational dynamics and relevant time scales are determined by the behavior of the retarded self-energy not at the small frequencies, but at the Landau damping thresholds. This explains the presence of power laws and not of exponential decay. In the process we rederive the HTL effective action using non-equilibrium field theory. Furthermore we obtain the influence functional, the Langevin equation and the fluctuation-dissipation theorem for the soft modes, identifying the correlators that emerge in the classical limit. We show that a Markovian approximation fails to describe the dynamics both at short and long times. We find that the distribution function for soft quasiparticles relaxes with a power law through Landau damping. We also introduce a novel kinetic approach that goes beyond the standard Boltzmann equation by incorporating off-shell processes and find that the distribution function for soft quasiparticles relaxes with a power law through Landau damping. We find an unusual dressing dynamics of bare particles and anomalous (logarithmic) relaxation of hard quasiparticles. copyright 1998 The American Physical Society

  3. Second-order Monte Carlo wave-function approach to the relaxation effects on ringing revivals in a molecular system interacting with a strongly squeezed coherent field

    International Nuclear Information System (INIS)

    Nakano, Masayoshi; Kishi, Ryohei; Nitta, Tomoshige; Yamaguchi, Kizashi

    2004-01-01

    We investigate the relaxation effects on the quantum dynamics in a two-state molecular system interacting with a single-mode strongly amplitude-squeezed coherent field using the second-order Monte Carlo wave-function method. The molecular population inversion (collapse-revival behavior of Rabi oscillations) is known to show the echoes after each revival, which are referred to as ringing revivals, in the case of strongly squeezed coherent fields with oscillatory photon-number distributions due to the phase-space interference effect. Two types of relaxation effects, i.e., cavity relaxation (the dissipation of an internal single mode to outer mode) and molecular coherent (phase) relaxation caused by nuclear vibrations on ringing revivals are investigated from the viewpoint of the quantum-phase dynamics using the quasiprobability (Q function) distribution of a single-mode field and the off-diagonal molecular density matrix ρ elec1,2 (t). It turns out that the molecular phase relaxation attenuates both the entire revival-collapse behavior and the increase in ρ elec1,2 (t) during the quiescent region, whereas a very slight cavity relaxation particularly suppresses the echoes in ringing revivals more significantly than the first revival but hardly changes a primary variation in envelope of ρ elec1,2 (t) in the nonrelaxation case

  4. Thermal relaxation of charm in hadronic matter

    Energy Technology Data Exchange (ETDEWEB)

    He Min, E-mail: mhe@comp.tamu.edu [Cyclotron Institute and Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States); Fries, Rainer J. [Cyclotron Institute and Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States); RIKEN/BNL Research Center, Brookhaven National Laboratory, Upton, NY 11973 (United States); Rapp, Ralf [Cyclotron Institute and Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States)

    2011-07-18

    The thermal relaxation rate of open-charm (D) mesons in hot and dense hadronic matter is calculated using empirical elastic scattering amplitudes. D-meson interactions with thermal pions are approximated by D{sup *} resonances, while scattering off other hadrons (K, {eta}, {rho}, {omega}, K{sup *}, N, {Delta}) is evaluated using vacuum scattering amplitudes as available in the literature based on effective Lagrangians and constrained by realistic spectroscopy. The thermal relaxation time of D-mesons in a hot {pi} gas is found to be around 25-50 fm/c for temperatures T=150-180 MeV, which reduces to 10-25 fm/c in a hadron-resonance gas. The latter values, argued to be conservative estimates, imply significant modifications of D-meson spectra in heavy-ion collisions. Close to the critical temperature (T{sub c}), the spatial diffusion coefficient (D{sub s}) is surprisingly similar to recent calculations for charm quarks in the Quark-Gluon Plasma using non-perturbative T-matrix interactions. This suggests a possibly continuous minimum structure of D{sub s} around T{sub c}.

  5. Histone H1 interphase phosphorylation becomes largely established in G1 or early S phase and differs in G1 between T-lymphoblastoid cells and normal T cells

    Directory of Open Access Journals (Sweden)

    Gréen Anna

    2011-08-01

    Full Text Available Abstract Background Histone H1 is an important constituent of chromatin, and is involved in regulation of its structure. During the cell cycle, chromatin becomes locally decondensed in S phase, highly condensed during metaphase, and again decondensed before re-entry into G1. This has been connected to increasing phosphorylation of H1 histones through the cell cycle. However, many of these experiments have been performed using cell-synchronization techniques and cell cycle-arresting drugs. In this study, we investigated the H1 subtype composition and phosphorylation pattern in the cell cycle of normal human activated T cells and Jurkat T-lymphoblastoid cells by capillary electrophoresis after sorting of exponentially growing cells into G1, S and G2/M populations. Results We found that the relative amount of H1.5 protein increased significantly after T-cell activation. Serine phosphorylation of H1 subtypes occurred to a large extent in late G1 or early S phase in both activated T cells and Jurkat cells. Furthermore, our data confirm that the H1 molecules newly synthesized during S phase achieve a similar phosphorylation pattern to the previous ones. Jurkat cells had more extended H1.5 phosphorylation in G1 compared with T cells, a difference that can be explained by faster cell growth and/or the presence of enhanced H1 kinase activity in G1 in Jurkat cells. Conclusion Our data are consistent with a model in which a major part of interphase H1 phosphorylation takes place in G1 or early S phase. This implies that H1 serine phosphorylation may be coupled to changes in chromatin structure necessary for DNA replication. In addition, the increased H1 phosphorylation of malignant cells in G1 may be affecting the G1/S transition control and enabling facilitated S-phase entry as a result of relaxed chromatin condensation. Furthermore, increased H1.5 expression may be coupled to the proliferative capacity of growth-stimulated T cells.

  6. Dielectric relaxation of 2-ethyl-1-hexanol around the glass transition by thermally stimulated depolarization currents.

    Science.gov (United States)

    Arrese-Igor, S; Alegría, A; Colmenero, J

    2015-06-07

    We explore new routes for characterizing the Debye-like and α relaxation in 2-ethyl-1-hexanol (2E1H) monoalcohol by using low frequency dielectric techniques including thermally stimulated depolarization current (TSDC) techniques and isothermal depolarization current methods. In this way, we have improved the resolution of the overlapped processes making it possible the analysis of the data in terms of a mode composition as expected for a chain-like response. Furthermore the explored ultralow frequencies enabled to study dynamics at relatively low temperatures close to the glass transition (Tg). Results show, on the one hand, that Debye-like and α relaxation timescales dramatically approach to each other upon decreasing temperature to Tg. On the other hand, the analysis of partial polarization TSDC data confirms the single exponential character of the Debye-like relaxation in 2E1H and rules out the presence of Rouse type modes in the scenario of a chain-like response. Finally, on crossing the glass transition, the Debye-like relaxation shows non-equilibrium effects which are further emphasized by aging treatment and would presumably emerge as a result of the arrest of the structural relaxation below Tg.

  7. Picosecond energy relaxation in La0.67Ca0.33MnO3

    International Nuclear Information System (INIS)

    Dorosinets, Vladimir; Richter, Pablo; Mohler, Ernst; Roskos, Hartmut G.; Jakob, Gerhard

    2005-01-01

    Investigating the reflectance response dynamics of La 0.67 Ca 0.33 MnO 3 thin films after excitation by femtosecond laser pulses, we identify for the first time a picosecond relaxation step which only exists below the Curie temperature T C . The relaxation time increases from zero at T C to several picoseconds at low temperatures. The data can be explained with the existence of a magnetization-related effective energy gap, and assuming relaxation between these states to be mediated by a Frohlich-type electron-lattice interaction

  8. An investigation into the effects of pore connectivity on T2 NMR relaxation

    Science.gov (United States)

    Ghomeshi, Shahin; Kryuchkov, Sergey; Kantzas, Apostolos

    2018-04-01

    Nuclear Magnetic Resonance (NMR) is a powerful technique used to characterize fluids and flow in porous media. The NMR relaxation curves are closely related to pore geometry, and the inversion of the NMR relaxometry data is known to give useful information with regards to pore size distribution (PSD) through the relative amplitudes of the fluids stored in the small and large pores. While this information is crucial, the main challenge for the successful use of the NMR measurements is the proper interpretation of the measured signals. Natural porous media patterns consist of complex pore structures with many interconnected or "coupled" regions, as well as isolated pores. This connectivity along the throats changes the relaxation distribution and in order to properly interpret this data, a thorough understanding of the effects of pore connectivity on the NMR relaxation distribution is warranted. In this paper we address two main points. The first pertains to the fact that there is a discrepancy between the relaxation distribution obtained from experiments, and the ones obtained from solving the mathematical models of diffusion process in the digitized images of the pore space. There are several reasons that may attribute to this such as the lack of a proper incorporation of surface roughness into the model. However, here we are more interested in the effects of pore connectivity and to understand why the typical NMR relaxation distribution obtained from experiments are wider, while the numerical simulations predict that a wider NMR relaxation distribution may indicate poor connectivity. Secondly, by not taking into account the pore coupling effects, from our experience in interpreting the data, we tend to underestimate the pore volume of small pores and overestimate the amplitudes in the large pores. The role of pore coupling becomes even more prominent in rocks with small pore sizes such as for example in shales, clay in sandstones, and in the microstructures of

  9. Effects of different "relaxing" music styles on the autonomic nervous system.

    Science.gov (United States)

    Perez-Lloret, Santiago; Diez, Joaquín; Domé, María Natalia; Delvenne, Andrea Alvarez; Braidot, Nestor; Cardinali, Daniel P; Vigo, Daniel Eduardo

    2014-01-01

    The objective of this study was to assess the effects on heart rate variability (HRV) of exposure to different styles of "relaxing" music. Autonomic responses to musical stimuli were correlated with subjective preferences regarding the relaxing properties of each music style. Linear and nonlinear HRV analysis was conducted in 25 healthy subjects exposed to silence or to classical, new age or romantic melodies in a random fashion. At the end of the study, subjects were asked to choose the melody that they would use to relax. The low-to-high-frequency ratio was significantly higher when subjects were exposed to "new age" music when compared with silence (3.4 ± 0.3 vs. 2.6 ± 0.3, respectively, P classical" or "romantic" melodies (2.1 ± 0.4 and 2.2 ± 0.3). These results were related to a reduction in the high frequency component with "new age" compared to silence (17.4 ± 1.9 vs. 23.1 ± 1.1, respectively P music induced a shift in HRV from higher to lower frequencies, independently on the music preference of the listener.

  10. Evidence of incomplete relaxation in the reaction Ag+40Ar at 288 and 340 MeV bombarding energies

    International Nuclear Information System (INIS)

    Galin, J.; Moretto, L.G.; Babinet, R.; Schmitt, R.; Jared, R.; Thompson, S.G.

    1975-01-01

    The particles emitted in the reaction induced by 40 Ar on natural Ag at 288 and 340 MeV bombarding energy have been studied. The fragments have been identified in atomic number, their kinetic energy distribution and their angular distributions have been measured. The kinetic energy spectra show two components: a high-energy component related to the beam energy, or quasi-elastic component, and a low kinetic energy component, close to the Coulomb energy called relaxed component. The relaxed component is present at all angles and for all particles. The quasi-elastic component is present close to the grazing angle for atomic numbers close to that of the projectile. The relaxed cross section increases with atomic number for Z>9. The increase in cross section is sharper for the lower bombarding energy. The angular distributions are forward peaked, in excess of 1/sin(theta) for all the measured atomic numbers. The forward peaking is larger for particles close in Z to the projectile. The results are interpreted in terms of characteristic times associated with a short-lived intermediate complex. The cross sections and angular distributions are satisfactorily reproduced on the basis of a model accounting for a diffusion process occurring along the mass asymmetry coordinate of the intermediate complex. (Auth.)

  11. Characterization of the collagen component of cartilage repair tissue of the talus with quantitative MRI: comparison of T2 relaxation time measurements with a diffusion-weighted double-echo steady-state sequence (dwDESS)

    International Nuclear Information System (INIS)

    Kretzschmar, M.; Hainc, N.; Studler, U.; Bieri, O.; Miska, M.; Wiewiorski, M.; Valderrabano, V.

    2015-01-01

    The purpose of this study was to characterize the collagen component of repair tissue (RT) of the talus after autologous matrix-induced chondrogenesis (AMIC) using quantitative T2 and diffusion-weighted imaging. Mean T2 values and diffusion coefficients of AMIC-RT and normal cartilage of the talus of 25 patients with posttraumatic osteochondral lesions and AMIC repair were compared in a cross-sectional design using partially spoiled steady-state free precession (pSSFP) for T2 quantification, and diffusion-weighted double-echo steady-state (dwDESS) for diffusion measurement. RT and cartilage were graded with modified Noyes and MOCART scores on morphological sequences. An association between follow-up interval and quantitative MRI measures was assessed using multivariate regression, after stratifying the cohort according to time interval between surgery and MRI. Mean T2 of the AMIC-RT and cartilage were 43.1 ms and 39.1 ms, respectively (p = 0.26). Mean diffusivity of the RT (1.76 μm 2 /ms) was significantly higher compared to normal cartilage (1.46 μm 2 /ms) (p = 0.0092). No correlation was found between morphological and quantitative parameters. RT diffusivity was lowest in the subgroup with follow-up >28 months (p = 0.027). Compared to T2-mapping, dwDESS demonstrated greater sensitivity in detecting differences in the collagen matrix between AMIC-RT and cartilage. Decreased diffusivity in patients with longer follow-up times may indicate an increased matrix organization of RT. (orig.)

  12. Characterization of the collagen component of cartilage repair tissue of the talus with quantitative MRI: comparison of T2 relaxation time measurements with a diffusion-weighted double-echo steady-state sequence (dwDESS)

    Energy Technology Data Exchange (ETDEWEB)

    Kretzschmar, M.; Hainc, N.; Studler, U. [University Hospital Basel, Department of Radiology, Basel (Switzerland); Bieri, O. [University Hospital Basel, Division of Radiological Physics, Basel (Switzerland); Miska, M. [University Hospital, Department of Orthopedics, Heidelberg (Germany); Wiewiorski, M.; Valderrabano, V. [University Hospital Basel, Department of Orthopedic Surgery, Basel (Switzerland)

    2015-04-01

    The purpose of this study was to characterize the collagen component of repair tissue (RT) of the talus after autologous matrix-induced chondrogenesis (AMIC) using quantitative T2 and diffusion-weighted imaging. Mean T2 values and diffusion coefficients of AMIC-RT and normal cartilage of the talus of 25 patients with posttraumatic osteochondral lesions and AMIC repair were compared in a cross-sectional design using partially spoiled steady-state free precession (pSSFP) for T2 quantification, and diffusion-weighted double-echo steady-state (dwDESS) for diffusion measurement. RT and cartilage were graded with modified Noyes and MOCART scores on morphological sequences. An association between follow-up interval and quantitative MRI measures was assessed using multivariate regression, after stratifying the cohort according to time interval between surgery and MRI. Mean T2 of the AMIC-RT and cartilage were 43.1 ms and 39.1 ms, respectively (p = 0.26). Mean diffusivity of the RT (1.76 μm{sup 2}/ms) was significantly higher compared to normal cartilage (1.46 μm{sup 2}/ms) (p = 0.0092). No correlation was found between morphological and quantitative parameters. RT diffusivity was lowest in the subgroup with follow-up >28 months (p = 0.027). Compared to T2-mapping, dwDESS demonstrated greater sensitivity in detecting differences in the collagen matrix between AMIC-RT and cartilage. Decreased diffusivity in patients with longer follow-up times may indicate an increased matrix organization of RT. (orig.)

  13. Mechanism of nuclear cross-relaxation in magnetically ordered media

    Energy Technology Data Exchange (ETDEWEB)

    Buishvili, L L; Volzhan, E B; Giorgadze, N P [AN Gruzinskoj SSR, Tbilisi. Inst. Fiziki

    1975-09-01

    A mechanism of two-step nuclear relaxation in magnetic ordered dielectrics is proposed. The case is considered where the energy conservation in the cross relaxation (CR) process is ensured by the lattice itself without spin-spin interactions. Expressions have been obtained describing the temperature dependence of the CR rate. For a nonuniform broadened NMR line it has been shown that the spin-lattice relaxation time for a spin packet taken out from the equilibrium may be determined by the CR time owing to the mechanism suggested. When the quantization axes for electron and nuclear spins coincide, the spin-lattice relaxation is due to the three-magnon mechanism. The cross-relaxation stage has been shown to play a significant role in the range of low temperatures (T<10 deg K) and to become negligible with a temperature increase.

  14. Optimized co-solute paramagnetic relaxation enhancement for the rapid NMR analysis of a highly fibrillogenic peptide

    International Nuclear Information System (INIS)

    Oktaviani, Nur Alia; Risør, Michael W.; Lee, Young-Ho; Megens, Rik P.; Jong, Djurre H. de; Otten, Renee; Scheek, Ruud M.; Enghild, Jan J.; Nielsen, Niels Chr.; Ikegami, Takahisa; Mulder, Frans A. A.

    2015-01-01

    Co-solute paramagnetic relaxation enhancement (PRE) is an attractive way to speed up data acquisition in NMR spectroscopy by shortening the T 1 relaxation time of the nucleus of interest and thus the necessary recycle delay. Here, we present the rationale to utilize high-spin iron(III) as the optimal transition metal for this purpose and characterize the properties of its neutral chelate form Fe(DO3A) as a suitable PRE agent. Fe(DO3A) effectively reduces the T 1 values across the entire sequence of the intrinsically disordered protein α-synuclein with negligible impact on line width. The agent is better suited than currently used alternatives, shows no specific interaction with the polypeptide chain and, due to its high relaxivity, is effective at low concentrations and in ‘proton-less’ NMR experiments. By using Fe(DO3A) we were able to complete the backbone resonance assignment of a highly fibrillogenic peptide from α 1 -antitrypsin by acquiring the necessary suite of multidimensional NMR datasets in 3 h

  15. Optimized co-solute paramagnetic relaxation enhancement for the rapid NMR analysis of a highly fibrillogenic peptide

    Energy Technology Data Exchange (ETDEWEB)

    Oktaviani, Nur Alia [University of Groningen, Groningen Biomolecular Sciences and Biotechnology Institute (Netherlands); Risør, Michael W. [University of Aarhus, Interdisciplinary Nanoscience Center (iNANO) and Department of Chemistry (Denmark); Lee, Young-Ho [Osaka University, Institute for Protein Research (Japan); Megens, Rik P. [University of Groningen, Stratingh Institute for Chemistry (Netherlands); Jong, Djurre H. de; Otten, Renee; Scheek, Ruud M. [University of Groningen, Groningen Biomolecular Sciences and Biotechnology Institute (Netherlands); Enghild, Jan J. [University of Aarhus, Interdisciplinary Nanoscience Center (iNANO) and Department of Molecular Biology and Genetics (Denmark); Nielsen, Niels Chr. [University of Aarhus, Interdisciplinary Nanoscience Center (iNANO) and Department of Chemistry (Denmark); Ikegami, Takahisa [Yokohama City University, Graduate School of Medical Life Science (Japan); Mulder, Frans A. A., E-mail: fmulder@chem.au.dk [University of Groningen, Groningen Biomolecular Sciences and Biotechnology Institute (Netherlands)

    2015-06-15

    Co-solute paramagnetic relaxation enhancement (PRE) is an attractive way to speed up data acquisition in NMR spectroscopy by shortening the T{sub 1} relaxation time of the nucleus of interest and thus the necessary recycle delay. Here, we present the rationale to utilize high-spin iron(III) as the optimal transition metal for this purpose and characterize the properties of its neutral chelate form Fe(DO3A) as a suitable PRE agent. Fe(DO3A) effectively reduces the T{sub 1} values across the entire sequence of the intrinsically disordered protein α-synuclein with negligible impact on line width. The agent is better suited than currently used alternatives, shows no specific interaction with the polypeptide chain and, due to its high relaxivity, is effective at low concentrations and in ‘proton-less’ NMR experiments. By using Fe(DO3A) we were able to complete the backbone resonance assignment of a highly fibrillogenic peptide from α{sub 1}-antitrypsin by acquiring the necessary suite of multidimensional NMR datasets in 3 h.

  16. Stress relaxation damage in K9 glass plate irradiated by 1.06μm CW laser

    International Nuclear Information System (INIS)

    Luo Fu; Sun Chengwei

    2001-01-01

    Based on the stress relaxation model in 1D planar geometry and the visco-elastic constitutive equation, the temperature and stress histories in the K9 glass samples irradiated by CW laser beams (λ = 1.06 μm) have been calculated. The results indicate that the residual tensile stress due to the stress relaxation effect during cooling after the laser radiation may be greater than the tensile fracture strength of samples, while the maximum compression stress during the laser heating is less than the requirement for compression damage. For a K9 glass window of 3 mm thickness, its damage due to the stress relaxation may be induced by a laser radiation of 0.946 MW/cm 2 for 0.2s . Therefore, the stress relaxation should be regarded as the main mechanism of damage in K9 glass windows while a CW laser beam (λ = 1.06 μm) irradiates it with large spot

  17. Thermally-induced electronic relaxation in structurally-modified Cu0.1Ni0.8Co0.2Mn1.9O4 spinel ceramics

    International Nuclear Information System (INIS)

    Shpotyuk, O.; Balitska, V.; Brunner, M.; Hadzaman, I.; Klym, H.

    2015-01-01

    Thermally-induced electronic relaxation in structurally-modified Cu 0.1 Ni 0.8 Co 0.2 Mn 1.9 O 4 spinel ceramics is shown to be adequately described by stretched exponential function on time. This kinetics is defined by microsctructure perfectness of the relaxing media, showing obvious onset to stretched exponential behaviour with non-exponentionality index attaining close to 0.43 values for high-monolith ceramics and smaller ones in fine-grained ceramics. Percolation threshold in relaxation-degradation kinetics is detected for ceramics with 10% of NiO extractions, showing the smallest but most prolonged single-path degradation effect. This finding is treated in terms of Phillips’ axiomatic diffusion-to-trap model, where only one of two relaxation channels (caused by operative short-range forces) occurs to be effective, while additional non-operative channels contribute to electronic relaxation in fine-grained ceramics

  18. Multi-voxel algorithm for quantitative bi-exponential MRI T

    NARCIS (Netherlands)

    Bladt, P.; Van Steenkiste, G.; Ramos-Llorden, G; den Dekker, A.J.; Sijbers, J.; Styner, Martin A.; Angelini, Elsa D.

    2016-01-01

    Quantification of the spin-lattice relaxation time, T1, of tissues is important for characterization of tissues in clinical magnetic resonance imaging (MRI). In T1 mapping, T1 values are estimated from a set of T1-weighted MRI images. Due to the limited

  19. Structural relaxation dynamics and annealing effects of sodium silicate glass.

    Science.gov (United States)

    Naji, Mohamed; Piazza, Francesco; Guimbretière, Guillaume; Canizarès, Aurélien; Vaills, Yann

    2013-05-09

    Here we report high-precision measurements of structural relaxation dynamics in the glass transition range at the intermediate and short length scale for a strong sodium silicate glass during long annealing times. We evidence for the first time the heterogeneous dynamics at the intermediate range order by probing the acoustic longitudinal frequency in the GHz region by Brillouin light scattering spectroscopy. Or, from in-situ Raman measurements, we show that relaxation is indeed homogeneous at the interatomic length scale. Our results show that the dynamics at the intermediate range order contains two distinct relaxation time scales, a fast and a slow component, differing by about a 10-fold factor below Tg and approaching to one another past the glass transition. The slow relaxation time agrees with the shear relaxation time, proving that Si-O bond breaking constitutes the primary control of structural relaxation at the intermediate range order.

  20. Relaxation behavior and dose dependence of radiation induced radicals in irradiated mango

    International Nuclear Information System (INIS)

    Kameya, Hiromi; Kakita, Daisuke; Kaimori, Yoshihiko; Ukai, Mitsuko; Kikuchi, Masahiro; Kobayashi, Yasuhiko; Shimoyama, Yuhei

    2010-01-01

    Mangoes are imported to Japan after treated with hot water. Recently, irradiated mangoes imported to U. S. are widely used. This paper reports on the ESR method for analyzing the radiation induced radicals of irradiated mangoes. Upon the γ ray irradiation, a strong single peak in the flesh and skin of mangoes was observed at g=2.004. This singlet peak may be attributed to organic free radicals. The ESR spectra of the flesh and skin of mangoes showed the radiation induced radicals due to cellulose by irradiation over 12 kGy. The relaxation times (T 1 and T 2 ) of the singlet signal were calculated. T 2 showed dose response according to increasing the irradiation dose levels, while T 1 was almost constant. The value of (T 1 T 2 ) 1/2 showed the dependence of irradiation dose level. (author)

  1. Abdominal applications of 3.0-T MR imaging: comparative review versus a 1.5-T system.

    Science.gov (United States)

    Choi, Jin-Young; Kim, Myeong-Jin; Chung, Yong Eun; Kim, Ji Youn; Jones, Alun C; de Becker, Jan; van Cauteren, Marc

    2008-01-01

    With the development of dedicated receiver coils and increased gradient performance, 3.0-T magnetic resonance (MR) systems are gaining wider acceptance in clinical practice. The expected twofold increase in signal-to-noise ratio (SNR) compared with that of 1.5-T MR systems may help improve spatial resolution or increase temporal resolution when used with parallel acquisition techniques. Several issues must be considered when applying 3.0-T MR in the abdomen, including the alteration of the radiofrequency field and relaxation time, increase in energy deposition and susceptibility effects, and problems associated with motion artifacts. For the evaluation of liver lesions, higher SNR and greater resolution achieved with the 3.0-T system could translate into better detection of malignant lesions on T2-weighted images obtained with adjusted imaging parameters. For the evaluation of pancreatic and biliary diseases, high-resolution T2-weighted imaging using single-shot turbo spin-echo sequences is useful; improvement in SNR was noticeable on two-dimensional MR cholangiopancreatographic images. For the preoperative imaging of rectal cancer, a single-shot sequence is useful for dramatically decreasing imaging time while maintaining image quality. Substantial modification of examination protocols, with optimized imaging parameters and sequence designs along with ongoing development of hardware, could contribute to an increased role of the 3.0-T system for abdominal MR examinations.

  2. Relaxation features of the Young's modulus and internal friction of lanthanum

    International Nuclear Information System (INIS)

    Bodryakov, V.Yu.

    1993-01-01

    E Young module and Q -1 inner friction of polycrystalline lanthanum specimens are studied comprehensively within 4.2-420 K temperature range using bend autovibrations of a specimen represented by a thin rod within ∼ 1-2 kHz frequency range. Three maximums of relaxation nature innner friction are detected under ∼ 380-410, 250-270 and 90-120 K temperatures with 0.29, 0.21 and 0.02 eV activation energies, respectively, on Q -1 (T) curves. Maximums of inner friction are accompanied by peculiarities of E(T) Young module behaviour. 21 refs., 3 figs., 2 tabs

  3. T2 mapping in patellar chondromalacia

    International Nuclear Information System (INIS)

    Ruiz Santiago, Fernando; Pozuelo Calvo, Rocío; Almansa López, Julio; Guzmán Álvarez, Luis; Castellano García, María del Mar

    2014-01-01

    Objective: To study the correlation between the T2 relaxation times of the patellar cartilage and morphological MRI findings of chondromalacia. Methods: This prospective study comprises 50 patients, 27 men and 23 women suffering of anterior knee pain (mean age: 29.7, SD 8.3 years; range: 16–45 years). MRI of 97 knees were performed in these patients at 1.5 T magnet including sagittal T1, coronal intermediate, axial intermediate fat sat and T2 mapping. Chondromalacia was assessed using a modified version of Noyes classification. The relaxation time, T2, was studied segmenting the full thickness of the patellar cartilage in 12 areas: 4 proximal (external facet–proximal–lateral (EPL), external facet–proximal–central (EPC), internal facet–proximal–central (IPC), internal facet–proximal–medial (IPM), 4 in the middle section (external facet–middle–lateral (EML), external facet–middle–central (EMC), internal facet–middle–central (IMC), internal facet–middle–medial (IMM) and 4 distal (external facet–distal–lateral (EDL), external facet–distal–central (EDC), internal facet–distal–central (IDC), internal facet–distal–medial (IDM). Results: T2 values showed a significant increase in mild chondromalacia regarding normal cartilage in most of the cartilage areas (p < 0.05), except in the internal distal facet (IDC and IDM), EPC, EDL, and IMM. Severe chondromalacia was characterized by a fall of T2 relaxation times with loss of statistical significant differences in comparison with normal cartilage, except in EMC and IMC, where similar values as mild chondromalacia were maintained (p < 0.05). Conclusions: Steepest increase in T2 values of patellar cartilage occurs in early stages of patellar cartilage degeneration. Progression of morphologic changes of chondromalacia to more severe degrees is associated to a new drop of T2 relaxation times approaching basal values in most of the areas of the patellar cartilage, except in the

  4. T2 mapping in patellar chondromalacia

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Santiago, Fernando, E-mail: ferusan12@gmail.com [Department of Radiology, Traumatology Hospital, University Hospital Virgen de las Nieves, Granada (Spain); Pozuelo Calvo, Rocío [Department of Rehabilitation and Physical therapy, Traumatology Hospital, University Hospital Virgen de las Nieves, Granada (Spain); Almansa López, Julio [Department of Physic, University Hospital Virgen de las Nieves, Granada (Spain); Guzmán Álvarez, Luis; Castellano García, María del Mar [Department of Radiology, Traumatology Hospital, University Hospital Virgen de las Nieves, Granada (Spain)

    2014-06-15

    Objective: To study the correlation between the T2 relaxation times of the patellar cartilage and morphological MRI findings of chondromalacia. Methods: This prospective study comprises 50 patients, 27 men and 23 women suffering of anterior knee pain (mean age: 29.7, SD 8.3 years; range: 16–45 years). MRI of 97 knees were performed in these patients at 1.5 T magnet including sagittal T1, coronal intermediate, axial intermediate fat sat and T2 mapping. Chondromalacia was assessed using a modified version of Noyes classification. The relaxation time, T2, was studied segmenting the full thickness of the patellar cartilage in 12 areas: 4 proximal (external facet–proximal–lateral (EPL), external facet–proximal–central (EPC), internal facet–proximal–central (IPC), internal facet–proximal–medial (IPM), 4 in the middle section (external facet–middle–lateral (EML), external facet–middle–central (EMC), internal facet–middle–central (IMC), internal facet–middle–medial (IMM) and 4 distal (external facet–distal–lateral (EDL), external facet–distal–central (EDC), internal facet–distal–central (IDC), internal facet–distal–medial (IDM). Results: T2 values showed a significant increase in mild chondromalacia regarding normal cartilage in most of the cartilage areas (p < 0.05), except in the internal distal facet (IDC and IDM), EPC, EDL, and IMM. Severe chondromalacia was characterized by a fall of T2 relaxation times with loss of statistical significant differences in comparison with normal cartilage, except in EMC and IMC, where similar values as mild chondromalacia were maintained (p < 0.05). Conclusions: Steepest increase in T2 values of patellar cartilage occurs in early stages of patellar cartilage degeneration. Progression of morphologic changes of chondromalacia to more severe degrees is associated to a new drop of T2 relaxation times approaching basal values in most of the areas of the patellar cartilage, except in the

  5. Applications of 1H-NMR relaxometry in experimental liver studies

    International Nuclear Information System (INIS)

    Holzmueller, P.

    1992-01-01

    Purpose of this study was to investigate applications of proton nuclear magnetic resonance ( 1 H-NMR) relaxometry in experimental medicine. Relaxometry was performed by measurements of spin-lattice (T 1 ) and spin-spin (T 2 ) relaxation time parameters on liver biopsies up to four hours after biopsy excision. Variations of relaxation times due to species and strain, different sample handling and different liver damage models, ethionine fatty liver and paracetamol liver necrosis, were investigated. Cell integrity effects were studied on homogenized liver samples. Relaxation time parameters, especially 'main' components T 1A and T 2A of biexponential model fit, were identified to react very sensitive after tissue damages as well as to cell viability. Thus, investigation of stored liver grafts was performed in order to evaluate the possibility of a rapid liver graft viability testing method for human liver transplantation surgery by 1 H-NMR relaxometry. Another series of measurements was performed to investigate the applicability of isoflurane anesthesia for in vivo NMR experiments. This study proved the good appropriateness of isoflurane for that purpose provided that physiological monitoring and individual adjustment of anesthesia are performed. In these investigations it could be revealed that mainly T 1A and T 2A are influenced by tissue condition and that different information is inherent in these two parameters, with T 2A reflecting tissue viability and changes of tissue conditions very sensitively but rather unspecifically in respect to the damage applied. Based on these results the following future applications of 1 H-NMR relaxometry are suggested : (1) model investigations, (2) investigation of given pathologies, (3) investigation of basic requirements for in vivo NMR and (4) application in a liver graft viability testing protocol, which seems to be the most important future application of 1 H-NMR relaxometry in medicine. (author)

  6. Impairment of the vascular relaxation and differential expression of caveolin-1 of the aorta of diabetic +db/+db mice.

    Science.gov (United States)

    Lam, Tze Yan; Seto, Sai Wang; Lau, Yee Man; Au, Lai Shan; Kwan, Yiu Wa; Ngai, Sai Ming; Tsui, Kwong Wing

    2006-09-28

    In this study, we compared the endothelium-dependent and -independent relaxation of the isolated thoracic aorta of control (+db/+m) and diabetic (+db/+db) (C57BL/KsJ) mice. The gene expression (mRNA and protein) level of the muscarinic M(3) receptors, endothelial nitric oxide synthase (eNOS) and caveolin-1 of the aorta was also evaluated. Acetylcholine caused a concentration-dependent, N(G)-nitro-L-arginine methyl-ester (20 microM)-sensitive relaxation, with approximately 100% relaxation at 10 microM, in +db/+m mice. In +db/+db mice, the acetylcholine-induced relaxation was significantly smaller (maximum relaxation: approximately 80%). The sodium nitroprusside-mediated relaxation was slightly diminished in +db/+db mice, compared to +db/+m mice. However, there was no significant difference in the isoprenaline- and cromakalim-induced relaxation observed in both species. The mRNA and protein expression levels of caveolin-1 were significantly higher in the aorta of +db/+db mice. In contrast, there was no difference in the mRNA and protein expression levels of eNOS and muscarinic M(3) receptors between these mice. Our results demonstrate that the impairment of the acetylcholine-induced, endothelium-dependent aortic relaxation observed in +db/+db mice was probably associated with an enhanced expression of caveolin-1 mRNA and protein.

  7. Mechanical relaxations and 1/f noise in Bi, Nb, and Fe films

    International Nuclear Information System (INIS)

    Alers, G.B.; Weissman, M.B.

    1991-01-01

    Anelastic piezoresistance and 1/f noise were measured in the same samples to compare mechanical relaxations with 1/f noise. In bismuth below 200 K, both effects could be fitted to a model invoking one class of mobile defects. In niobium, both the anelastic piezoresistance and the noise scaled with the concentration of dissolved hydrogen. A well-defined peak in noise versus temperature was observed without any peak in the anelastic response. In iron, noise apparently from a carbon Snoek relaxation was observed at 220 K in a sample with high impurity concentration and at 300 K with low impurity concentration. No anelastic feature was found at 220 K in the high-impurity-concentration sample. The broad nature of 1/f noise appears to arise not from a fundamental source but from the generally poor quality of thin films

  8. k-t PCA: temporally constrained k-t BLAST reconstruction using principal component analysis

    DEFF Research Database (Denmark)

    Pedersen, Henrik; Kozerke, Sebastian; Ringgaard, Steffen

    2009-01-01

    in applications exhibiting a broad range of temporal frequencies such as free-breathing myocardial perfusion imaging. We show that temporal basis functions calculated by subjecting the training data to principal component analysis (PCA) can be used to constrain the reconstruction such that the temporal resolution...... is improved. The presented method is called k-t PCA....

  9. PER, a Circadian Clock Component, Mediates the Suppression of MMP-1 Expression in HaCaT Keratinocytes by cAMP.

    Science.gov (United States)

    Yeom, Miji; Lee, HansongI; Shin, Seoungwoo; Park, Deokhoon; Jung, Eunsun

    2018-03-23

    Skin circadian clock system responds to daily changes, thereby regulating skin functions. Exposure of the skin to UV irradiation induces the expression of matrix metalloproteinase-1 (MMP-1) and causes DNA damage. It has been reported both DNA repair and DNA replication are regulated by the circadian clock in mouse skin. However, the molecular link between circadian clock and MMP-1 has little been investigated. We found PERIOD protein, a morning clock component, represses the expression of MMP-1 in human keratinocytes by using a PER-knockdown strategy. Treatment with siPer3 alleviated the suppression of MMP-1 expression induced by forskolin. Results revealed PER3 suppresses the expression of MMP-1 via cAMP signaling pathway. Additionally, we screened for an activator of PER that could repress the expression of MMP-1 using HaCaT cell line containing PER promoter-luciferase reporter gene. Results showed Lespedeza capitate extract (LCE) increased PER promoter activity. LCE inhibited the expression of MMP-1 and its effect of LCE was abolished in knockdown of PER2 or PER3, demonstrating LCE can repress the expression of MMP-1 through PER. Since circadian clock component PER can regulate MMP-1 expression, it might be a new molecular mechanism to develop therapeutics to alleviate skin aging and skin cancer.

  10. PER, a Circadian Clock Component, Mediates the Suppression of MMP-1 Expression in HaCaT Keratinocytes by cAMP

    Directory of Open Access Journals (Sweden)

    Miji Yeom

    2018-03-01

    Full Text Available Skin circadian clock system responds to daily changes, thereby regulating skin functions. Exposure of the skin to UV irradiation induces the expression of matrix metalloproteinase-1 (MMP-1 and causes DNA damage. It has been reported both DNA repair and DNA replication are regulated by the circadian clock in mouse skin. However, the molecular link between circadian clock and MMP-1 has little been investigated. We found PERIOD protein, a morning clock component, represses the expression of MMP-1 in human keratinocytes by using a PER-knockdown strategy. Treatment with siPer3 alleviated the suppression of MMP-1 expression induced by forskolin. Results revealed PER3 suppresses the expression of MMP-1 via cAMP signaling pathway. Additionally, we screened for an activator of PER that could repress the expression of MMP-1 using HaCaT cell line containing PER promoter-luciferase reporter gene. Results showed Lespedeza capitate extract (LCE increased PER promoter activity. LCE inhibited the expression of MMP-1 and its effect of LCE was abolished in knockdown of PER2 or PER3, demonstrating LCE can repress the expression of MMP-1 through PER. Since circadian clock component PER can regulate MMP-1 expression, it might be a new molecular mechanism to develop therapeutics to alleviate skin aging and skin cancer.

  11. 13C NMR and relaxation studies of the nanomagnet Mn12-acetate

    Science.gov (United States)

    Achey, Randall M.; Kuhns, Philip L.; Reyes, Arneil P.; Moulton, William G.; Dalal, Naresh S.

    2001-08-01

    The nanomagnet [Mn12O12(CH3COO)16(H2O)4].2CH3COOH.4H2O, also known as Mn12, has been synthesized with 13C labeling at the CH3 groups, and investigated by 13C NMR at fields up to 23 T. Using oriented samples, it is possible to resolve four distinct 13C peaks at room temperature, located on both sides of the unshifted Larmor frequency. These peaks were assigned to the four hyperfine-shifted, magnetically inequivalent sets of 13CH3 groups in the Mn12 lattice, based on a comparison with the crystal structure and point-dipole and spin-density calculations. These results establish that the unpaired electron spin density of the S=10 system in this cluster extends over the entire molecular framework, not just the core. These results are discussed in relationship to inelastic neutron scattering measurements. The temperature and field dependence of the 13C nuclear-spin-lattice-relaxation time T1 on the least shifted peak was measured. A single weakly field-dependent minimum at about 60 K is observed in the temperature dependence of the measured T1. The relaxation mechanism responsible for the T1 minimum is ascribed mainly to hindered rotation of the methyl group of the acetate ligand at higher temperature, and to electronic spin fluctuations at lower temperature.

  12. Morphological imaging and T2 and T2* mapping of hip cartilage at 7 Tesla MRI under the influence of intravenous gadolinium

    International Nuclear Information System (INIS)

    Lazik-Palm, Andrea; Geis, Christina; Goebel, Juliane; Theysohn, Jens M.; Kraff, Oliver; Johst, Soeren; Ladd, Mark E.; Quick, Harald H.

    2016-01-01

    To investigate the influence of intravenous gadolinium on cartilage T2 and T2* relaxation times and on morphological image quality at 7-T hip MRI. Hips of 11 healthy volunteers were examined at 7 T. Multi-echo sequences for T2 and T2* mapping, 3D T1 volumetric interpolated breath-hold examination (VIBE) and double-echo steady-state (DESS) sequences were acquired before and after intravenous application of gadolinium according to a delayed gadolinium-enhanced MRI of cartilage (dGEMRIC) protocol. Cartilage relaxation times were measured in both scans. Morphological sequences were assessed quantitatively using contrast ratios and qualitatively using a 4-point Likert scale. Student's t-test, Pearson's correlation (ρ) and Wilcoxon sign-rank test were used for statistical comparisons. Pre- and post-contrast T2 and T2* values were highly correlated (T2: acetabular: ρ = 0.76, femoral: ρ = 0.77; T2*: acetabular: ρ = 0.80, femoral: ρ = 0.72). Gadolinium enhanced contrasts between cartilage and joint fluid in DESS and T1 VIBE according to the qualitative (p = 0.01) and quantitative (p < 0.001) analysis. The delineation of acetabular and femoral cartilage and the labrum predominantly improved with gadolinium. Gadolinium showed no relevant influence on T2 or T2* relaxation times and improved morphological image quality at 7 T. Therefore, morphological and quantitative sequences including dGEMRIC can be conducted in a one-stop-shop examination. (orig.)

  13. Morphological imaging and T2 and T2* mapping of hip cartilage at 7 Tesla MRI under the influence of intravenous gadolinium

    Energy Technology Data Exchange (ETDEWEB)

    Lazik-Palm, Andrea; Geis, Christina; Goebel, Juliane; Theysohn, Jens M. [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Kraff, Oliver; Johst, Soeren [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); Ladd, Mark E. [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); German Cancer Research Center (DKFZ), Division of Medical Physics in Radiology, Heidelberg (Germany); Quick, Harald H. [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); University Hospital Essen, High-Field and Hybrid MR Imaging, Essen (Germany)

    2016-11-15

    To investigate the influence of intravenous gadolinium on cartilage T2 and T2* relaxation times and on morphological image quality at 7-T hip MRI. Hips of 11 healthy volunteers were examined at 7 T. Multi-echo sequences for T2 and T2* mapping, 3D T1 volumetric interpolated breath-hold examination (VIBE) and double-echo steady-state (DESS) sequences were acquired before and after intravenous application of gadolinium according to a delayed gadolinium-enhanced MRI of cartilage (dGEMRIC) protocol. Cartilage relaxation times were measured in both scans. Morphological sequences were assessed quantitatively using contrast ratios and qualitatively using a 4-point Likert scale. Student's t-test, Pearson's correlation (ρ) and Wilcoxon sign-rank test were used for statistical comparisons. Pre- and post-contrast T2 and T2* values were highly correlated (T2: acetabular: ρ = 0.76, femoral: ρ = 0.77; T2*: acetabular: ρ = 0.80, femoral: ρ = 0.72). Gadolinium enhanced contrasts between cartilage and joint fluid in DESS and T1 VIBE according to the qualitative (p = 0.01) and quantitative (p < 0.001) analysis. The delineation of acetabular and femoral cartilage and the labrum predominantly improved with gadolinium. Gadolinium showed no relevant influence on T2 or T2* relaxation times and improved morphological image quality at 7 T. Therefore, morphological and quantitative sequences including dGEMRIC can be conducted in a one-stop-shop examination. (orig.)

  14. Optimal Configuration for Relaxation Times Estimation in Complex Spin Echo Imaging

    Directory of Open Access Journals (Sweden)

    Fabio Baselice

    2014-01-01

    Full Text Available Many pathologies can be identified by evaluating differences raised in the physical parameters of involved tissues. In a Magnetic Resonance Imaging (MRI framework, spin-lattice T1 and spin-spin T2 relaxation time parameters play a major role in such an identification. In this manuscript, a theoretical study related to the evaluation of the achievable performances in the estimation of relaxation times in MRI is proposed. After a discussion about the considered acquisition model, an analysis on the ideal imaging acquisition parameters in the case of spin echo sequences, i.e., echo and repetition times, is conducted. In particular, the aim of the manuscript consists in providing an empirical rule for optimal imaging parameter identification with respect to the tissues under investigation. Theoretical results are validated on different datasets in order to show the effectiveness of the presented study and of the proposed methodology.

  15. Low temperature dielectric relaxation and charged defects in ferroelectric thin films

    Directory of Open Access Journals (Sweden)

    A. Artemenko

    2013-04-01

    Full Text Available We report a dielectric relaxation in BaTiO3-based ferroelectric thin films of different composition and with several growth modes: sputtering (with and without magnetron and sol-gel. The relaxation was observed at cryogenic temperatures (T < 100 K for frequencies from 100 Hz up to 10 MHz. This relaxation activation energy is always lower than 200 meV and is very similar to the relaxation that we reported in the parent bulk perovskites. Based on our Electron Paramagnetic Resonance (EPR investigation, we ascribe this dielectric relaxation to the hopping of electrons among Ti3+-V(O charged defects. Being dependent on the growth process and on the amount of oxygen vacancies, this relaxation can be a useful probe of defects in actual integrated capacitors with no need for specific shaping.

  16. Transport relaxation measurements and glassy state effects in superconducting MgB{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Olutas, M. [Abant Izzet Baysal University, Department of Physics, Turgut Gulez Research Laboratory, 14280 Bolu (Turkey)], E-mail: olutas_m@ibu.edu.tr; Yetis, H.; Altinkok, A.; Kilic, A.; Kilic, K. [Abant Izzet Baysal University, Department of Physics, Turgut Gulez Research Laboratory, 14280 Bolu (Turkey)

    2008-09-15

    Time dependent effects in superconducting MgB{sub 2} have been studied systematically for the first time by transport relaxation measurements (V-t curves) as a function of transport current (I), temperature (T) and external magnetic field (H). At very low dissipation levels (below {approx}1 {mu}V), it was observed that the sample voltage grows up smoothly in time by exhibiting the details of initial stage of relaxation process. At high dissipation levels, steady state corresponding to constant flow rate is maintained within a very short time and monitoring of details of flux dynamic evolving along sample becomes difficult on long time scales. Another interesting behavior is the appearance of voltage peak when the transport current was reduced to a finite value. After peak, it was observed that the sample voltage relaxes smoothly by leveling off within a very short time. The evolution of V-t curves suggests that formation of resistive flow channels along sample develops easily, which is quite similar to that of obtained for the superconducting ceramic samples whose grain boundaries are improved. Time dependent effects were also observed in magnetovoltage measurements (V-H curves) as the field sweep rate (dH/dt) varies. The observations were interpreted mainly in terms of flux trapping in grains.

  17. Vibrational relaxation of CDCl3 induced by infrared laser radiation

    International Nuclear Information System (INIS)

    Alvarez, R.F.; Azcarate, M.L.; Alonso, E.M.; Dangelo, R.J.; Quel, E.J.

    1990-01-01

    A CO 2 TEA laser was used to excite mode ν 4 of CDCl 3 (914cm- 1 ). The laser was constructed at the laboratory, tuned in line 10P(48), (10.91 μm). Infrared fluorescence technique was used to determine V-T/R relaxation times for CDCl 3 both pure and in Ar mixtures. (Author). 9 refs., 3 figs

  18. Microscopic dynamics and relaxation processes in liquid hydrogen fluoride

    International Nuclear Information System (INIS)

    Angelini, R.; Giura, P.; Monaco, G.; Sette, F.; Fioretto, D.; Ruocco, G.

    2004-01-01

    Inelastic x-ray scattering and Brillouin light scattering measurements of the dynamic structure factor of liquid hydrogen fluoride have been performed in the temperature range T=214-283 K. The data, analyzed using a viscoelastic model with a two time-scale memory function, show a positive dispersion of the sound velocity c(Q) between the low frequency value c 0 (Q) and the high frequency value c ∞α (Q). This finding confirms the existence of a structural (α) relaxation directly related to the dynamical organization of the hydrogen bonds network of the system. The activation energy E a of the process has been extracted by the analysis of the temperature behavior of the relaxation time τ α (T) that follows an Arrhenius law. The obtained value for E a , when compared with that observed in another hydrogen bond liquid as water, suggests that the main parameter governing the α-relaxation process is the number of hydrogen bonds per molecule

  19. A biomarker-responsive T2ex MRI contrast agent.

    Science.gov (United States)

    Daryaei, Iman; Randtke, Edward A; Pagel, Mark D

    2017-04-01

    This study investigated a fundamentally new type of responsive MRI contrast agent for molecular imaging that alters T 2 exchange (T 2ex ) properties after interacting with a molecular biomarker. The contrast agent Tm-DO3A-oAA was treated with nitric oxide (NO) and O 2 . The R 1 and R 2 relaxation rates of the reactant and product were measured with respect to concentration, temperature, and pH. Chemical exchange saturation transfer (CEST) spectra of the reactant and product were acquired using a 7 Tesla (T) MRI scanner and analyzed to estimate the chemical exchange rates and r 2ex relaxivities. The reaction of Tm-DO3A-oAA with NO and O 2 caused a 6.4-fold increase in the r 2 relaxivity of the agent, whereas r 1 relaxivity remained unchanged, which demonstrated that Tm-DO3A-oAA is a responsive T 2ex agent. The effects of pH and temperature on the r 2 relaxivities of the reactant and product supported the conclusion that the product's benzimidazole ligand caused the agent to have a fast chemical exchange rate relative to the slow exchange rate of the reactant's ortho-aminoanilide ligand. T 2ex MRI contrast agents are a new type of responsive agent that have good detection sensitivity and specificity for detecting a biomarker, which can serve as a new tool for molecular imaging. Magn Reson Med 77:1665-1670, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  20. Synthesis and Characterization of a Gd-DOTA-D-Permeation Peptide for Magnetic Resonance Relaxation Enhancement of Intracellular Targets

    Directory of Open Access Journals (Sweden)

    Andrew M. Prantner

    2003-10-01

    Full Text Available Many MR contrast agents have been developed and proven effective for extracellular nontargeted applications, but exploitation of intracellular MR contrast agents has been elusive due to the permeability barrier of the plasma membrane. Peptide transduction domains can circumvent this permeability barrier and deliver cargo molecules to the cell interior. Based upon enhanced cellular uptake of permeation peptides with D-amino acid residues, an all-D Tat basic domain peptide was conjugated to DOTA and chelated to gadolinium. Gd-DOTA-D-Tat peptide in serum at room temperature showed a relaxivity of 7.94 ± 0.11 mM−1 sec−1 at 4.7 T. The peptide complex displayed no significant binding to serum proteins, was efficiently internalized by human Jurkat leukemia cells resulting in intracellular T1 relaxation enhancement, and in preliminary T1-weighted MRI experiments, significantly enhanced liver, kidney, and mesenteric signals.

  1. Metastability exchange optical pumping in 3He gas up to 30 mT. Efficiency measurements and evidence of laser-induced nuclear relaxation

    International Nuclear Information System (INIS)

    Batz, Marion

    2011-01-01

    Advances in metastability exchange optical pumping (MEOP) of 3 He at high laser powers, with its various applications, but also at high gas pressures p 3 and high magnetic field strengths B, have provided strong motivation for revisiting the understanding and for investigating the limitations of this powerful technique. For this purpose, we present systematic experimental and theoretical studies of efficiency and of relaxation mechanisms in B≤30 mT and p 3 =0.63-2.45 mbar. 3 He nuclear polarisation is measured by light absorption in longitudinal configuration where weak light beams at 1083 nm parallel to magnetic field and cell axis with opposite circular polarisations are used to probe the distribution of populations in the metastable state. This method is systematically tested to evaluate potential systematic biases and is shown to be reliable for the study of OP dynamics despite the redistribution of populations by OP light. Nuclear polarisation loss associated to the emission of polarised light by the plasma discharge used for MEOP is found to decrease above 10 mT, as expected, due to hyperfine decoupling in highly excited states. However, this does not lead to improved MEOP efficiency at high laser power. We find clear evidence of additional laser-induced relaxation instead. The strong OP-enhanced polarisation losses, currently limiting MEOP performances, are quantitatively investigated using an angular momentum budget approach and a recently developed comprehensive model that describes the combined effects of OP, ME and relaxation, validated by comparison to experimental results.

  2. NMR and NQR studies of 5f-band metamagnetic UCoAl and UCo{sub 1-x}T{sub x}Al (T=Fe,Ni)

    Energy Technology Data Exchange (ETDEWEB)

    Kohori, Y. [Graduate School of Science and Technology, Chiba University, Chiba 263-8522 (Japan) and Department of Physics, Faculty of Science, Chiba University, Chiba 263-8522 (Japan)]. E-mail: kohori@faculty.chiba-u.jp; Fukazawa, H. [Graduate School of Science and Technology, Chiba University, Chiba 263-8522 (Japan); Department of Physics, Faculty of Science, Chiba University, Chiba 263-8522 (Japan); Iwamoto, Y. [Division of Cargo and Transportation Science, Kobe University, Kobe 658-0022 (Japan); Kohara, T. [Graduate School of Material Science, University of Hyogo, Hyogo 678-1297 (Japan); Andreev, A.V. [Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18040 Prague 8 (Czech Republic); Sechovsky, V. [Department of Electronic Structures, Charles University, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic)

    2006-05-01

    The 5f-band system UCoAl, which crystallizes in the hexagonal ZrNiAl-type structure, has the paramagnetic ground state. The magnetic fields H as low as 0.6T oriented along the c-axis induce the metamagnetic transition below 17K. In order to study the magnetic property of UCoAl, we performed {sup 27}Al and {sup 59}Co NMR/NQR measurements in UCoAl, UCo{sub 0.98}Fe{sub 0.02}Al and UCo{sub 0.95}Ni{sub 0.05}Al single crystals. The substitution of Fe stabilizes the ferromagnetic state, and that of Ni stabilizes the paramagnetic state. The nuclear spin-lattice relaxation rate 1/T{sub 1} obtained with the crystal c-axis perpendicular to H is nearly six times larger than the 1/T{sub 1} with the c-axis parallel to H, which reflects the anisotropy of the spin fluctuations of the system.

  3. Tracheal relaxation of five medicinal plants used in Mexico for the treatment of several diseases.

    Science.gov (United States)

    Sánchez-Recillas, Amanda; Mantecón-Reyes, Paul; Castillo-España, Patricia; Villalobos-Molina, Rafael; Ibarra-Barajas, Maximiliano; Estrada-Soto, Samuel

    2014-03-01

    To assess the relaxant effect of several organic extracts obtained from Agastache mexicana (A. mexicana), Cochlospermum vitifolium (C. vitifolium), Cordia morelosana (C. morelosana), Lepechinia caulescens (L. caulescens) and Talauma mexicana (T. mexicana) used in Mexican traditional medicine for the treatment of several diseases. Extracts were obtained by maceration at room temperature using hexane, dichloromethane and methanol for each plant material. The organic extracts were evaluated ex vivo to determine their relaxant activity on the contractions induced by carbachol (cholinergic receptor agonist, 1 μ mol/L) in isolated rat tracheal rings. A total of 15 extracts were evaluated (three for each species). All test samples showed significant relaxant effect, in a concentration-dependent manner, on the contractions induced by 1 μ mol/L carbachol, with exception of extracts from C. morelosana. Active extracts were less potent than theophylline [phosphodiesterase inhibitor, EC50: (28.79±0.82) μg/mL] that was used as positive control. Concentration-response curves revealed that the extracts with more significant effects were dichloromethanic extracts of T. mexicana [Emax: (103.03±3.32)% and EC50: (159.39±3.72) μg/mL) and C. vitifolium [Emax: (106.58±2.42)% and EC50: (219.54±7.61) μg/mL]. Finally, hexanic and dichloromethanic extracts from A. mexicana were fully effective but less potent than T. mexicana and C. vitifolium. Less polar extracts obtained from A. mexicana, T. mexicana and C. vitifolium exhibited greater relaxant effect on tracheal rat rings, which allows us to suggest them as sources for the isolation of bioactive molecules with potential therapeutic value in the treatment of asthma. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  4. Interfacial bonding stabilizes rhodium and rhodium oxide nanoparticles on layered Nb oxide and Ta oxide supports.

    Science.gov (United States)

    Strayer, Megan E; Binz, Jason M; Tanase, Mihaela; Shahri, Seyed Mehdi Kamali; Sharma, Renu; Rioux, Robert M; Mallouk, Thomas E

    2014-04-16

    Metal nanoparticles are commonly supported on metal oxides, but their utility as catalysts is limited by coarsening at high temperatures. Rhodium oxide and rhodium metal nanoparticles on niobate and tantalate supports are anomalously stable. To understand this, the nanoparticle-support interaction was studied by isothermal titration calorimetry (ITC), environmental transmission electron microscopy (ETEM), and synchrotron X-ray absorption and scattering techniques. Nanosheets derived from the layered oxides KCa2Nb3O10, K4Nb6O17, and RbTaO3 were compared as supports to nanosheets of Na-TSM, a synthetic fluoromica (Na0.66Mg2.68(Si3.98Al0.02)O10.02F1.96), and α-Zr(HPO4)2·H2O. High surface area SiO2 and γ-Al2O3 supports were also used for comparison in the ITC experiments. A Born-Haber cycle analysis of ITC data revealed an exothermic interaction between Rh(OH)3 nanoparticles and the layered niobate and tantalate supports, with ΔH values in the range -32 kJ·mol(-1) Rh to -37 kJ·mol(-1) Rh. In contrast, the interaction enthalpy was positive with SiO2 and γ-Al2O3 supports. The strong interfacial bonding in the former case led to "reverse" ripening of micrometer-size Rh(OH)3, which dispersed as 0.5 to 2 nm particles on the niobate and tantalate supports. In contrast, particles grown on Na-TSM and α-Zr(HPO4)2·H2O nanosheets were larger and had a broad size distribution. ETEM, X-ray absorption spectroscopy, and pair distribution function analyses were used to study the growth of supported nanoparticles under oxidizing and reducing conditions, as well as the transformation from Rh(OH)3 to Rh nanoparticles. Interfacial covalent bonding, possibly strengthened by d-electron acid/base interactions, appear to stabilize Rh(OH)3, Rh2O3, and Rh nanoparticles on niobate and tantalate supports.

  5. Association of HMOX1 and NQO1 Polymorphisms with Metabolic Syndrome Components.

    Science.gov (United States)

    Martínez-Hernández, Angélica; Córdova, Emilio J; Rosillo-Salazar, Oscar; García-Ortíz, Humberto; Contreras-Cubas, Cecilia; Islas-Andrade, Sergio; Revilla-Monsalve, Cristina; Salas-Labadía, Consuelo; Orozco, Lorena

    2015-01-01

    Metabolic syndrome (MetS) is among the most important public health problems worldwide, and is recognized as a major risk factor for various illnesses, including type 2 diabetes mellitus, obesity, and cardiovascular diseases. Recently, oxidative stress has been suggested as part of MetS aetiology. The heme oxygenase 1 (HMOX1) and NADH:quinone oxidoreductase 1 (NQO1) genes are crucial mediators of cellular defence against oxidative stress. In the present study, we analysed the associations of HMOX1 (GT)n and NQO1 C609T polymorphisms with MetS and its components. Our study population comprised 735 Mexican Mestizos unrelated volunteers recruited from different tertiary health institutions from Mexico City. In order to know the HMOX1 (GT)n and NQO1 C609T allele frequencies in Amerindians, we included a population of 241 Amerindian native speakers. Their clinical and demographic data were recorded. The HMOX1 (GT)n polymorphism was genotyped using PCR and fluorescence technology. NQO1 C609T polymorphism genotyping was performed using TaqMan probes. Short allele (metabolic disorders, including high systolic and diastolic blood pressure, hypertriglyceridemia, and low HDL-c levels in Mexican Mestizo individuals.

  6. Temperature-dependent structural relaxation in As{sub 40}Se{sub 60} glass

    Energy Technology Data Exchange (ETDEWEB)

    Golovchak, R., E-mail: roman_ya@yahoo.com [Lviv Sci. and Res. Institute of Materials of SRC ' Carat' , 202 Stryjska str., 79031 Lviv (Ukraine); Kozdras, A. [Opole University of Technology, 75, Ozimska str., Opole, PL-45370 (Poland); Academy of Management and Administration, 18 Niedzialkowski str., Opole, PL-45085 (Poland); Shpotyuk, O. [Jan Dlugosz University, 13/15, al. Armii Krajowej, 42201, Czestochowa (Poland); Gorecki, Cz. [Opole University of Technology, 75, Ozimska str., Opole, PL-45370 (Poland); Kovalskiy, A.; Jain, H. [Department of Materials Science and Engineering, Lehigh University, 5 East Packer Avenue, Bethlehem, PA 18015-3195 (United States)

    2011-08-01

    The origin of structural relaxation in As{sub 40}Se{sub 60} glass at different annealing temperatures is studied by differential scanning calorimetry (DSC) and in situ extended X-ray absorption fine structure (EXAFS) methods. Strong physical aging effect, expressed through the increase of endothermic peak area in the vicinity of T{sub g}, is recorded by DSC technique at the annealing temperatures T{sub a}>90{sup o}C. EXAFS data show that the observed structural relaxation is not associated with significant changes in the short-range order of this glass. An explanation is proposed for this relaxation behavior assuming temperature-dependent constraints. -- Highlights: → In this study we report experimental evidence for temperature-dependent constraints theory. → Structural relaxation of As{sub 2}Se{sub 3} glass at higher annealing temperatures is studied by DSC technique. → Accompanied changes in the structure are monitored by in situ EXAFS measurements.

  7. Multivariate analysis of electrical impedance spectra for relaxed and contracted skeletal muscle

    International Nuclear Information System (INIS)

    Zagar, T; Krizaj, D

    2008-01-01

    Four-electrode impedance spectra of relaxed and contracted muscle biceps brachii were analyzed in an adult human subject over the frequency range from 300 Hz to 75 kHz. A feasibility of the principal component analysis of bioimpedance measurement for the evaluation of skeletal muscle contractile state was examined. The principal components score plots show a data grouping of the impedance spectra from the two muscle groups. The classification was performed using a soft independent modeling of class analogy (SIMCA) method. The data set comprised 32 samples (16 samples of contracted muscle and 16 samples of relaxed muscle). The leave-one-out test of the classification yields about 80% of correctly classified samples (11 samples for contracted and 15 samples for relaxed muscle)

  8. Increased transverse relaxivity in ultrasmall superparamagnetic iron oxide nanoparticles used as MRI contrast agent for biomedical imaging.

    Science.gov (United States)

    Mishra, Sushanta Kumar; Kumar, B S Hemanth; Khushu, Subash; Tripathi, Rajendra P; Gangenahalli, Gurudutta

    2016-09-01

    Synthesis of a contrast agent for biomedical imaging is of great interest where magnetic nanoparticles are concerned, because of the strong influence of particle size on transverse relaxivity. In the present study, biocompatible magnetic iron oxide nanoparticles were synthesized by co-precipitation of Fe 2+ and Fe 3+ salts, followed by surface adsorption with reduced dextran. The synthesized nanoparticles were spherical in shape, and 12 ± 2 nm in size as measured using transmission electron microscopy; this was corroborated with results from X-ray diffraction and dynamic light scattering studies. The nanoparticles exhibited superparamagnetic behavior, superior T 2 relaxation rate and high relaxivities (r 1  = 18.4 ± 0.3, r 2  = 90.5 ± 0.8 s -1 mM -1 , at 7 T). MR image analysis of animals before and after magnetic nanoparticle administration revealed that the signal intensity of tumor imaging, specific organ imaging and whole body imaging can be clearly distinguished, due to the strong relaxation properties of these nanoparticles. Very low concentrations (3.0 mg Fe/kg body weight) of iron oxides are sufficient for early detection of tumors, and also have a clear distinction in pre- and post-enhancement of contrast in organs and body imaging. Many investigators have demonstrated high relaxivities of magnetic nanoparticles at superparamagnetic iron oxide level above 50 nm, but this investigation presents a satisfactory, ultrasmall, superparamagnetic and high transverse relaxivity negative contrast agent for diagnosis in pre-clinical studies. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  9. Closed expressions for $\\int_{0}^{1} t^{-1} log^{n-1}t log^{p}(1 - t) dt$

    CERN Document Server

    Kölbig, Kurt Siegfried

    1982-01-01

    Closed expressions for the integral integral /sub 0//sup 1/ t/sup -1/ log/sup n-1/t log/sup p/(1-t)dt, whose general form is given elsewhere, are listed for n=1(1)9, p=1(1)9. A formula is derived which allows an easy evaluation of these expressions by formula manipulation on a computer. The majority of the above expressions are given in a microfiche supplement to the paper.

  10. Anisotropy of the nuclear magnetic relaxation times induced in solid 3He by modulation of the dipolar interactions

    International Nuclear Information System (INIS)

    Deville, G.

    1976-01-01

    Anisotropic nuclear relaxation times have been measured in solid 3 He samples grown at constant pressure, in the Larmor frequency range 1.5MHz-5MHz where the main relaxation mechanism is the modulation of the dipolar interaction by exchange or by motion of the vacancies. The second order calculation made by Harris for the exchange induced relaxation regime is extended to the regime where vacancy motion dominates. The theory is further refined by considering the fourth moment anisotropy effect on the spectral densities. This latter calculation yields a frequency dependent anisotropic contribution to T 1 which agrees qualitatively with the data, unlike the simpler results by Harris [fr

  11. Craniopharyngiomas - the utility of contrast medium enhancement for MR imaging at 1.5 T

    International Nuclear Information System (INIS)

    Hald, J.K.; Eldevik, O.P.; Brunberg, J.A.; Chandler, W.F.

    1994-01-01

    To evaluate the efficacy of i.v. contrast medium administration in MR imaging at 1.5 T in patients with craniopharyngiomas, MR studies of 10 men and 6 women with pathologically proven craniopharyngiomas were made. The MR images were obtained as 3- to 5-mm-thick coronal (n=13) or axial (n=3) T1-weighted images (T1WI) prior to an following i.v. Gd-DTPA administration. Proton density-(PD) and T2-weighted images (T2WI) were also obtained. Conspicuity of tumor margins, cystic versus solid components, size, location and effect upon adjacent structures were separately characterized in all imaging sequences. In 6 patients contrast medium-enhanced T1WI, PD and T2WI demonstrated cystic tumor components not seen on unenhanced T1WI. There were significant differences (p<0.004) on 2-tailed Student's t-test comparing tumor conspicuity on contrast medium-enhanced T1WI with unenhanced T1WI, PD and T2WI. Optimal tumor delineation on MR imaging of patients with craniopharyngiomas justifies the use of i.v. contrast medium. (orig.)

  12. T2 Mapping of the Sacroiliac Joints With 3-T MRI: A Preliminary Study.

    Science.gov (United States)

    Lefebvre, Guillaume; Bergère, Antonin; Rafei, Mazen El; Duhamel, Alain; Teixeira, Pedro; Cotten, Anne

    2017-08-01

    The objective of this study was to assess the feasibility of T2 relaxation time measurements of the sacroiliac joints. The sacroiliac joints of 40 patients were imaged by 3-T MRI using an oblique axial multislice multiecho spin-echo T2-weighted sequence. Manual plotting and automatic subdivision of ROIs allowed us to obtain T2 values for up to 48 different areas per patient (posterior and anterior parts, sacral, intermediate, and iliac parts). Intraand interobserver reproducibility of T2 values were calculated after independent assessment by two musculoskeletal radiologists. A total of 1656 measurement sites could be analyzed. Mean (± SD) T2 values were 40.6 ± 6.7 ms and 41.2 ± 6.3 ms for observer 1 and 39.9 ± 6.6 ms for observer 2. The intraobserver intraclass correlation coefficient was 0.72 (95% CI, 0.70-0.74), and the interobserver intraclass correlation coefficient was 0.71 (95% CI, 0.68-0.72). Our study shows the feasibility of T2 relaxation time measurements at the sacroiliac joints.

  13. Variational formulation of relaxed and multi-region relaxed magnetohydrodynamics

    Science.gov (United States)

    Dewar, R. L.; Yoshida, Z.; Bhattacharjee, A.; Hudson, S. R.

    2015-12-01

    > Ideal magnetohydrodynamics (IMHD) is strongly constrained by an infinite number of microscopic constraints expressing mass, entropy and magnetic flux conservation in each infinitesimal fluid element, the latter preventing magnetic reconnection. By contrast, in the Taylor relaxation model for formation of macroscopically self-organized plasma equilibrium states, all these constraints are relaxed save for the global magnetic fluxes and helicity. A Lagrangian variational principle is presented that leads to a new, fully dynamical, relaxed magnetohydrodynamics (RxMHD), such that all static solutions are Taylor states but also allows state with flow. By postulating that some long-lived macroscopic current sheets can act as barriers to relaxation, separating the plasma into multiple relaxation regions, a further generalization, multi-region relaxed magnetohydrodynamics (MRxMHD) is developed.

  14. Mozart versus new age music: relaxation states, stress, and ABC relaxation theory.

    Science.gov (United States)

    Smith, Jonathan C; Joyce, Carol A

    2004-01-01

    Smith's (2001) Attentional Behavioral Cognitive (ABC) relaxation theory proposes that all approaches to relaxation (including music) have the potential for evoking one or more of 15 factor-analytically derived relaxation states, or "R-States" (Sleepiness, Disengagement, Rested / Refreshed, Energized, Physical Relaxation, At Ease/Peace, Joy, Mental Quiet, Childlike Innocence, Thankfulness and Love, Mystery, Awe and Wonder, Prayerfulness, Timeless/Boundless/Infinite, and Aware). The present study investigated R-States and stress symptom-patterns associated with listening to Mozart versus New Age music. Students (N = 63) were divided into three relaxation groups based on previously determined preferences. Fourteen listened to a 28-minute tape recording of Mozart's Eine Kleine Nachtmusik and 14 listened to a 28-minute tape of Steven Halpern's New Age Serenity Suite. Others (n = 35) did not want music and instead chose a set of popular recreational magazines. Participants engaged in their relaxation activity at home for three consecutive days for 28 minutes a session. Before and after each session, each person completed the Smith Relaxation States Inventory (Smith, 2001), a comprehensive questionnaire tapping 15 R-States as well as the stress states of somatic stress, worry, and negative emotion. Results revealed no differences at Session 1. At Session 2, those who listened to Mozart reported higher levels of At Ease/Peace and lower levels of Negative Emotion. Pronounced differences emerged at Session 3. Mozart listeners uniquely reported substantially higher levels of Mental Quiet, Awe and Wonder, and Mystery. Mozart listeners reported higher levels, and New Age listeners slightly elevated levels, of At Ease/Peace and Rested/Refreshed. Both Mozart and New Age listeners reported higher levels of Thankfulness and Love. In summary, those who listened to Mozart's Eine Kleine Nachtmusik reported more psychological relaxation and less stress than either those who listened to

  15. Studies of a nitroxide radical by EPR in monocrystal: interaction of protons and electronic relaxation

    International Nuclear Information System (INIS)

    Alonso, A.

    1986-01-01

    The ESR spectra of a nitroxide radical, 4-hydroxi-2,2,6,6-tetramethylpiperidine-1-oxyl (TANOL II), introduced as impurity in a diamagnetic host, 4-hydroxi-2,6,6-tetramethylpiperedine (I), were investigated. The use of deuterated radical, 4-hydroxi-2,2,6,6 tetramethylpiperidine-d sub(17) -1, oxyl (PD-TANOL, III) improved the resolution of ESR spectra for most of orientations of magnetic field. The proton interqactions in the neighbourhood of magnetic group N-O were studied and superpyresfine tensors for two strongly coupled protons were determined. In order to study the influence of protons on electronic relaxation of radicals, the relaxation times T sub(1) and T sub(2) were estimated in the temperature range-160 sup(0)C - 25 sup(0)C for several orientations, and comparing data for protonated and deuterated radicals II and III, using the continuous wave saturation method. (author)

  16. Peroxynitrite-induced relaxation in isolated canine cerebral arteries and mechanisms of action

    International Nuclear Information System (INIS)

    Li Jianfeng; Li Wenyan; Altura, Bella T.; Altura, Burton M.

    2004-01-01

    The present study was undertaken to determine the vascular actions of peroxynitrite (ONOO - ), the product of superoxide and nitric oxide (NO), in isolated canine cerebral arteries and to gain insight into its potential mechanisms of action. In the absence of any vasoactive agent, ONOO - (from 10 -7 to 10 -6 M) was able to reduce the basal tension. In prostaglandin F2α-precontracted canine basilar arterial rings, ONOO - elicited concentration-dependent relaxation at concentrations from 10 -8 to 10 -5 M. The effective concentrations producing approximately 50% maximal relaxation (EC 50 ) to ONOO - were 4.06 x 10 -6 and 4.12 x 10 -6 M in intact and denuded rings, respectively (P > 0.05). No significant differences in relaxation responses were found in ring preparations with or without endothelium (P > 0.05). The presence of either 5 μM methylene blue (MB) or 5 μM 1H-[1,2,4]oxadiazolo-[4,3-α]quinoxalin-1-one (ODQ) significantly inhibited the relaxations induced by ONOO - . Tetraethylammonium chloride (T-2265) significantly decreased the ONOO - -induced relaxations in a concentration-dependent manner. However, ONOO - had no effect on rings precontracted by high KCL (P > 0.05). Addition of low concentrations of calyculin A (50 nM) was able to abolish the ONOO - -induced relaxation. Furthermore, ONOO - significantly inhibited calcium-induced contractions of K + -depolarized canine cerebral rings in a concentration-related manner. Lastly, a variety of pharmacological agents and antagonists including L-NMMA, L-arginine, indomethacin, atropine, naloxone, diphenhydramine, cimetine, glibenclamide, haloperidol, etc., did not influence the relaxant effects of ONOO - on the rings. Our new results suggest that ONOO - -triggered relaxation, on canine cerebral arteries, is mediated by elevation of cyclic guanosine monophosphate (cGMP) levels, membrane hyperpolarization via K+ channel activation, activation of myosin light chain phosphatase activity, and interference with

  17. Relaxation-compensated difference spin diffusion NMR for detecting 13C–13C long-range correlations in proteins and polysaccharides

    International Nuclear Information System (INIS)

    Wang, Tuo; Williams, Jonathan K.; Schmidt-Rohr, Klaus; Hong, Mei

    2015-01-01

    The measurement of long-range distances remains a challenge in solid-state NMR structure determination of biological macromolecules. In 2D and 3D correlation spectra of uniformly 13 C-labeled biomolecules, inter-residue, inter-segmental, and intermolecular 13 C– 13 C cross peaks that provide important long-range distance constraints for three-dimensional structures often overlap with short-range cross peaks that only reflect the covalent structure of the molecule. It is therefore desirable to develop new approaches to obtain spectra containing only long-range cross peaks. Here we show that a relaxation-compensated modification of the commonly used 2D 1 H-driven spin diffusion (PDSD) experiment allows the clean detection of such long-range cross peaks. By adding a z-filter to keep the total z-period of the experiment constant, we compensate for 13 C T 1 relaxation. As a result, the difference spectrum between a long- and a scaled short-mixing time spectrum show only long-range correlation signals. We show that one- and two-bond cross peaks equalize within a few tens of milliseconds. Within ∼200 ms, the intensity equilibrates within an amino acid residue and a monosaccharide to a value that reflects the number of spins in the local network. With T 1 relaxation compensation, at longer mixing times, inter-residue and inter-segmental cross peaks increase in intensity whereas intra-segmental cross-peak intensities remain unchanged relative to each other and can all be subtracted out. Without relaxation compensation, the difference 2D spectra exhibit both negative and positive intensities due to heterogeneous T 1 relaxation in most biomolecules, which can cause peak cancellation. We demonstrate this relaxation-compensated difference PDSD approach on amino acids, monosaccharides, a crystalline model peptide, a membrane-bound peptide and a plant cell wall sample. The resulting difference spectra yield clean multi-bond, inter-residue and intermolecular correlation peaks

  18. Precipitate growth in multi-component systems with stress relaxation by diffusion and creep

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Fischer, F. D.; Riedel, H.; Kozeschnik, E.

    2016-01-01

    Roč. 82, JUL (2016), s. 112-126 ISSN 0749-6419 EU Projects: European Commission(XE) 309916 Institutional support: RVO:68081723 Keywords : Strengthening mechanisms * Phase transformation * Creep * Stress relaxation * Precipitation kinetics Subject RIV: BJ - Thermodynamics Impact factor: 5.702, year: 2016

  19. Nuclear relaxation behavior of the superconducting cuprates: Bi2Sr2CaCu2O8

    Science.gov (United States)

    Walstedt, R. E.; Bell, R. F.; Mitzi, D. B.

    1991-10-01

    Nuclear-magnetic-resonance data are presented and analyzed for the high-Tc compound Bi2Sr2CaCu2O8 for two oxygen doping levels. Both sample conditions lead to spin-gap behavior for the NMR shift, with a precursive downturn in the data at T>Tc. In addition, the relaxation times T1 obey the relation (T1T)-1~Ks(T) at low temperatures (T<~100 K), where Ks(T) is the spin paramagnetic shift. This relation, which is also obeyed by other superconductors, is argued to be related to the spin-gap effects and thus incompatible with a Fermi-liquid approach to the understanding of these systems.

  20. Hyperfine relaxation of an optically pumped cesium vapor

    International Nuclear Information System (INIS)

    Tornos, J.; Amare, J.C.

    1986-01-01

    The relaxation of hyperfine orientation indirectly induced by optical pumping with a σ-polarized D 1 -light in a cesium vapor in the presence of Ar is experimentally studied. The detection technique ensures the absence of quadrupole relaxation contributions in the relaxation signals. The results from the dependences of the hyperfine relaxation rate on the temperature and argon pressure are: diffusion coefficient of Cs in Ar, D 0 = 0.101 +- 0.010 cm 2 s -1 at 0 0 C and 760 Torr; relaxation cross section by Cs-Ar collisions, σ/sub c/ = (104 +- 5) x 10 -23 cm 2 ; relaxation cross section by Cs-Cs (spin exchange) collisions, σ/sub e//sub x/ = (1.63 +- 0.13) x 10 -14 cm 2

  1. Electric noise component with density f-1 identified on ISEE 3

    International Nuclear Information System (INIS)

    Hoang, S.; Steinberg, J.L.; Couturier, P.; Feldman, W.C.

    1982-01-01

    An electric noise component with an f - 1 spectrum is observed with the SBH radioastronomy receivers on ISEE 3 at frequencies lower than the plasma frequency f/sub p/. On the Z antenna (electrical length for long waves is 7 m) this component is 5--10 times more intense than the predicted thermal noise level. Its spectral density is proportional to f/sub p/ f - 1 (T/sub c/)/sup 1/2/, where T/sub c/ is the core electron temperature and f is the observing frequency. On the S antenna (90 m tip to tip) the new component is much weaker and most probably represents the high-frequency part of a noise spectrum found by Kellogg (1981) with an antenna of the same length. This author interpreted it as mostly due to electron acoustic waves and Doppler shifted ion acoustic waves, but this interpretation has not been confirmed by more accurate calculations (Couturier et al., 1982). Kellogg's spectrum also shows an f - 1 frequency dependence and, if extrapolated assuming the same law as for the Z antenna, approximately fits our S antenna observations. The S antenna f - 1 noise is deeply spin modulated with the minimum electric field in the direction of the solar wind flow as seen in the spacecraft frame of reference. The modulation factor decreases with increasing frequency, becomes negligible when the new component intensity becomes negligible as compared with thermal noise, and increases with the solar wind velocity. The f - 1 component shows some of the properties which are expected from shot noise (direction of minimum intensity) but its spectral index is -1 while shot noise is supposed to show a spectral index -2

  2. Magnetic relaxation phenomena in the chiral magnet Fe1 -xCoxSi : An ac susceptibility study

    Science.gov (United States)

    Bannenberg, L. J.; Lefering, A. J. E.; Kakurai, K.; Onose, Y.; Endoh, Y.; Tokura, Y.; Pappas, C.

    2016-10-01

    We present a systematic study of the ac susceptibility of the chiral magnet Fe1 -xCoxSi with x =0.30 covering four orders of magnitude in frequencies from 0.1 Hz to 1 kHz, with particular emphasis to the pronounced history dependence. Characteristic relaxation times ranging from a few milliseconds to tens of seconds are observed around the skyrmion lattice A phase, the helical-to-conical transition and in a region above TC. The distribution of relaxation frequencies around the A phase is broad, asymmetric, and originates from multiple coexisting relaxation processes. The pronounced dependence of the magnetic phase diagram on the magnetic history and cooling rates as well as the asymmetric frequency dependence and slow dynamics suggest more complicated physical phenomena in Fe0.7Co0.3Si than in other chiral magnets.

  3. Significance of focal relaxation times in head injury

    Energy Technology Data Exchange (ETDEWEB)

    Inao, Suguru; Furuse, Masahiro; Saso, Katsuyoshi; Yoshida, Kazuo; Motegi, Yoshimasa; Kaneoke, Yoshiki; Izawa, Akira

    1987-11-01

    Serial examinations by nuclear magnetic resonance-computed tomography were carried out in 35 head-injured patients aged 7 to 77 years. The injuries were classified as cerebral contusion (nine cases), acute epidural hematoma (eight cases), acute cerebral swelling (two cases), and chronic subdural hematoma (16 cases). The results of 92 measurements were divided into two groups: acute stage (within 3 days of injury) and chronic stage (2 weeks or longer after injury). The spin-lattice relaxation times (T/sub 1/) of brain tissue adjacent to chronic subdural hematoma were evaluated pre- and postoperatively. A Fonar QED 80-alpha system was used for magnetic resonance imaging and measurement of focal T/sub 1/. The T/sub 1/ values at the region of interest were measured 3 to 5 times by the field focusing technique (468 gauss in the focused spot), and the mean value was used for evaluation. The standard T/sub 1/ values obtained from healthy subjects were 290 +- 41 msec in the cerebral cortex and 230 +- 34 msec in the white matter. Prolongation of T/sub 1/ in perifocal brain gradually shortened over time and normalized in the chronic stage. The degree of contusional edema may have been reflected in alterations in T/sub 1/. In contrast, parenchymal injury resulted in a progressive T/sub 1/ elevation, which far exceeded 500 msec in the chronic stage. Such time courses of T/sub 1/ may indicate irreversible tissue damage. There were no noticeable changes in tissue T/sub 1/ over time in patients with acute diffuse cerebral swelling or those who underwent evacuation of acute epidural or chronic subdural hematomas. The underlying pathophysiology in such situations seems to be not brain edema but cerebral hyperemia. In the presence of ischemia, the T/sub 1/ value was prolonged in the early stage, reflecting progression of is chemic edema. (Abstract Truncated)

  4. Metastability exchange optical pumping in {sup 3}He gas up to 30 mT. Efficiency measurements and evidence of laser-induced nuclear relaxation

    Energy Technology Data Exchange (ETDEWEB)

    Batz, Marion

    2011-07-08

    Advances in metastability exchange optical pumping (MEOP) of {sup 3}He at high laser powers, with its various applications, but also at high gas pressures p{sub 3} and high magnetic field strengths B, have provided strong motivation for revisiting the understanding and for investigating the limitations of this powerful technique. For this purpose, we present systematic experimental and theoretical studies of efficiency and of relaxation mechanisms in B{<=}30 mT and p{sub 3}=0.63-2.45 mbar. {sup 3}He nuclear polarisation is measured by light absorption in longitudinal configuration where weak light beams at 1083 nm parallel to magnetic field and cell axis with opposite circular polarisations are used to probe the distribution of populations in the metastable state. This method is systematically tested to evaluate potential systematic biases and is shown to be reliable for the study of OP dynamics despite the redistribution of populations by OP light. Nuclear polarisation loss associated to the emission of polarised light by the plasma discharge used for MEOP is found to decrease above 10 mT, as expected, due to hyperfine decoupling in highly excited states. However, this does not lead to improved MEOP efficiency at high laser power. We find clear evidence of additional laser-induced relaxation instead. The strong OP-enhanced polarisation losses, currently limiting MEOP performances, are quantitatively investigated using an angular momentum budget approach and a recently developed comprehensive model that describes the combined effects of OP, ME and relaxation, validated by comparison to experimental results.

  5. Experimental evidence for simultaneous relaxation processes in super spin glass γ-Fe2O3 nanoparticle system

    Science.gov (United States)

    Nikolic, V.; Perovic, M.; Kusigerski, V.; Boskovic, M.; Mrakovic, A.; Blanusa, J.; Spasojevic, V.

    2015-03-01

    Spherical γ-Fe2O3 nanoparticles with the narrow size distribution of (5 ± 1) nm were synthesized by the method of thermal decomposition from iron acetyl acetonate precursor. The existence of super spin-glass state at low temperatures and in low applied magnetic fields was confirmed by DC magnetization measurements on a SQUID magnetometer. The comprehensive investigation of magnetic relaxation dynamics in low-temperature region was conducted through the measurements of single-stop and multiple stop ZFC memory effects, ZFC magnetization relaxation, and AC susceptibility measurements. The experimental findings revealed the peculiar change of magnetic relaxation dynamics at T ≈ 10 K, which arose as a consequence of simultaneous existence of different relaxation processes in Fe2O3 nanoparticle system. Complementarity of the applied measurements was utilized in order to single out distinct relaxation processes as well as to elucidate complex relaxation mechanisms in the investigated interacting nanoparticle system.

  6. Characterization of dynamics in complex lyophilized formulations: I. Comparison of relaxation times measured by isothermal calorimetry with data estimated from the width of the glass transition temperature region.

    Science.gov (United States)

    Chieng, Norman; Mizuno, Masayasu; Pikal, Michael

    2013-10-01

    The purposes of this study are to characterize the relaxation dynamics in complex freeze dried formulations and to investigate the quantitative relationship between the structural relaxation time as measured by thermal activity monitor (TAM) and that estimated from the width of the glass transition temperature (ΔT(g)). The latter method has advantages over TAM because it is simple and quick. As part of this objective, we evaluate the accuracy in estimating relaxation time data at higher temperatures (50 °C and 60 °C) from TAM data at lower temperature (40 °C) and glass transition region width (ΔT(g)) data obtained by differential scanning calorimetry. Formulations studied here were hydroxyethyl starch (HES)-disaccharide, HES-polyol, and HES-disaccharide-polyol at various ratios. We also re-examine, using TAM derived relaxation times, the correlation between protein stability (human growth hormone, hGH) and relaxation times explored in a previous report, which employed relaxation time data obtained from ΔT(g). Results show that most of the freeze dried formulations exist in single amorphous phase, and structural relaxation times were successfully measured for these systems. We find a reasonably good correlation between TAM measured relaxation times and corresponding data obtained from estimates based on ΔT(g), but the agreement is only qualitative. The comparison plot showed that TAM data are directly proportional to the 1/3 power of ΔT(g) data, after correcting for an offset. Nevertheless, the correlation between hGH stability and relaxation time remained qualitatively the same as found with using ΔT(g) derived relaxation data, and it was found that the modest extrapolation of TAM data to higher temperatures using ΔT(g) method and TAM data at 40 °C resulted in quantitative agreement with TAM measurements made at 50 °C and 60 °C, provided the TAM experiment temperature, is well below the Tg of the sample. Copyright © 2013 Elsevier B.V. All rights

  7. Characterization of anomalous relaxation using the time-fractional Bloch equation and multiple echo T2 *-weighted magnetic resonance imaging at 7 T.

    Science.gov (United States)

    Qin, Shanlin; Liu, Fawang; Turner, Ian W; Yu, Qiang; Yang, Qianqian; Vegh, Viktor

    2017-04-01

    To study the utility of fractional calculus in modeling gradient-recalled echo MRI signal decay in the normal human brain. We solved analytically the extended time-fractional Bloch equations resulting in five model parameters, namely, the amplitude, relaxation rate, order of the time-fractional derivative, frequency shift, and constant offset. Voxel-level temporal fitting of the MRI signal was performed using the classical monoexponential model, a previously developed anomalous relaxation model, and using our extended time-fractional relaxation model. Nine brain regions segmented from multiple echo gradient-recalled echo 7 Tesla MRI data acquired from five participants were then used to investigate the characteristics of the extended time-fractional model parameters. We found that the extended time-fractional model is able to fit the experimental data with smaller mean squared error than the classical monoexponential relaxation model and the anomalous relaxation model, which do not account for frequency shift. We were able to fit multiple echo time MRI data with high accuracy using the developed model. Parameters of the model likely capture information on microstructural and susceptibility-induced changes in the human brain. Magn Reson Med 77:1485-1494, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  8. Polyethylene glycol-covered ultra-small Gd2O3 nanoparticles for positive contrast at 1.5 T magnetic resonance clinical scanning

    Science.gov (United States)

    Fortin, Marc-André; Petoral, Rodrigo M., Jr.; Söderlind, Fredrik; Klasson, A.; Engström, Maria; Veres, Teodor; Käll, Per-Olof; Uvdal, Kajsa

    2007-10-01

    The size distribution and magnetic properties of ultra-small gadolinium oxide crystals (US-Gd2O3) were studied, and the impact of polyethylene glycol capping on the relaxivity constants (r1, r2) and signal intensity with this contrast agent was investigated. Size distribution and magnetic properties of US-Gd2O3 nanocrystals were measured with a TEM and PPMS magnetometer. For relaxation studies, diethylene glycol (DEG)-capped US-Gd2O3 nanocrystals were reacted with PEG-silane (MW 5000). Suspensions were adequately dialyzed in water to eliminate traces of Gd3+ and surfactants. The particle hydrodynamic radius was measured with dynamic light scattering (DLS) and the proton relaxation times were measured with a 1.5 T MRI scanner. Parallel studies were performed with DEG-Gd2O3 and PEG-silane-SPGO (Gd2O3,DTPA and the r2/r1 ratio was 1.4. PEG-silane-SPGO gave low r1 relaxivities and high r2/r1 ratios, less compatible with positive contrast agent requirements. Higher r1 were obtained with PEG-silane in comparison to DEG-Gd2O3. Treatment of DEG-US-Gd2O3 with PEG-silane provides enhanced relaxivity while preventing aggregation of the oxide cores. This study confirms that PEG-covered Gd2O3 nanoparticles can be used for positively contrasted MR applications requiring stability, biocompatible coatings and nanocrystal functionalization.

  9. Escape time, relaxation, and sticky states of a softened Henon-Heiles model: Low-frequency vibrational mode effects and glass relaxation

    Science.gov (United States)

    Toledo-Marín, J. Quetzalcóatl; Naumis, Gerardo G.

    2018-04-01

    Here we study the relaxation of a chain consisting of three masses joined by nonlinear springs and periodic conditions when the stiffness is weakened. This system, when expressed in their normal coordinates, yields a softened Henon-Heiles system. By reducing the stiffness of one low-frequency vibrational mode, a faster relaxation is enabled. This is due to a reduction of the energy barrier heights along the softened normal mode as well as for a widening of the opening channels of the energy landscape in configurational space. The relaxation is for the most part exponential, and can be explained by a simple flux equation. Yet, for some initial conditions the relaxation follows as a power law, and in many cases there is a regime change from exponential to power-law decay. We pinpoint the initial conditions for the power-law decay, finding two regions of sticky states. For such states, quasiperiodic orbits are found since almost for all components of the initial momentum orientation, the system is trapped inside two pockets of configurational space. The softened Henon-Heiles model presented here is intended as the simplest model in order to understand the interplay of rigidity, nonlinear interactions and relaxation for nonequilibrium systems such as glass-forming melts or soft matter. Our softened system can be applied to model β relaxation in glasses and suggest that local reorientational jumps can have an exponential and a nonexponential contribution for relaxation, the latter due to asymmetric molecules sticking in cages for certain orientations.

  10. Synthesis and photodegradation studies of analogues of muscle relaxant 1,4-dihydropyridine compounds

    Directory of Open Access Journals (Sweden)

    Gündüz Miyase Gözde

    2017-09-01

    Full Text Available This paper describes the synthesis of 1,4-dihydropyridine compounds (DHPs endowed with good muscle relaxant activity and stability to light. Six new condensed DHPs were synthesized by the microwave irradiation method. A long-chain ester moiety [2-(methacryloyloxyethyl] and various substituents on the phenyl ring were demonstrated to affect the muscle relaxant activity occurring in isolated rabbit gastric fundus smooth muscle strips. Forced photodegradation conditions were applied to the molecules according to the ICH rules. The degradation profile of the drugs was monitored by spectrophotometry coupled with the multivariate curve resolution technique. Formation of the oxidized pyridine derivative was observed for all the studied DHPs, except for one compound, which showed very fast degradation and formation of a second photo-product. Pharmacological tests on the molecules showed a good muscle relaxing effect, with a mechanism similar to that of nifedipine, however, proving to be more stable to light.

  11. Non-exponential dynamic relaxation in strongly nonequilibrium nonideal plasmas

    International Nuclear Information System (INIS)

    Morozov, I V; Norman, G E

    2003-01-01

    Relaxation of kinetic energy to the equilibrium state is simulated by the molecular dynamics method for nonideal two-component non-degenerate plasmas. Three limiting examples of initial states of strongly nonequilibrium plasma are considered: zero electron velocities, zero ion velocities and zero velocities of both electrons and ions. The initial non-exponential stage, its duration τ nB and subsequent exponential stages of the relaxation process are studied for a wide range of the nonideality parameter and the ion mass

  12. Deformation, Stress Relaxation, and Crystallization of Lithium Silicate Glass Fibers Below the Glass Transition Temperature

    Science.gov (United States)

    Ray, Chandra S.; Brow, Richard K.; Kim, Cheol W.; Reis, Signo T.

    2004-01-01

    The deformation and crystallization of Li(sub 2)O (center dot) 2SiO2 and Li(sub 2)O (center dot) 1.6SiO2 glass fibers subjected to a bending stress were measured as a function of time over the temperature range -50 to -150 C below the glass transition temperature (Tg). The glass fibers can be permanently deformed at temperatures about 100 C below T (sub)g, and they crystallize significantly at temperatures close to, but below T,, about 150 C lower than the onset temperature for crystallization for these glasses in the no-stress condition. The crystallization was found to occur only on the surface of the glass fibers with no detectable difference in the extent of crystallization in tensile and compressive stress regions. The relaxation mechanism for fiber deformation can be best described by a stretched exponential (Kohlrausch-Williams-Watt (KWW) approximation), rather than a single exponential model.The activation energy for stress relaxation, Es, for the glass fibers ranges between 175 and 195 kJ/mol, which is considerably smaller than the activation energy for viscous flow, E, (about 400 kJ/mol) near T, for these glasses at normal, stress-free condition. It is suspected that a viscosity relaxation mechanism could be responsible for permanent deformation and crystallization of the glass fibers below T,

  13. Study of supersaturation of defects under neutron irradiation by Zener relaxation

    International Nuclear Information System (INIS)

    Gonzalez, Hector C.; Justus, Francisco J.W.

    2004-01-01

    Vacancy supersaturation in dynamic equilibrium under fast neutron irradiation could be determined by anelastic relaxation. This phenomenon is particularly noticeable in some substitutional binary alloys. Relaxation is due to the reordering of atoms pairs under a stress, being a local reordering at the atomic scale. Relaxation time (τ) is inversely proportional to the vacancy concentration (Cv) and decreases under irradiation because a dynamical equilibrium of vacancy concentration, higher than thermodynamic equilibrium, is established. Theoretical models allow estimating the magnitude of that supersaturation. Determinations of τ at different temperatures, with and without fast neutron irradiations, were made with an 'in situ' device placed in the high temperature loop in the RA1 CAC-CNEA reactor. An alloy Au-30% Ni was used, since it presents an appreciable Zener effect. The measurements were performed in a spring-shaped specimen in order to minimize temperature and flux gradients. An Arrhenius plot of τ was obtained, and it was observed that for temperatures lower than 220 C degrees a vacancy supersaturation exists. The lowest temperature of our experiments was 190 C degrees. A value of τ at this temperature was three times lower under irradiations. A plot of τ vs. fast neutron fluence (φ f t) at the irradiation temperature T= 203 C degrees was obtained. An increase of τ was observed. After an annealing at T = 280 C degrees, the value of τ recovers the value corresponding to the unirradiated case. This fact suggests that the loops produced by irradiation act as defect sinks. (author) [es

  14. Animal experimental studies on the influence of fatty infiltration of the liver on tissue relaxation times and signal changes in MRT

    International Nuclear Information System (INIS)

    Kreft, B.; Stark, D.; Schild, H.

    1995-01-01

    Using a spectrometer (n=60) in vitro and MRT imaging (n=8) in vivo, we studied the influence of fatty changes of liver cells on the relaxation times of the liver (two animal models of fatty liver disease/orotic acid, L-ethionine). Induction of fatty degeneration of the liver by means of an orotic acid diet resulted in pure deposition of fat in the liver without any histological or serological proof of inflammatory changes. Although accumulation of triglyceride in the liver reduced the T 1 relaxation time only relatively slightly (-15%), there was good correlation (r=0.88) between fat content and T 1 . There was also good correlation (r=0.92) between T 2 and histological fat content. Inflammatory changes besides fatty deposition were seen both serologically and histologically in the L-ethionine model, so that the fatty content did not correlate with T 1 . In-vivo MRT imaging showed that spin-echo sequences are inappropriate for diagnosing fatty infiltration of the liver despite the relaxation time changes produced by the fatty deposition. On the other hand, chemical-shift imaging sequences are very sensitive to identify fatty deposits, and are also independent of any additionally existing inflammatory changes. (orig.) [de

  15. Comparing the Effects of Progressive Muscle Relaxation and Guided Imagery on sleep quality in primigravida women referring to Mashhad health care centers-1393

    Directory of Open Access Journals (Sweden)

    Nahid Golmakani

    2015-04-01

    Full Text Available Background & aim: Decreased sleep quality is a common complaint during pregnancy. Relaxation is one of the non-pharmaceutical treatments for sleep disorders. Different techniques could have different impacts on various biological and mental stressors. Therefore, this study aimed to compare the effects of progressive muscle relaxation and guided imagery on the sleep quality of primigravida women. Methods:This three-group clinical trial was conducted on 100 primigravida women, referring to Mashhad health care centers in 2014. All women, who met the inclusion criteria, were randomly assigned to three groups: progressive muscle relaxation, guided imagery, and control groups. The intervention groups performed the exercises twice a day for a period of four weeks at home after two sessions of relaxation training (held during two weeks. Then, the quality of sleep was measured using Pittsburgh Sleep Quality Index. For data analysis, ANOVA, Kruskal-Wallis, paired t-test, and post-hoc test were performed, using SPSS version 11.5. Results: The total score of sleep quality and its components (except use of sleep medication was significantly lower after the intervention, compared to the pre-intervention period in progressive muscle relaxation and guided imagery groups (P

  16. Solid-state NMR paramagnetic relaxation enhancement immersion depth studies in phospholipid bilayers

    KAUST Repository

    Chu, Shidong

    2010-11-01

    A new approach for determining the membrane immersion depth of a spin-labeled probe has been developed using paramagnetic relaxation enhancement (PRE) in solid-state NMR spectroscopy. A DOXYL spin label was placed at different sites of 1-palmitoyl-2-stearoyl-sn-glycero-3-phosphocholine (PSPC) phospholipid bilayers as paramagnetic moieties and the resulting enhancements of the longitudinal relaxation (T1) times of 31P nuclei on the surface of the bilayers were measured by a standard inversion recovery pulse sequence. The 31P NMR spin-lattice relaxation times decrease steadily as the DOXYL spin label moves closer to the surface as well as the concentration of the spin-labeled lipids increase. The enhanced relaxation vs. the position and concentration of spin-labels indicate that PRE induced by the DOXYL spin label are significant to determine longer distances over the whole range of the membrane depths. When these data were combined with estimated correlation times τc, the r-6-weighted, time-averaged distances between the spin-labels and the 31P nuclei on the membrane surface were estimated. The application of using this solid-state NMR PRE approach coupled with site-directed spin labeling (SDSL) may be a powerful method for measuring membrane protein immersion depth. © 2010 Elsevier Inc. All rights reserved.

  17. Current leakage relaxation and charge trapping in ultra-porous low-k materials

    International Nuclear Information System (INIS)

    Borja, Juan; Plawsky, Joel L.; Gill, William N.; Lu, T.-M.; Bakhru, Hassaram

    2014-01-01

    Time dependent dielectric failure has become a pivotal aspect of interconnect design as industry pursues integration of sub-22 nm process-technology nodes. Literature has provided key information about the role played by individual species such as electrons, holes, ions, and neutral impurity atoms. However, no mechanism has been shown to describe how such species interact and influence failure. Current leakage relaxation in low-k dielectrics was studied using bipolar field experiments to gain insight into how charge carrier flow becomes impeded by defects within the dielectric matrix. Leakage current decay was correlated to injection and trapping of electrons. We show that current relaxation upon inversion of the applied field can be described by the stretched exponential function. The kinetics of charge trapping events are consistent with a time-dependent reaction rate constant, k=k 0 ⋅(t+1) β−1 , where 0 < β < 1. Such dynamics have previously been observed in studies of charge trapping reactions in amorphous solids by W. H. Hamill and K. Funabashi, Phys. Rev. B 16, 5523–5527 (1977). We explain the relaxation process in charge trapping events by introducing a nonlinear charge trapping model. This model provides a description on the manner in which the transport of mobile defects affects the long-tail current relaxation processes in low-k films

  18. The water proton spin-lattice relaxation times in virus-infected cells

    International Nuclear Information System (INIS)

    Valensin, G.; Gaggelli, E.; Tiezzi, E.; Valensin, P.E.; Bianchi Bandinelli, M.L.

    1979-01-01

    The water proton spin-lattice relaxation times in HEp-2 cell cultures were determined immediately after 1 h of polio-virus adsorption. The shortening of the water T 1 was closely related to the multiplicity of infection, allowing direct inspections of the virus-cell interaction since the first steps of the infectious cycle. Virus-induced structural and conformational changes of cell constituents were suggested to be detectable by NMR investigation of cell water. (Auth.)

  19. Muon spin relaxation in ferromagnetic PdMn

    International Nuclear Information System (INIS)

    Dodds, S.A.; Gist, G.A.; Heffner, R.H.; Leon, M.; MacLaughlin, D.E.; Mydosh, J.A.; Nieuwenhuys, G.J.; Schillaci, M.E.

    1983-01-01

    Positive-muon (μ + ) spin relaxation experiments have been carried out in the dilute ferromagnetic alloy Pd + 2 at % Mn (T/sub c/ = 5.8 0 K). In the paramagnetic state the inhomogeneous μ + linewidth is proportional to the bulk magnetization. Below T/sub c/ the μ + linewidth and the width of the μ + local field distribution in zero applied field are both in qualitative accord with the Sherrington-Kirkpatrick theory of disordered magnets

  20. Magnetic resonance studies on the brain edema by the administration of the osmotic agents; Special references to the relaxation times

    Energy Technology Data Exchange (ETDEWEB)

    Niino, Masaki; Asakura, Tetsuhiko; Nakamura, Katsumi; Yatsushiro, Kazutaka; Kadota, Koki (Kagoshima Univ. (Japan). Faculty of Medicine); Sasahira, Masahiro; Fujimoto, Toshiro; Shimooki, Susumu

    1990-03-01

    Changes of proton relaxation times (T{sub 1} and T{sub 2}) and MR imaging of the brain edema by the administration of the osmotic agents (mannitol or glycerol) were studied. Subjects were 11 patients who were composed of 4 gliomas, 2 metastatic brain tumors, 2 meningiomas, 2 hypertensive intracerebral hematomas, and a C-P angle tumor. 20% mannitol or 10% glycerol 550 ml was rapidly injected intravenously. Scanning was done before injection, just after injection, and post injection until 2 hours with passing times. We regarded the peritumoral or perihemorrahgical low density area on the CT scan as the edema, and then, relaxation times of the edema was obtained from the ROI of the calculated images corresponding to the surrounding low density area on the CT scan. The results were as follows. (1) In general, relaxation times of the edema showed a tendency to decrease after injection of the osmotic agents. Normal white matter, in the same way, showed the decreasing tendency, but the degree of the decreasing was more clearly in the edematous areas than in the white matter. (2) The changes of relaxation times did not show a uniform pattern. In most cases, relaxation times decreased just after injection. But in a few cases, relaxation times increased just after injection, transiently. In some cases, decreased relaxation times continued more than 2 hours, in the other cases, relaxation times increased at 2 hours. (3) The changes of relaxation times thought to be varied by some factors, that is --kinds of the lesions causing edema, degree of malignancy of the lesions, or phase of edema (acute or chronic) etc. (4) Osmotic agents were supposed to dehydrate the edematous lesions. In the current MR systems, there are considerably large standard deviations and inequality in the magnetic field, therefore, further investigations should be done moreover. (author).