WorldWideScience

Sample records for relacionadas ao cateter

  1. INFECÇÃO DO TRATO URINÁRIO RELACIONADA AO CATETER: PERFIL DE SENSIBILIDADE ANTIMICROBIANA

    Directory of Open Access Journals (Sweden)

    Silvana Kelie Souza de Almeida Barros

    2013-01-01

    Full Text Available Estudio descriptivo, cuantitativo, cuyo objetivo fue analizar la prevalencia de microorganismos y perfil de sensibilidad a antimicrobianos en uroculturas de pacientes con infección del tracto urinario relacionada al catéter. Se investigaron 394 registros médicos de pacientes adultos en Unidad de Cuidados Intensivos del Hospital Universitario de Londrina-Paraná, Brasil, de abril a diciembre de 2011. La prevalencia de infección de tracto urinario relacionada al catéter fue 34,0% (134 y 2,2% (3 desarrollaron sepsis. Los microorganismos más comunes aislados en los cultivos de orina fueron: Candida sp (44,4%, Acinetobacter baumannii (9,7% y Pseudomonas aeruginosa (9,2%. La última representó 86,7% de resistencia a cefalosporinas de tercera generación y Acinetobacter baumannii 83,3% a los carbapenémicos. La Klebsiella pneumoniae presentó 87,5% de resistencia a cefalosporinas de tercera y cuarta generación y 75,0% a carbapenémicos. La resistencia bacteriana es frecuente en infecciones del tracto urinario relacionadas al catéter, y las medidas de control deben ser resaltadas.

  2. Importância da assistência de enfermagem no manejo de complicação relacionada ao cateter totalmente implantável

    Directory of Open Access Journals (Sweden)

    Luciana Mendes Bruzi

    2011-04-01

    Full Text Available Trata-se de relato de experiência com paciente do sexo feminino, 30 anos, com diagnóstico de recaída de Leucemia Mielóide Aguda, submetida à implantação de cateter e que apresentou necrose na ferida cirúrgica. Foram utilizados com sucesso: colagenase, alginato de cálcio e loção oleosa à base de ácidos graxos essenciais. Ficou claro que as complicações relacionadas a cateteres conferem um grande desafio à enfermagem oncológica além de determinarem atraso no tratamento oncológico. A correta tomada de decisão o quanto antes é de extrema importância e evita a retirada precoce do cateter.

  3. O enfermeiro e o cuidado na prevenção de infecção sanguínea relacionada ao cateter de PICC em neonatos

    OpenAIRE

    Santos, Ana Selma Pereira dos; Maia, Luiz Faustino dos Santos

    2014-01-01

    O cateter central de inserção periférica é um procedimento indicado para o recém-nascido quando existe dificuldade para punção venosa. Trata-se de um estudo de revisão bibliográfica e qualitativa, cuja fonte foi as bases de dados da BDENF e os objetos foram artigos que atenderam aos critérios de inclusão estabelecidos. Infere-se que o profissional requer conhecimento, treinamento e habilidade para executar os cuidados com o cateter de PICC e realizar prevenção e intervenção de complicações in...

  4. Infecção do trato urinário relacionada ao cateter vesical de demora: incidência e fatores de risco

    Directory of Open Access Journals (Sweden)

    Stamm A.M.N. de F.

    1999-01-01

    Full Text Available OBJETIVO: Determinar a incidência e os fatores de risco relacionados a infecção do trato urinário (ITU em pacientes submetidos à sondagem vesical de demora (SVD. MÉTODOS E CASUÍSTICA: Cento e trinta e seis pacientes submetidos à SVD entre maio e dezembro de 1993 no Hospital Universitário(HU da Universidade Federal de Santa Catarina (UFSC. Estudo observacional de coorte contemporânea, não-controlado, em pacientes submetidos a SVD, que foram seguidos desde a inserção até a remoção da sonda. Culturas de urina no ato da inserção e da retirada foram realizadas em meios convencionais para bactérias aeróbicas; também foi cultivado material obtido com "swab" do meato uretral. Na análise estatística usou-se métodos paramétricos para variáveis categóricas e contínuas, e análise multivariada para determinação de fatores de risco para ITU. RESULTADOS: A incidência de ITU associada a SVD nesta amostra foi de 11 % . Na análise univariada três fatores foram significativos estatisticamente: a doença de base (clínica ou cirúrgica (p=0,01, a permanência em uma clínica durante a internação(p=0,02 e a duração (em dias da cateterização (p= 0,00003 Na análise multivariada, somente a duração da sondagem vesical foi preditiva para ITU (p = 0,03. CONCLUSÕES: A incidência de ITU relacionada a SVD na amostra analisada foi de 11,0%, porque no HU da UFSC existe um controle dos fatores de risco alteráveis. A duração da sondagem vesical é um importante fator de risco para este problema. Recomenda-se limitar ao mínimo necessário o tempo de cateterização em pacientes internados.

  5. Pacientes assintomáticos apresentam infecção relacionada ao cateter venoso utilizado para terapia nutricional parenteral Asymptomatic patients present infection related to the central venous catheter used for total parenteral nutrition

    Directory of Open Access Journals (Sweden)

    Juliana Deh Carvalho Machado

    2009-12-01

    Full Text Available OBJETIVO: Avaliar a freqüência de infecção relacionada ao cateter venoso central em pacientes submetidos a terapia nutricional parenteral. MÉTODOS: Foram analisados os cateteres venosos centrais de pacientes em terapia nutricional parenteral que tiveram a indicação de retirada do cateter venoso central por infecção, alta hospitalar, ou trombose. Os pacientes com infecção foram denominados de Grupo 1 e os demais de Grupo 2. RESULTADOS: Não houve diferença estatisticamente significante quanto ao estado nutricional dos 18 pacientes analisados. Foram analisados 28 cateteres e destes 68% estavam infectados, sendo 72% do Grupo 1 e 28% do Grupo 2 (assintomáticos. No Grupo 1, houve infecção sistêmica em 70% dos casos, já no Grupo 2 a hemocultura foi positiva em 17% dos casos. A colonização por Staphylococcus sp. ocorreu em 48% dos casos, seguida de Candida sp. (21%, Enterococcus faecalis (16%, Pseudomonas aerurginosa (10% e Proteus sp.(5%. CONCLUSÃO: A contaminação de cateter venoso central utilizado para terapia nutricional parenteral é freqüente. Mesmo pacientes assintomáticos recebendo nutrição parenteral têm uma incidência maior de infecção por Candida sp. Portanto é necessária a criação de barreiras que impeçam a colonização destes cateteres venosos centrais, a fim de diminuir a morbimortalidade de pacientes dependentes deste tipo de terapia.OBJECTIVE: The aim of this study was to evaluate the frequency of central venous catheter-related infections in hospitalized patients receiving total parenteral nutrition. METHODS: Central venous catheters were analyzed immediately after removal due to infection, hospital discharge or thrombosis. The patients with catheter-related infection were named Group 1 and the other patients were named Group 2. RESULTS: Eighteen patients were studied. There was no statistically significant difference in nutritional status between the two groups. A total of 28 catheters were analyzed

  6. Violência relacionada ao trabalho: uma proposta conceitual

    OpenAIRE

    Oliveira,Roberval Passos de; Nunes,Mônica de Oliveira

    2008-01-01

    p. 22-34 O aumento de situações de violência no âmbito do trabalho vem se constituindo um importante problema de Saúde Pública, que tem impacto na dignidade e na qualidade de vida dos trabalhadores. Nessa perspectiva, este artigo tem como objetivo propor, a partir da discussão do fenômeno da violência e de sua faceta concernente ao trabalho, o conceito de violência relacionada ao trabalho, como referência para futuros estudos no campo da Saúde do Trabalhador. Trata-se de um artigo conceitu...

  7. Atitudes dos profissionais de enfermagem relacionadas ao Processo de Enfermagem

    Directory of Open Access Journals (Sweden)

    Erika de Souza Guedes

    2012-10-01

    Full Text Available Os objetivos do estudo foram descrever a disposição sobre o Processo de Enfermagem (PE e a percepção de poder clínico dos profissionais de enfermagem; analisar associações entre atitudes relacionadas ao PE e variáveis selecionadas. Participaram 1.605 auxiliares de enfermagem e enfermeiros (86,9% mulheres, idade média 44,12 anos; DP=9,55. O escore médio no instrumento Posições sobre o Processo de Enfermagem (PPE foi 112,37 (DP=22,28 e no Power as Knowing Participation in Change Tool - versão brasileira (PKPCT foi 281,12 (DP= 38,72. Os escores nos instrumentos foram mais altos para enfermeiros quando comparados aos auxiliares. Houve correlação positiva moderada entre escores do PPE e PKPCT. Para os auxiliares houve associação entre os escores no PPE, sexo e pós-graduação; e entre percepção de poder e sexo. Para os enfermeiros houve associação entre PKPCT e cargo de chefia. Mais estudos devem ser desenvolvidos com vistas a identificar variáveis potencialmente associadas ao uso do Processo de Enfermagem na prática clínica.

  8. Comparison between qualitative and semiquantitative catheter-tip cultures: laboratory diagnosis of catheter-related infection in newborns Comparação entre culturas qualitativa e semiquantitativa de ponta de cateter: diagnóstico laboratorial de infecção relacionada a cateter em recém-nascidos

    Directory of Open Access Journals (Sweden)

    Camila Marconi

    2008-06-01

    Full Text Available This prospective study evaluated semiquantitative and qualitative catheter-culture methods for diagnosis of catheter-related infection (CRI in newborns. Catheter tips from newborns admitted to the Neonatal Unit of the University Hospital of the Botucatu Medical School, UNESP were included in the study. Catheter cultures were performed with both semiquantitative and qualitative techniques. For CRI diagnosis, microorganisms isolated from catheter cultures and from peripheral blood cultures were identified and submitted to agent susceptibility test. The gold standard was the certain CRI diagnosis when same microorganism (specie and profile of susceptibility to agents was isolated from both catheter tips and peripheral blood culture. A total of 85 catheters from 63 newborns were included in the study. The semiquantitative culture method, despite presenting lower sensitivity (90%, showed higher specificity (71% when compared to 100% of sensitivity and 60% of specificity in the qualitative method. The identification of the microorganisms obtained from the catheter cultures showed a prevalence of coagulase-negative staphylococci(CNS species. The specie Staphylococcus epidermidis (77.5% was the prevalent in the catheters with positive semiquantitative cultures. Among 11 episodes with CRI diagnosis, 8 (72.7% were associated with CNS species, of which 6 were S. epidermidis. Two episodes of CRI by S. aureus and one by Candida parapsilosis were also detected. The semiquantitative catheter-culture method showed advantages for CRI diagnosis in newborns when compared to the conservative qualitative method.Este estudo prospectivo avaliou os métodos semiquantitativo e qualitativo de cultura de cateter para o diagnóstico de infecção relacionada a cateter (IRC em recém-nascidos (RN. Foram incluídas pontas de cateteres provenientes de recém-nascidos internados na Unidade Neonatal do Hospital das Clínicas da Faculdade de Medicina de Botucatu, UNESP. Foram

  9. Hipoventilação relacionada ao sono Sleep hypoventilation

    Directory of Open Access Journals (Sweden)

    Sonia Maria Guimarães Pereira Togeiro

    2010-06-01

    Full Text Available Tanto SHO como as doenças neuromusculares estão relacionadas à hipoventilação durante o sono. Define-se SHO como a combinação de obesidade, hipercapnia e hipoxemia crônica durante a vigília que se agrava durante o sono. Em 90% dos casos, SHO está associada à apneia obstrutiva do sono. O diagnóstico baseia-se na presença de hipoventilação diurna e hipertensão pulmonar que não são justificadas por alterações da função pulmonar. A mortalidade dos pacientes com SHO é maior que aquela de pacientes sem hipoventilação e controlados para obesidade. As doenças neuromusculares são representadas principalmente pelas distrofias musculares. A progressão para insuficiência respiratória crônica surge como consequência da fraqueza dos músculos respiratórios e da limpeza inadequada das vias aéreas, causando atelectasias e pneumonias. Quando há uma redução maior que 50% da forca muscular respiratória, ocorre uma diminuição na CV. A medida do pico de fluxo da tosse Sleep hypoventilation is seen in patients with neuromuscular disease, as well as in those with obesity hypoventilation syndrome (OHS, which is defined as the combination of obesity, chronic hypercapnia, and hypoxemia during wakefulness that is aggravated during sleep. In 90% of cases, OHS is accompanied by obstructive sleep apnea. The diagnosis of OHS is based on hypoventilation and pulmonary hypertension that cannot be explained by alterations in pulmonary function. The mortality of patients with OHS is greater than is that of obese patients without hypoventilation. The principal neuromuscular diseases associated with OHS are the muscular dystrophies. The progression to chronic respiratory failure results from respiratory muscle weakness and impaired airway secretion clearance, causing atelectasis and pneumonia. With a decrease of greater than 50% in respiratory muscle strength, there is a reduction in VC. Cough peak flow < 160 L/min is associated with impaired

  10. Causas de remocao nao eletiva do cateter epicutaneo em neonatos

    Directory of Open Access Journals (Sweden)

    Eny Dorea Paiva

    2013-12-01

    Full Text Available Objetivou-se descrever a incidência e as razões de remoção não eletiva do cateter epicutâneo em neonatos, verificando a associação com o sítio de inserção. Estudo de coorte prospectivo realizado em unidade de cuidado intensivo neonatal de um hospital privado terciário na cidade de São Paulo. Foram analisadas 266 inserções de cateter epicutâneo. A incidência de remoção não eletiva foi 39,1%. As complicações pós-inserção mais frequentes foram suspeita de infecção de corrente sanguínea relacionada ao cateter (25% e ruptura (23,1%. A maioria dos cateteres foi inserida através do hemisfério corporal direito (65%, membros superiores (77,1% e veias axilares (31,2%. Os resultados sugerem não haver associação entre a incidência de remoção não eletiva e o sítio de inserção do cateter epicutâneo em neonatos. Compete à Enfermagem implementar estratégias para a melhoria da prática assistencial a fim de diminuir a frequência de remoções não eletivas do cateter epicutâneo em neonatos.

  11. Mortalidade por causas relacionadas ao aborto no Brasil: declínio e desigualdades espaciais

    Directory of Open Access Journals (Sweden)

    Lima Bruno Gil de Carvalho

    2000-01-01

    Full Text Available Além de constituir causa freqüente de internamentos obstétricos em países pobres, o aborto representa a incapacidade do sistema público de saúde de prover informação suficiente sobre métodos contraceptivos para prevenir gestações em vez de interrompê-las. No Brasil, as altas taxas de utilização de serviços de saúde por abortamentos refletem as dificuldades persistentes de contracepção e planejamento familiar. Além disso, a mortalidade por aborto serve como indicador da qualidade dos procedimentos abortivos, um ponto importante num país onde tal prática é ilegal e, portanto, clandestinamente realizada. No presente estudo, analisamos as taxas de mortalidade por causas relacionadas ao aborto entre mulheres de 10 a 54 anos de idade, incluindo aquelas que morreram por abortamentos espontâneos e provocados, de 1980 a 1995, segundo região de residência. As informações utilizadas foram obtidas do banco de dados sobre mortalidade do Sistema Único de Saúde --Ministério da Saúde. Dados sobre população foram obtidos junto à Fundação Instituto Brasileiro de Geografia e Estatística. Estudaram-se 2 602 óbitos. Do total de óbitos, 15% foram devidos a aborto retido, aborto espontâneo e aborto induzido com indicação legalmente admitida. Oitenta e cinco por cento dos óbitos foram causados por aborto induzido sem indicação legalmente admitida e por aborto sem causa especificada. Os coeficientes de mortalidade por causas relacionadas ao aborto têm decrescido continuamente no Brasil, mas tais avanços têm-se distribuído desigualmente no país. A região que apresentou a menor queda na taxa (38% em 15 anos foi o Nordeste. As mulheres que morreram por aborto tiveram uma média de idade decrescente no período estudado.

  12. Mortalidade por causas relacionadas ao aborto no Brasil: declínio e desigualdades espaciais

    Directory of Open Access Journals (Sweden)

    Bruno Gil de Carvalho Lima

    2000-03-01

    Full Text Available Além de constituir causa freqüente de internamentos obstétricos em países pobres, o aborto representa a incapacidade do sistema público de saúde de prover informação suficiente sobre métodos contraceptivos para prevenir gestações em vez de interrompê-las. No Brasil, as altas taxas de utilização de serviços de saúde por abortamentos refletem as dificuldades persistentes de contracepção e planejamento familiar. Além disso, a mortalidade por aborto serve como indicador da qualidade dos procedimentos abortivos, um ponto importante num país onde tal prática é ilegal e, portanto, clandestinamente realizada. No presente estudo, analisamos as taxas de mortalidade por causas relacionadas ao aborto entre mulheres de 10 a 54 anos de idade, incluindo aquelas que morreram por abortamentos espontâneos e provocados, de 1980 a 1995, segundo região de residência. As informações utilizadas foram obtidas do banco de dados sobre mortalidade do Sistema Único de Saúde --Ministério da Saúde. Dados sobre população foram obtidos junto à Fundação Instituto Brasileiro de Geografia e Estatística. Estudaram-se 2 602 óbitos. Do total de óbitos, 15% foram devidos a aborto retido, aborto espontâneo e aborto induzido com indicação legalmente admitida. Oitenta e cinco por cento dos óbitos foram causados por aborto induzido sem indicação legalmente admitida e por aborto sem causa especificada. Os coeficientes de mortalidade por causas relacionadas ao aborto têm decrescido continuamente no Brasil, mas tais avanços têm-se distribuído desigualmente no país. A região que apresentou a menor queda na taxa (38% em 15 anos foi o Nordeste. As mulheres que morreram por aborto tiveram uma média de idade decrescente no período estudado.

  13. Atividade fisica de idosos relacionada ao transporte e lazer, Maceio, Brasil

    Directory of Open Access Journals (Sweden)

    Ana Raquel de Carvalho Mourao

    2013-12-01

    Full Text Available OBJETIVO : Analisar o nível de atividade física de idosos nos domínios do transporte e lazer e fatores associados. MÉTODOS : Estudo transversal com amostra populacional de 319 idosos em Maceió, AL, em 2009. O nível de atividade física relacionada ao transporte e ao lazer foi mensurado com aplicação do Questionário Internacional de Atividade Física, versão longa. As variáveis analisadas foram: idade, escolaridade, sexo, renda per capita e saúde percebida. Foram utilizadas análise descritiva e de regressão múltipla da razão de prevalência e teste de Fisher. RESULTADOS : Foram classificados insuficientemente ativos no transporte 87,5%, significativamente maior entre idosos com idades mais avançadas, com maior escolaridade e que se consideram insatisfeitos com a saúde física comparada. A prevalência dos idosos insuficientemente ativos no lazer foi de 76,2%, mais frequente nas mulheres, nos homens com idade avançada, nos idosos com menor renda per capita, nos que relataram estarem insatisfeitos com a saúde física comparada e a autopercepção da saúde mental. CONCLUSÕES : A prevalência de insuficientemente ativos foi elevada nos domínios transporte e lazer. Os fatores idade, sexo e renda devem ser considerados particularmente no lazer, a fim de garantir equidade no desenvolvimento de políticas de promoção da saúde e atividade física nessa população.

  14. Circuitos online de comunicação relacionada ao consumo

    Directory of Open Access Journals (Sweden)

    Ernani Coelho Neto

    2008-09-01

    Full Text Available O artigo discute o papel da internet na circulação de informações sobre produtos e serviços e apresenta a noção de circuitos online de comunicação relacionada ao consumo. A análise destaca a ampliação da interação entre consumidores através da internet como um fenômeno da comunicação contemporânea e suas implicações sobre o processo de construção da experiência de consumo. Palavras-chave: Comunicação; consumo; internet; interação entre consumidores. ABSTRACT The article argues the role of the Internet in the circulation of informations on products and services and presents the notion of circuits online of communication related to the consumption. The analysis detaches the magnifying of the interaction between consumers through the Internet as a phenomenon of the contemporary communication and its implications on the process of construction of the consumption experience. Keywords: Communication; consumption; internet; consumer interactions.

  15. Motivo de retirada do cateter de Hickman em pacientes submetidos ao transplante de células-tronco hematopoéticas Rationale for Hickman catheter removal in patients undergoing hematopoietic stem cell transplantation

    Directory of Open Access Journals (Sweden)

    Lais Carvalho Castanho

    2011-01-01

    Full Text Available OBJETIVO: Identificar os motivos da retirada do primeiro cateter de Hickman implantado em pacientes submetidos ao transplante de células-tronco hematopoéticas alogênico, os micro-organismos envolvidos na ocorrência de infecção e o tempo de permanência do cateter in situ. MÉTODOS: Estudo transversal retrospectivo. A amostra foi constituída por 57 prontuários de pacientes transplantados. Para a obtenção dos dados, elaborou-se um instrumento contendo variáveis relativas à identificação do paciente, tempo de permanência do cateter, motivo de retirada e micro-organismo isolado. RESULTADOS: Dentre os motivos de retirada do cateter, destacou-se como o mais frequente a infecção (49%. O Stenotrophomonas maltophilia (25% foi o micro-organismo identificado com maior frequência. CONCLUSÕES: Diante da elevada incidência de complicações infecciosas que levam à retirada do cateter de Hickman, faz-se necessária uma padronização de cuidados relacionados a esse cateter, tanto para a equipe de saúde como ao paciente e seu cuidador.OBJETIVO: Identificar los motivos del retiro del primer catéter de Hickman implantado en pacientes sometidos al transplante de células-tronco hematopoéticas alogénico, los microorganismos involucrados en la ocurrencia de infección y el tiempo de permanencia del catéter in situ. MÉTODOS: Estudio transversal retrospectivo. La muestra estuvo constituída por 57 historias clínicas de pacientes transplantados. Para la obtención de los datos, se elaboró un instrumento conteniendo variables relativas a la identificación del paciente, tiempo de permanencia del catéter, motivo del retiro y microorganismo aislado. RESULTADOS: Entre los motivos del retiro del catéter, se destacó como el más frecuente la infección (49%. El Stenotrophomonas maltophilia (25% fue el microorganismo identificado con mayor frecuencia. CONCLUSIONES: Frente a la elevada incidencia de complicaciones infecciosas que llevan al

  16. Análise das complicações hospitalares relacionadas ao cateterismo cardíaco

    OpenAIRE

    Rossato,Géderson; de Quadros, Alexandre Schaan; Sarmento-Leite, Rogério; Gottschall, Carlos Antonio M.

    2007-01-01

    INTRODUÇÃO: As complicações relacionadas ao cateterismo cardíaco são os principais limitantes desta técnica, e podem variar desde eventos adversos leves e transitórios até eventos graves, como infarto do miocárdio ou morte. OBJETIVO: Avaliar a incidência de complicações imediatas do cateterismo cardíaco diagnóstico em adultos, conforme um modelo de categorização das complicações em tipo e gravidade. MÉTODO: Estudo de coorte prospectivo em um centro de referência. As características dos pacien...

  17. Proteinorraquia total: variações relacionadas ao sexo e à idade

    Directory of Open Access Journals (Sweden)

    A. Spina-França

    1963-03-01

    Full Text Available Foi estudada a proteinorraquia total de 1.011 pacientes com LCR normal para investigar a influência da idade e do sexo. O método empregado para a determinação da concentração protêica foi o turbidimétrico do ácido tricloracético. A influência do fator etário foi estudada entre 3 meses e 70 anos de idade. Os resultados permitiram verificar que a concentração protêica do LCR é maior entre 3 e 6 meses de idade. Entre 1 e 40 anos de idade os valores médios são próximos entre si, situando ao redor de 16 e 18 mg por 100 ml. A partir de 40 anos de idade verifica-se tendência para ser progressivamente maior a proteinorraquia total. Essa tendência se acentua com o avançar da idade. Em relação ao sexo, foi verificado que a proteinorraquia total tende a ser maior no homem do que na mulher. A diferença entre as médias encontradas para os homens e mulheres foi estatisticamente significante. Êsses dados confirmam observações anteriores, caracterizando-os em relação ao método empregado para a determinação da concentração protêica do LCR.

  18. Adesão e dificuldades relacionadas ao tratamento medicamentoso em pacientes com depressão

    Directory of Open Access Journals (Sweden)

    Grazielle Ibanez

    2014-07-01

    Full Text Available Esta pesquisa verificou a adesão e conhecimento de pessoas com depressão quanto à farmacoterapia prescrita, a satisfação com a equipe de saúde e as dificuldades relacionadas ao tratamento medicamentoso. Trata-se de estudo transversal, descritivo, com abordagem quali-quantitativa. Participaram do estudo 27 pessoas atendidas em um serviço ambulatorial do interior de São Paulo - Brasil. Os dados foram coletados por entrevistas semiestruturadas e revisão de prontuários e analisados por estatística descritiva e análise de conteúdo. Constatou-se que 29,6% dos pacientes não aderiam aos medicamentos e que 51,9% desconheciam a dose dos medicamentos prescritos. Como dificuldades para o seguimento da terapêutica medicamentosa, foram apontados o impacto dos sintomas depressivos sobre o autocuidado, a insatisfação com efeitos dos psicofármacos, a carência de apoio, a polifarmacoterapia e a falta de conhecimento sobre o transtorno e tratamento. Este estudo aponta fatores críticos para a promoção da segurança do paciente no seguimento da terapêutica medicamentosa.

  19. MONITORAMENTO DAS PUBLICAÇÕES RELACIONADAS AO CAMARÃO SETE BARBAS Xiphopenaeus kroyeri (Heller, 1862

    Directory of Open Access Journals (Sweden)

    Danilo Francisco Corrêa Lopes

    2013-03-01

    Full Text Available Integrante da ordem Decapoda (Latreille, 1802 subordem Dendrobranchiata (Bate, 1888 e família Penaeidae (Rafinesque, 1815 o camarão sete barbas, Xiphopenaeus kroyeri (Heller, 1862, se distribui no Oceano Pacífico Oriental, desde a cidade de Sinaloa no México até a cidade de Paita no Peru e, no Atlântico Ocidental, desde a Virgínia (Estados Unidos até o Rio Grande do Sul, Brasil. Diversos pesquisadores brasileiros e de outros países vem desenvolvendo trabalhos a respeito da dinâmica populacional, biologia reprodutiva, caracterização da pesca, distribuição espaço-temporal, morfometria, proporção sexual, genética e outras demais áreas de interesse desta espécie.  Monitorar toda produção literária voltada ao Xiphopenaeus kroyeri (Heller, 1862 presente no banco de publicações inseridos no site dos periódicos da CAPES e nas bases do Scopus e da Scientific Electronic Library Online (Scielo, a fim de contabilizar o número de publicações, os principais países que desenvolvem trabalhos, os idiomas, as principais revistas utilizadas pelos autores que desenvolvem pesquisas relacionadas a esta espécie. Espera-se que o desenvolvimento deste trabalho se torne um novo incentivo para os pesquisadores brasileiros, para desenvolver novos estudos direcionados ao camarão sete barbas Xiphopenaeus kroyeri (Heller, 1862.

  20. Quebra de cateter no espaço peridural

    OpenAIRE

    Cristian Sbardelotto; Mauro Matsumoto Yoshimi; Raquel da Rocha Pereira; Renato Almeida Couto de Castro

    2008-01-01

    JUSTIFICATIVA E OBJETIVOS: A quebra do cateter peridural durante sua remoção é rara, porém descrita. O conhecimento das possíveis complicações e o manuseio adequado são responsabilidades do anestesiologista. O objetivo deste relato foi apresentar caso de quebra de cateter peridural em analgesia de parto. RELATO DO CASO: Paciente do sexo feminino, 33 anos, GII, PI, deu entrada na maternidade em trabalho de parto. Após duas horas de evolução, a paciente solicitou analgesia. Ao exame, encontrava...

  1. O emprego do cateter duplo J diminui as complicações na ureterolitotomia retroperitoneoscópica

    Directory of Open Access Journals (Sweden)

    Alexandre Cavalheiro Cavalli

    Full Text Available OBJETIVO: Avaliar os resultados da ureterolitotomia retroperitoneoscópica no tratamento do cálculo ureteral e a necessidade do cateter duplo J para reduzir complicações relacionadas ao procedimento. MÉTODOS: Estudo retrospectivo comparativo de 47 pacientes operados pela técnica de ureterolitotomia retroperitoneoscópica, dos quais 31 foram selecionados e divididos em dois grupos: Grupo 1, cujos pacientes não receberam cateter duplo J, e Grupo 2, que foram submetidos ao implante de cateter duplo J transoperatório. Foram coletados dados de urografia excretora pré e pós-operatória, tempo cirúrgico, analgesia pós-operatória, tempo de internação e retirada do dreno. RESULTADOS: Os grupos foram semelhantes quando comparados na idade e sexo, grau de dilatação do trato urinário, posição e tamanho médio do cálculo (Grupo 1= 15,5 ± 6,6mm; Grupo 2= 16,3 ± 6,1mm. O tempo operatório também não teve diferença significativa (Grupo 1= 130 ± 40,3min; Grupo 2= 136,3 ± 49,3min. O Grupo 1 apresentou seis pacientes (37,5 % com complicações precoces (quatro casos de fístula urinária e tardias (um caso de estenose de ureter, um caso de exclusão funcional do rim operado, enquanto o Grupo 2 não teve complicações, sendo esta diferença estatisticamente significativa (p=0,011. CONCLUSÃO: O emprego do cateter duplo J foi associado a um número significativamente menor de complicações na ureterolitotomia retroperitoneoscópica. Tempo cirúrgico, analgesia pós-operatória e tempo de internação foram semelhantes entre os grupos com e sem cateter.

  2. Diferença de tempo de positividade: método útil no diagnóstico de infecção de corrente sanguínea relacionada com cateter? Differential time to positivity: a useful tool for the diagnosis of catheter-related infections?

    Directory of Open Access Journals (Sweden)

    Karoline de Lemes Giuntini Corrêa

    2012-06-01

    Full Text Available INTRODUÇÃO: As infecções de corrente sanguínea relacionadas com cateter (ICSRCs apresentam impacto significativo na morbidade e na mortalidade de pacientes internados, além de elevar custos hospitalares. A utilização de equipamentos automatizados no processamento de hemoculturas gerou uma alternativa para diagnóstico de ICSRC por meio da análise da diferença de tempo de positividade (DTP entre hemoculturas pareadas (coletadas simultaneamente de sangue periférico e sangue de cateter. Um diagnóstico acurado e rápido dessas infecções pode otimizar as condutas clínicas e terapêuticas, poupando a retirada precoce dos cateteres. OBJETIVOS: Avaliar na rotina a DTP como ferramenta auxiliar no diagnóstico de ICSRC e determinar os principais microrganismos isolados. MÉTODOS: Foram avaliadas retrospectivamente hemoculturas coletadas no complexo do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo (HC/FMUSP de maio a agosto de 2008. Somente amostras que apresentaram DTP maior que 120 minutos foram consideradas possíveis ICSRCs pelo critério laboratorial. RESULTADOS: A seção processou 11.017 hemoculturas aeróbias durante o período de estudo; somente 5% foram coletadas de forma pareada. Destas, 148 (28% foram positivas, sendo 9% com crescimento somente em sangue periférico, 41% somente em sangue de cateter e 50% em ambas as amostras com 88% de homologia de microrganismos identificados. A DTP apresentou valores acima de 120 minutos em 50% dos casos e os microrganismos mais isolados foram Staphylococcus aureus (22%, Candida spp. (18%, Klebsiella spp. (7% e Enterobacter spp. (7%. CONCLUSÃO: A determinação da DTP como ferramenta auxiliar no diagnóstico de ICSRC é viável e fácil de ser executada em laboratórios de rotina com automação, porém o processo de coleta das amostras pareadas deve ser rigidamente padronizado.INTRODUCTION: Not only do catheter related bloodstream infections (CRBSIs have

  3. Fadiga relacionada ao câncer: uma revisão Cancer-related fatigue: a review

    Directory of Open Access Journals (Sweden)

    Maira Paschoin de Oliveira Campos

    2011-04-01

    Full Text Available A fadiga relacionada ao câncer (FRC é um dos sintomas mais prevalentes em pacientes com câncer, sendo reportada por 50% a 90% dos pacientes durante o curso da doença ou do seu tratamento, impactando na qualidade de vida de forma severa além de diminuir a capacidade funcional diária dos pacientes. Uma abordagem ampla deve ser realizada com orientações gerais sobre fadiga, além da determinação de um plano individualizado de abordagem terapêutica. Pacientes com fadiga moderada ou severa devem se beneficiar de ambas as medidas farmacológicas e não farmacológicas a serem adotadas, enquanto pacientes que apresentem fadiga leve que não interfira na qualidade de vida podem ser tratados com medidas não farmacológicas como única medida terapêutica. O tratamento não farmacológico se mostra promissor com o uso de terapias cognitivas-comportamentais (conservação de energia e organização de atividades diárias realizadas, ECAM, exercícios físicos e talvez terapias do sono. O tratamento farmacológico tem mostrado resultados promissores que incluem o uso de psicoestimulantes tais como metilfenidato e dexmetilfenidato, modanafil (em pacientes com fadiga severa e agentes estimuladores de eritropoietina em pacientes com anemia associada à quimioterapia e hemoglobina menor que 10 mg/dL. Além dessas drogas, o uso de Guaraná (Paullinia cupana tem-se mostrado uma opção promissora, com efeitos benéficos no tratamento da fadiga física e mental relacionada ao câncer. Por ser uma opção sem efeitos colaterais significantes e uma planta nacional, torna-se atrativo considerando o fácil acesso a esta medicação por seu baixo custo e fácil adesão ao tratamento. O tratamento pode ser oferecido através de uma abordagem multimodal e multidisciplinar que individualize as opções terapêuticas dentro de um contexto que promova o diagnóstico acurado da FRC, além de um tratamento específico e adequado para cada paciente que apresente

  4. Diagnóstico da tuberculose em pessoas idosas: barreiras de acesso relacionadas aos serviços de saúde

    Directory of Open Access Journals (Sweden)

    Annelissa Andrade Virgínio de Oliveira

    Full Text Available Este estudo tem como objetivo analisar as barreiras ao diagnóstico da tuberculose em idosos relacionadas aos serviços de saúde no município de João Pessoa-PB. Trata-se de pesquisa qualitativa que envolveu sete pessoas idosas doentes de tuberculose. Entrevistas foram utilizadas para coletar informações. O material empírico foi organizado com o software Atlas.tiversão 6.0 e analisado conforme a técnica de análise de discurso. As barreiras relacionadas ao acesso para confirmação diagnóstica foram: horário de funcionamento das unidades de saúde da família; transferência de responsabilidades; visitas domiciliares sem controle de comunicantes; demora do serviço de saúde em suspeitar da doença e repetidas idas do doente ao serviço de saúde para a obtenção do diagnóstico. Apesar de terem sido identificadas barreiras comuns às encontradas por doentes de tuberculose de um modo geral, em virtude da vulnerabilidade dos idosos, sugerem-se que ações de controle sejam empreendidas pelos serviços de saúde de modo a evitar que a doença torne-se um agravo comum para essa população.

  5. Fístula broncovascular: complicação de cateter venoso central percutâneo em neonato

    Directory of Open Access Journals (Sweden)

    D'Elia Cláudio

    2002-01-01

    Full Text Available Objetivos: relatar um caso em que ocorreu falso trajeto de cateter venoso central, com fístula vásculo-pulmonar e graves conseqüências respiratórias correlatas em recém-nascido. Revisar a literatura sobre as complicações respiratórias e não respiratórias relacionadas à introdução de cateteres venosos centrais percutâneos em crianças. Descrição: dados clínicos evolutivos e diagnósticos foram obtidos após revisão do prontuário. O recém-nascido prematuro permaneceu em UTI neonatal após o parto para tratamento de doença da membrana hialina leve e de infecção manifestada posteriormente. No dia seguinte à introdução percutânea do cateter central, para a administração de nutrição parenteral, iniciou desconforto respiratório que progrediu rapidamente. Necessitou de ventilação mecânica para estabelecer troca gasosa adequada. A verificação da trajetória do cateter com o auxílio de contraste radiológico revelou a presença da complicação. Comentários: não são raras as complicações decorrentes da inserção de cateteres centrais, sendo a infecção a mais comum. É importante que os profissionais responsáveis pelos cuidados desses pacientes conheçam as várias outras complicações menos freqüentes, como a trombose vascular e a migração do cateter, com lesões de órgãos e coleções extravasculares de líquidos. Em recém-nascidos, existe apenas um único relato de complicação semelhante à verificada em nosso paciente. Sua raridade pode ter determinado dificuldades para o diagnóstico imediato. São enfatizados os aspectos relacionados aos cuidados, após a introdução destes cateteres, que poderiam facilitar o reconhecimento precoce destas complicações.

  6. Comparação entre citrato trissódico e heparina como solução para selo de cateter em pacientes em hemodiálise

    Directory of Open Access Journals (Sweden)

    José Luís Bevilacqua

    2011-03-01

    Full Text Available INTRODUÇÃO: A elevada incidência de pacientes iniciando ou sendo mantidos em tratamento dialítico através de cateteres venosos tem aumentado o número de infecções da corrente sanguínea relacionadas aos cateteres e suas consequências, obrigando a busca de substâncias que tenham propriedades anticoagulantes e que também impeçam a contaminação dos mesmos. OBJETIVOS: Comparar a utilização de heparina e citrato trissódico como selo de cateteres de longa permanência quanto à ocorrência de pirogenia, bacteremia, internações hospitalares relacionadas à infecção, trombose e óbito. MÉTODOS: Estudo retrospectivo por meio de dados do registro de infecção do Programa de Controle e Prevenção de Infecções e Eventos Adversos, onde foram incluídos todos os pacientes que entre abril de 2006 e março de 2008 utilizaram cateteres de longa permanência. Nos primeiros 365 dias, o selo do cateter foi feito com heparina (Grupo Heparina e nos 365 dias seguintes foi feito com citrato trissódico a 46,7% (Grupo Citrato. Sessenta e cinco pacientes fizeram parte do estudo utilizando noventa e dois cateteres. Os grupos foram comparados para ocorrência de pirogenia, bacteremia, hospitalização, trombose de cateter e óbito. RESULTADOS: A ocorrência de bacteremia relacionada ao cateter e o tempo de hospitalização foram significantemente menores no Grupo Citrato. Houve uma tendência a menor ocorrência de hospitalização relacionada à infecção de acesso no Grupo Citrato (p = 0.055, e não houve diferença quanto à trombose de cateteres levando a disfunção. O tempo livre de bacteremia e de hospitalização foram maiores no Grupo Citrato. A ocorrência de bacteremia esteve associada a ser diabético e a pertencer ao Grupo Heparina. Na análise multivariada, apenas pertencer ao Grupo Heparina esteve associada à sua ocorrência. CONCLUSÃO: O uso de citrato a 46,7% reduziu de maneira efetiva episódios de bacteremia e interna

  7. Lesão liquenóide oral relacionada ao amálgama Amalgam-related oral lichenoid lesion

    OpenAIRE

    Vanessa de Fátima Bernardes; Bruna Gonçalves Garcia; Giovanna Ribeiro Souto; João Batista Novaes-Junior; Maria Cássia Ferreira de Aguiar; Ricardo Alves Mesquita

    2007-01-01

    A lesão liquenóide oral relacionada ao amálgama, condição rara na prática odontológica, constitui importante diagnóstico diferencial no grupo das leucoplasias orais. Relatam-se dois casos que apresentaram rápida resolução clínica após a substituição das restaurações de amálgama.Amalgam-related oral lichenoid lesion, a rare disorder in dental practice, is an important differential diagnosis among oral leukoplastic lesions. We report two cases with rapid clinical resolution following the replac...

  8. Queixas osteomusculares relacionadas ao trabalho relatadas por mulheres de centro de ressocialização Work-related musculoskeletal complaints by women in a social rehabilitation center

    Directory of Open Access Journals (Sweden)

    Eliane Cristina Pastre

    2007-11-01

    Full Text Available Considerando as queixas de origem laboral um problema de saúde pública, objetivou-se, com o presente estudo, analisar a freqüência da população que refere queixas osteomusculares e a associação de ocorrência e severidade destas às variáveis antropométricas e de trabalho. Tomou-se 146 mulheres de um centro de ressocialização feminino, que responderam a um questionário validado contendo informações sobre dados antropométricos e queixas osteomusculares relacionadas ao trabalho. O estudo da associação entre e dentro das variáveis foi feito pelo teste de Goodman. Observou-se elevada freqüência de ocorrência de queixas após início de atividade laboral (94,19%. As participantes com necessidade de afastamento apresentaram maiores valores em idade e peso. Queixa acentuada foi mais referida na coluna do tronco. Afastamento foi mais referido para as que trabalhavam há mais tempo. Concluiu-se que é alta a freqüência de queixas relacionadas ao trabalho e que há associação entre maiores valores de peso e de estatura e nível de severidade acentuado; maiores valores de idade e de peso e necessidade de afastamento; níveis acentuados de queixas e região da coluna e entre maior tempo de serviço e necessidade de afastamento.Considering work-related complaints as a public health problem, the current study aimed to analyze the frequency of musculoskeletal complaints and the association between their occurrence and severity and anthropometric and work variables. The sample included 146 women from a social rehabilitation center who answered a validated questionnaire with anthropometric data and history of work-related musculoskeletal complaints. The Goodman test was used to analyze the association between and within variables. We observed a high rate of complaints after beginning work activity (94.19%. Subjects that required sick leave showed higher mean age and weight. The most severe complaints related to back pain. Sick leave was

  9. Alterações pleurais e parenquimatosas relacionadas com a exposição ao asbesto: Ensaio pictórico

    Directory of Open Access Journals (Sweden)

    G.S.P. Meirelles

    2005-09-01

    Full Text Available Resumo: As alterações pleurais e pulmonares decorrentes da exposição ao asbesto podem ser benignas, como o derrame e as placas pleurais, ou malignas, como o carcinoma de pulmão e o mesotelioma pleural. O derrame pleural é a manifestação mais comum nos primeiros anos após a exposição e os aspectos de imagem são incaracterísticos. O espessamento pleural difuso compromete a pleura visceral, não sendo específico da exposição ao asbesto. As placas pleurais, espessamentos focais da pleura, são consideradas marcadores de exposição. A asbestose corresponde à fibrose do parênquima pulmonar pelo asbesto, predominando nos lobos inferiores, e a atelectasia redonda a um colapso pulmonar periférico, geralmente associado a alterações pleurais. O carcinoma pulmonar e o mesotelioma pleural são mais prevalentes em indivíduos expostos. O objectivo deste estudo é ilustrar as principais alterações de imagem das alterações relacionadas com o asbesto.Rev Port Pneumol 2005; XI (5: 477-485 Abstract: Pleural and pulmonary asbestos-related diseases range from benign conditions, like pleural effusion and pleural plaques, to some neoplasias, such as lung cancer and malignant mesothelioma. Pleural effusion is the earliest finding after asbestos exposure, but the imaging findings are not specific. Diffuse pleural thickening involves the visceral pleura and pleural plaques are considered to be hallmarks of exposure. Asbestosis is the pulmonary fibrosis due to asbestos. Rounded atelectasis is a peripheral lung collapse in these individuals, generally related to pleural disease. Some neoplasias, like lung carcinoma and pleural mesothelioma, are more prevalent in asbestos-exposed subjects. The aim of this essay is to illustrate the main imaging findings of asbestos-related diseases.Rev Port Pneumol 2005; XI (5: 477-485 Palavras-chave: Asbesto, pneumoconioses, doenças ocupacionais

  10. Perfil do paciente ostomizado e complicações relacionadas ao estoma Profile of the pacient with stoma and complications related to stoma

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Marques dos Santos

    2007-03-01

    Full Text Available OBJETIVO: elaborar o perfil dos pacientes ostomizados e as complicações relacionadas ao estoma. MATERIAL E MÉTODO: estudo retrospectivo em que foram analisados prontuários dos pacientes cadastrados no Programa de Ostomizados do Centro de Especialidades Médicas da Prefeitura Municipal de Campo Grande-MS. RESULTADOS: foram avaliados 178 prontuários (56.7% homens e 43.3% mulheres. A média de idade entre os pacientes foi de 46.8 anos para o sexo masculino e de 54.6 anos para os do sexo feminino. Dentre as ostomias, foram encontradas 152 colostomias (85.4%, 21 ileostomias (11.8% e 5 urostomias (2.8%. O principal motivo para confecção dos estomas foi a neoplasia maligna (46.6%, seguido do trauma abdominal (7.3%, e do desvio de trânsito intestinal devido a úlceras de pressão (6.7%. Adaptação inadequada da placa ao estoma foi encontrada em 90 pacientes (50.6%. Complicações do estoma foram encontradas em 103 pacientes (57.9%, dentre elas, dermatite peri-estomal (28.7%, estoma plano (18.6%, hérnia para-colostômica (10.7% e retração do estoma (10.1%. CONCLUSÕES: No grupo estudado, o principal motivo para a confecção de ostomia foi a neoplasia de retossigmóide e canal anal. A complicação mais comum foi a dermatite peri-estomal.OBJECTIVE: To elaborate the profile of the patients with permanent ostomies and the complications related to the stoma. MATERIAL AND METHODS: This is a retrospective study based on the database of the patients with permanent ostomies, registered in the 'Programa de Ostomizados do Centro de Especialidades Médicas' of the City Hall of Campo Grande, MS. RESULTS: It was evaluated 178 handbooks of these patients (56,7% men and 43,3% women. The average age was 46,8 years for the male group and 54.6 years for the female group. It was found 152 colostomies (85,4%, 21 ileostomies (11,8% and 5 urostomies (2,8%. The main indication for the stomas was the cancer (46,6%. The second indication was abdominal trauma (7

  11. Arteriografia coronária com cateter de muito baixo perfil. Eficácia e segurança do procedimento e da alta hospitalar aos 60 minutos

    Directory of Open Access Journals (Sweden)

    Berti Sergio

    1998-01-01

    Full Text Available OBJETIVO: Avaliar a eficiência, a segurança e a praticidade da angiografia coronária com cateteres 4 French (F, pela técnica de Judkins. MÉTODOS: De agosto/95 a janeiro/96, 70 pacientes com suspeita de insuficiência coronária submeteram-se à cinecoronariografia , utilizando introdutores e cateteres 4F. Após o exame, realizava-se compressão local por 15min e, 60min após, os pacientes eram orientados a caminhar, sob vigilância , sendo dada a alta hospitalar após 4h, . RESULTADOS: A idade variou de 31 a 83 (m = 57 anos, sendo 39 (56% homens, com peso entre 43 a 101 (m = 69 kg. Obteve-se ótima qualidade de imagem em 62 casos (88%, havendo a necessidade de substituição por cateteres de maior calibre (6 a 8F em 8 (12% pacientes. Não ocorreram complicações vasculares ou sangramentos maiores. Em apenas 2 (3% casos, houve discreto sangramento, resolvido com nova compressão local. Sessenta pacientes (85% deambularam aos 60±5min e tiveram alta hospitalar com 4h, em média. CONCLUSÃO: A utilização de cateteres 4F por via femoral, para realização de cinecoronariografia permite a deambulação muito precoce (média = 60±5min e sem complicações hemorrágicas. Verificaram-se pequena utilização de contraste (média = 60ml e redução da permanência hospitalar. Esta técnica torna o exame cinecoronariográfico mais simples, menos traumático e menos invasivo.

  12. Mortalidade relacionada ao tratamento endovascular do aneurisma da aorta abdominal com o uso dos modelos revisados Procedure-related mortality of endovascular abdominal aortic aneurysm repair using revised reporting standards

    Directory of Open Access Journals (Sweden)

    Gosen Gabriel Konig

    2007-03-01

    Full Text Available OBJETIVO: O objetivo do estudo foi avaliar a definição da mortalidade relacionada ao procedimento após tratamento endovascular do aneurisma de aorta abdominal (EVAR como definido pelo Committee for Standardized Reporting Practices in Vascular Surgery. MÉTODO: Dados de pacientes com aneurisma de aorta abdominal foram analisados do banco de dados EUROSTAR. Os pacientes foram submetidos ao EVAR entre junho de 1996 a fevereiro de 2004 e foram estudados retrospectivamente. A probabilidade explicita da causa de morte foi registrada. O intervalo entre a operação, alta hospitalar ou intervenção secundária até a morte foi registrado. RESULTADOS: De um total de 5612 pacientes, 589 (10,5% faleceram após o EVAR em acompanhamento total e qualquer causa de morte foi inclusa. Cento e quarenta e um pacientes (12,5% morreram devido a causa relacionada ao aneurisma, sendo que 28 (4,8% foram rupturas, 25 (4,2% infecções do implante e 88 (14,9% foram pacientes que morreram num prazo de 30 dias após o procedimento inicial (definição atualmente utilizada, também conhecido como resultado clínico a curto prazo. Além disso, 25 pacientes faleceram após 30 dias, mas continuavam ainda hospitalizados (ou transferidos a home-care para reavaliação posterior, ou necessitaram intervenção secundária. Levando em conta a duração da admissão ao hospital e a mortalidade imediata após o procedimento relacionada a intervenções secundárias, 49 mortes tardias também podem ser relacionadas ao EVAR. CONCLUSÃO: Morte tardia compõe uma proporção considerável da mortalidade relacionada ao EVAR dentro do tempo de análise revisado.OBJECTIVE: The aim of this study was to evaluate the definition of Procedure-related mortality after endovascular aneurysm repair (EVAR as defined by the Committee for Standardized Reporting Practices in Vascular Surgery. METHODS: Data on patients with an AAA were taken from the EUROSTAR database. The patients underwent EVAR

  13. Síndrome de Moebius relacionada ao uso do misoprostol (CYTOTEC®) como abortivo - doi:10.5020/18061230.2005.p140

    OpenAIRE

    Renata Cavalcante Barbosa; Marcelo Bezerra Nogueira; Célia Maria Giacheti

    2012-01-01

    A síndrome de Moebius constitui uma doença congênita caracterizada por paralisia dos nervos facial e abducente associada a malformações de membros. Além da etiologia genética, fatores causais de origem ambiental foram propostos devido ao aumento do número de casos da síndrome associados ao emprego de misoprostol durante a gravidez. O misoprostol é o princípio ativo do Cytotec®, uma droga utilizada para o tratamento da úlcera péptica que atua na contratilidade uterina quando empregada durante ...

  14. Fatores associados a infeccao pelo uso do cateter central de insercao periferica em Unidade de Terapia Intensiva Neonatal

    Directory of Open Access Journals (Sweden)

    Elysangela Dittz Duarte

    2013-06-01

    Full Text Available Estudo epidemiológico, longitudinal e analítico, desenvolvido em um hospital de Minas Gerais, com o objetivo de analisar os fatores associados à infecção pelo uso do cateter central de inserção periférica em recém-nascidos internados em unidade de terapia intensiva. A coleta dos dados foi realizada por meio de uma ficha estruturada, preenchida pelos profissionais e verificada pelos pesquisadores. Foram estudados 291 cateteres inseridos em 233 recém-nascidos. Os fatores associados à retirada por suspeita de infecção foram: prematuridade, peso ao nascer até 1.500 gramas, cateter de poliuretano, localização não centralizada do cateter e tempo de uso superior a 30 dias. Após ajuste multivariado, permaneceram independentemente associados: peso inferior a 2.500 gramas na inserção, reparo e tempo de uso do cateter. Conclui-se que fatores relacionados à prática dos profissionais contribuíram para a retirada dos cateteres, sinalizando para a necessidade de intervenções que melhorem a segurança e a eficácia em seu uso.

  15. Diagnóstico da tuberculose em pessoas idosas: barreiras de acesso relacionadas aos serviços de saúde El diagnóstico de la tuberculosis em las personas mayores: las barreras relacionadas con el acceso a los servicios de salud Tuberculosis diagnosis in the aged: barriers to accessing health services

    Directory of Open Access Journals (Sweden)

    Annelissa Andrade Virgínio de Oliveira

    2013-02-01

    Full Text Available Este estudo tem como objetivo analisar as barreiras ao diagnóstico da tuberculose em idosos relacionadas aos serviços de saúde no município de João Pessoa-PB. Trata-se de pesquisa qualitativa que envolveu sete pessoas idosas doentes de tuberculose. Entrevistas foram utilizadas para coletar informações. O material empírico foi organizado com o software Atlas.tiversão 6.0 e analisado conforme a técnica de análise de discurso. As barreiras relacionadas ao acesso para confirmação diagnóstica foram: horário de funcionamento das unidades de saúde da família; transferência de responsabilidades; visitas domiciliares sem controle de comunicantes; demora do serviço de saúde em suspeitar da doença e repetidas idas do doente ao serviço de saúde para a obtenção do diagnóstico. Apesar de terem sido identificadas barreiras comuns às encontradas por doentes de tuberculose de um modo geral, em virtude da vulnerabilidade dos idosos, sugerem-se que ações de controle sejam empreendidas pelos serviços de saúde de modo a evitar que a doença torne-se um agravo comum para essa população.Se objetiva analizar las barreras al diagnóstico de tuberculosis en ancianos relacionadas a servicios de salud en João Pessoa-Paraíba. Investigación cualitativa involucrando siete ancianos enfermos de tuberculosis. Informaciones recolectadas mediante entrevistas. El material empírico fue organizado con el software Atlas.ti 6.0 y sometido a técnica de análisis de discurso. Las barreras relacionadas al acceso para confirmación diagnóstica fueron: horario de funcionamiento de las unidades de salud de la familia; transferencia de responsabilidades; visitas domiciliarias sin control de comunicantes; demora del servicio sanitario en sospechar la enfermedad y repetidas visitas del enfermo al servicio de salud para obtener el diagnóstico. A pesar de haber sido identificados obstáculos similares a los encontrados por tuberculosos en general, en virtud

  16. Experiências de discriminação relacionadas aos serviços de saúde: análise exploratória em duas capitais do Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Alexandre Baumgarten

    Full Text Available OBJETIVO: descrever a prevalência de discriminação relacionada aos serviços de saúde, suas motivações e fatores associados. MÉTODOS: análise seccional realizada com bancos de dados oriundos de dois inquéritos realizados no município de Porto Alegre, Rio Grande do Sul, com usuários de serviços de saúde, e no município de Florianópolis, Santa Catarina, com amostra representativa de universitários, entre 2010 e 2012. RESULTADOS: a prevalência de discriminação relacionada aos serviços de saúde foi de 13,6% (IC95%: 10,5-17,2 em Porto Alegre-RS e de 7,4% (IC95%: 5,8-9,1 em Florianópolis-SC; o principal motivo para a discriminação foi ser de baixa posição socioeconômica; em ambas as capitais, observou-se maior prevalência de discriminação entre fumantes, autoclassificados pretos/negros e indivíduos de 31 a 40 anos de idade. CONCLUSÃO: a prevalência de discriminação foi relativamente baixa; reforça-se a necessidade de se investigar a discriminação no âmbito dos serviços de saúde, para a provisão de cuidados adequados à população.

  17. Resposta neuro-imuno-endocrinologica da pele relacionada ao fotoenvelhecimento : avaliação in vitro e clinica de um novo composto como alternativa terapeutica em dermatologia

    OpenAIRE

    Gustavo de Campos Dieamant

    2008-01-01

    Resumo: O envelhecimento cutâneo é resultado de dois processos independentes, clinica e biologicamente distintos, que afetam a pele simultaneamente. Ao primeiro, conhecido como "relógio biológico", damos o nome de envelhecimento intrínseco, o qual afeta a pele na mesma proporção em que órgãos internos são afetados, como por exemplo, a lenta e irreversível degeneração tecidual. O segundo, denominado fotoenvelhecimento, é resultado da exposição da pele a agentes agressores ambientais, primeiram...

  18. Síndrome de Moebius relacionada ao uso do misoprostol (CYTOTEC® como abortivo - doi:10.5020/18061230.2005.p140

    Directory of Open Access Journals (Sweden)

    Renata Cavalcante Barbosa

    2012-01-01

    Full Text Available A síndrome de Moebius constitui uma doença congênita caracterizada por paralisia dos nervos facial e abducente associada a malformações de membros. Além da etiologia genética, fatores causais de origem ambiental foram propostos devido ao aumento do número de casos da síndrome associados ao emprego de misoprostol durante a gravidez. O misoprostol é o princípio ativo do Cytotec®, uma droga utilizada para o tratamento da úlcera péptica que atua na contratilidade uterina quando empregada durante a gravidez. O objetivo deste estudo é identificar dentre os pacientes com a síndrome de Moebius aqueles cujas mães referiram tentativa de aborto pelo uso do misoprostol. Para tanto, foram entrevistadas quinze mães de crianças portadoras da síndrome de Moebius a respeito da tentativa de interrupção da gravidez e o meio empregado. Relato de tentativas de aborto foi mencionado por 66.7% das entrevistadas, realizadas em todos os casos por meio da utilização do medicamento Cytotec®, com predomínio da via conjugada de administração (via oral + via vaginal (70.0% e emprego de um a quatro comprimidos na maioria dos casos (90.0%. Tal prática foi realizada por 100.0% das mães (10/10 durante o primeiro trimestre gestacional, estando a maior parte delas (70.0% entre a quinta e a oitava semana de gestação. Nossos achados revelam a alta prevalência de emprego do medicamento Cytotec® em tentativas clandestinas de aborto entre as mães de indivíduos com a Síndrome de Moebius.

  19. Análise das patentes de tecnologias relacionadas aos probióticos, prebióticos e simbióticos no Brasil

    Directory of Open Access Journals (Sweden)

    Ferlando Lima Santos

    2014-09-01

    Full Text Available Este trabalho avaliou os documentos de patentes depositados no Brasil que fazem referência aos termos probióticos, prebióticos e simbióticos. Os dados foram selecionados nas bases de dados do Instituto Nacional de Propriedade Industrial e do European Patent Office. O ano de 2010 apresentou maior número de patentes depositadas. As indústrias de alimentos e farmacêuticas formam os setores de maior destaque, representando juntas 70% dos depósitos de patentes nesse ramo. Entre as patentes do setor alimentício, 77,55% dos depósitos foram efetuados por empresas, recebendo destaque a Nestlé S.A. A busca através dos termos relacionados revela que o Brasil tem um universo de 101 pedidos de proteção de patentes no Instituto Nacional de Propriedade Industrial e que desse total apenas 22,45% foram oriundos de depositantes do próprio país, implicando na necessidade de ampliar o incentivo à proteção das propriedades industriais para geração de novos produtos.

  20. Life quality of patients with migraine related to menstrual period undergoing auricular therapy Qualidade de vida de pacientes com migrânea relacionada ao período menstrual submetidos à terapia auricular

    Directory of Open Access Journals (Sweden)

    Vivian Viani Picanço

    2011-06-01

    Full Text Available Migraine is a chronic disease characterized by intermittent attacks of headache and associated symptoms. It is a disease that affects around 12 to 15% of the general population, most of them being women. The quality of life of these individuals is compromised, causing a major impact on physical, mental and social for those who suffer from migraine. One method of treatment that seems to be effective in relieving the symptoms of menstrual migraine is auricular therapy. The purpose of this study was to evaluate the quality of life of patients with migraine related to the menstrual period who underwent auricular therapy. To this end, sessions were held in patients previously selected and implemented the survey of quality of life SF-36 on three different occasions. Before the first session, sixty days after the start of treatment and a third evaluation, ninety days after the beginning of treatment. The results showed that from eight individuals, seven had a general improvement in their quality of life. It follows that the treatment with auricular therapy was effective for improving quality of life of women with migraine related to menstruation. A migrânea é uma doença crônica caracterizada por crises intermitentes de cefaléia e sintomas associados, e constitui uma afecção que acomete em torno de 12 a 15 % da população em geral, em sua maioria mulheres. A qualidade de vida desses indivíduos fica comprometida, gerando um grande impacto físico, mental e social para os migranosos. Um dos métodos de tratamento que se mostra eficaz para aliviar os sintomas da migrânea menstrual é a terapia auricular ou auriculoterapia. O objetivo dessa pesquisa foi avaliar a qualidade de vida de pacientes com migrânea relacionada ao período menstrual que foram submetidos à terapia auricular. Para tanto, foram realizadas sessões de auriculoterapia em pacientes previamente selecionados e aplicado o questionário de qualidade de vida SF-36, em três momentos

  1. Thrombotic obstruction of the central venous catheter in patients undergoing hematopoietic stem cell transplantation Obstrucción trombótica del catéter venoso central en pacientes sometidos al trasplante de células-tronco hematopoyéticas Obstrução trombótica do cateter venoso central em pacientes submetidos ao transplante de células-tronco hematopoéticas

    Directory of Open Access Journals (Sweden)

    Kátia Michelli Bertoldi Arone

    2012-08-01

    literatura, cujo objetivo foi sintetizar as medidas de prevenção e tratamento da obstrução trombótica no cateter venoso central de longa permanência e semi-implantado, em pacientes submetidos ao transplante de células-tronco hematopoéticas. A amostra foi constituída por sete estudos, sendo dois ensaios clínicos controlados randomizados, três estudos de coorte e duas séries de casos. Quanto às medidas de prevenção, um único estudo que se mostrou efetivo abordando pesquisa de coorte sobre o uso da varfarina oral. Em relação às medidas de tratamento, três estudos evidenciaram efetividade: um apontou a eficácia da estreptoquinase ou uroquinase, outro estudo mostrou benefício no uso de heparina de baixo peso molecular e outro tratou a obstrução com heparina ou uroquinase. Nota-se que a evolução da pesquisa referente à perviedade do cateter foi restrita, não acompanhando a evolução do transplante, principalmente no que tange aos cuidados de enfermagem.

  2. Atitudes de estudantes de enfermagem frente questões relacionadas ao álcool, alcoolismo e alcoolista Actitudes de estudiantes de enfermería frente a cuestiones relacionadas al álcool, alcoolismo e alcoolista Attitudes of nursing students facing questions related to alcohol, alcoholism and the alcoholic

    Directory of Open Access Journals (Sweden)

    Divane de Vargas

    2011-01-01

    Full Text Available OBJETIVO: Examinar as atitudes de uma amostra de estudantes de enfermagem frente ao álcool, alcoolismo e alcoolista. MÉTODOS: Estudo exploratório realizado com 144 estudantes do último ano de graduação em enfermagem de duas escolas do setor privado da cidade de Ribeirão Preto - SP. Para a coleta de dados, utilizou-se a Escala de atitudes frente álcool, alcoolismo e alcoolista. RESULTADOS: as atitudes frente ao alcoolista foram mais negativas do que aquelas que vêm sendo reportadas na literatura. A maioria dos participantes considerou o alcoolista culpado por seus problemas de saúde e preferiu não trabalhar com esse tipo de paciente. CONCLUSÃO: As atitudes dos estudantes frente às questões relacionadas ao álcool e alcoolismo tendem à ambivalência e à negatividade, o que pode ser atribuído à falta de preparo recebida durante a graduação. Apesar das recomendações feitas pelos especialistas no País pouco tem sido investido na formação do enfermeiro em álcool e outras drogas sobretudo nas escolas privadas.OBJETIVO: Examinar las actitudes de una muestra de estudiantes de enfermería frente al alcohol, alcoholismo y al alcohólico. MÉTODOS: Estudio exploratorio realizado con 144 estudiantes del último año del pregrado en enfermería de dos escuelas del sector privado de la ciudad de Ribeirão Preto - SP. Para la recolección de datos, se utilizó la Escala de Actitudes frente al alcohol, alcoholismo y alcohólico. RESULTADOS: las actitudes frente al alcoholismo fueron más negativas que aquellas que vienen siendo reportadas en la literatura. La mayoría de los participantes consideró al alcohólico culpable por sus problemas de salud y prefirió no trabajar con este tipo de paciente. CONCLUSIÓN: Las actitudes de los estudiantes frente a las cuestiones relacionadas al alcohol y alcoholismo tienden a la ambivalencia y a la negatividad, el que puede ser atribuído a la falta de preparación recibida durante el pregrado. A

  3. Bloodstream infections among patients using central venous catheters in intensive care units Infección de corriente sanguínea en pacientes con catéter venosos central en unidades de cuidado intensivo Infecções da corrente sangüínea em pacientes em uso de cateter venoso central em unidades de terapia intensiva

    Directory of Open Access Journals (Sweden)

    Eni Rosa Aires Borba Mesiano

    2007-06-01

    Full Text Available Central Venous Catheters (CVC, widely used in Intensive Care Units (ICU are important sources of bloodstream infections (BSI. This prospective cohort epidemiological analytical study, aimed to infer the incidence of BSI, the risk factors associated and evaluate the care actions related to the use of these catheters in seven ICU in the Federal District - Brasília, Brazil. From the 630 patients using CVC, 6.4% developed BSI (1.5% directly related to the catheter and 4.9% clinic BSI. The hospitalization term was 3.5 times greater among these patients. Different modalities of catheter insertion and antiseptic substances use were observed. Time of CVC permanence was significantly associated to infection incidence (pLos catéteres venosos centrales (CVC utilizados principalmente en unidades de cuidados intensivos - UCIs, son importantes fuentes de infección de la corriente sanguínea (ICS. Este estudio epidemiológico analítico, de corte prospectivo, enfoca la incidencia de ICS, factores de riesgo asociados y medidas asistenciales relacionadas con el uso de estos catéteres en 7 UCIs del Distrito Federal. Del total de 630 pacientes con CVC, 6,4% presentaron ICS (1,5% relacionado al catéter y 4,9% ICS-Clínica. El tiempo de hospitalización fue 3,5 veces mayor para este grupo de pacientes. Fueron observadas diferentes conductas con relación a la inserción de catéteres y al uso de antisépticos. El tiempo de permanencia del CVC estuvo asociado a la incidencia de infección (pOs cateteres venosos centrais (CVC, utilizados, principalmente em unidades de terapia intensiva-UTIs, são importantes fontes de infecção da corrente sangüínea (ICS. Este estudo epidemiológico analítico, tipo coorte prospectiva, enfoca a incidência de ICS, fatores de risco associados e ações assistenciais relacionadas ao uso desses cateteres em 7 UTIs no Distrito Federal. Dos 630 pacientes com CVC, 6,4% apresentaram ICS (1,5% relacionadas ao cateter e 4,9% ICS

  4. Infecções relacionadas à assistência à saúde por Staphylococcus coagulase negativa em unidade de terapia intensiva neonatal

    Directory of Open Access Journals (Sweden)

    Andre Ricardo Araujo da Silva

    2013-09-01

    Full Text Available OBJETIVO: Avaliar as infecções relacionadas à assistência à saúde, em unidade de terapia intensiva neonatal, causadas pelo Staphylococcus coagulase negativa, verificando o perfil de sensibilidade antimicrobiana e possíveis esquemas antibióticos eficazes. MÉTODOS: Estudo descritivo retrospectivo de uma série de casos de infecções relacionadas à assistência à saúde tardias de origem hospitalar atribuída ao Staphylococcus coagulase negativa, avaliando o perfil de sensibilidade antimicrobiana. Foram estudados os recém-nascidos internados entre 1º de janeiro de 2010 a 30 de junho de 2012 em uma unidade de terapia intensiva neonatal da cidade do Rio de Janeiro, sendo todos os pacientes oriundos de outras unidades. RESULTADOS: Foram admitidos 765 pacientes, totalizando 3.051 pacientes-dia e uma densidade de incidência de infecção geral de 18,9 por 1.000 pacientes-dia. A taxa de utilização de cateteres venosos centrais foi de 71,6% e a positividade das culturas de todos os sítios para todas as infecções relacionadas à assistência à saúde foi de 68,4%. O Staphylococcus coagulase negativa foi implicado em 11 (19,2% das 57 infecções relacionadas à assistência à saúde e Klebsiela pneumoniae produtor de betalactamase de espectro estendido e Candida sp em 5 ocasiões cada. Das 11 infecções, 10 (90,9% foram atribuídas a infecções primárias de corrente sanguínea. A sensibilidade dos isolados de Staphylococcus coagulase negativa em relação à vancomicina, clindamicina, ciprofloxacin, oxacilina e gentamicina foi de 100%, 81,8%, 72,7%, 27,2%, 22,2%, respectivamente. Não houve óbito atribuído diretamente à infecção por Staphylococcus coagulase negativa. CONCLUSÃO: O Staphylococcus coagulase negativa foi o principal agente encontrado nas infecções relacionadas à assistência à saúde tardias de origem hospitalar, sendo baixas as taxas de infecções relacionadas a cateter venoso central. Em hospitais

  5. Perfil de clientes submetidos a amputações relacionadas ao diabetes mellitus Perfíl del paciente sometido a la amputación relacionada a el diabestes mellitus Profile of patients submitted to amputation related to diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Darlene Mara dos Santos Tavares

    2009-12-01

    Full Text Available Estudo retrospectivo que objetivou descrever as características sócio-demográficas e clínicas de 141 sujeitos, internados no Hospital de Clínicas da Universidade Federal do Triângulo Mineiro, submetidos à amputação relacionada ao diabetes; comparar o número de amputações de acordo com as variáveis sexo, faixa etária, co-morbidades e tipo de tratamento e associar o número de amputações com o tempo de internação e de diagnóstico. Os dados coletados em prontuários totalizaram 208 amputações. Maior percentual de sujeitos do sexo masculino (58,9% e maior ocorrência de amputação entre os idosos (70,2%; principal causa de internação: pé diabético (35,7%; a maioria (75,0% foi internada até duas vezes; co-morbidade mais freqüente: hipertensão arterial (74,0%; a mediana do número de amputações foi duas. Não foi observada diferença significativa entre as variáveis estudadas.Estudio retrospectivo que tuvo como objetivo describir las características sociodemográficas y las clínicas de 141 individuos internados en el Hospital de Clínicas de la Universidade Federal do Triângulo Mineiro, Uberaba, MG, Brasil, sometidos a amputaciones relacionadas con diabetes y comparar el número de amputaciones a partir de las variables sexo, edad, comorbilidad y tipo de tratamiento, así como asociar el número de amputaciones con el tiempo de internación y de diagnóstico. Los datos fueron recolectados en las fichas médicas, totalizando 208 amputaciones. Quedó comprobado un mayor porcentual de pacientes del sexo masculino (58,9% y una mayor incidencia de amputaciones entre los ancianos (70,2%; el principal causa de internación fue: pie diabético (35,7%; la mayoría (75,0% fue internado dos veces; comorbilidad más frecuente: hipertensión arterial (74,0%; promedio de amputaciones fue dos. No fueron observadas diferencias significativas entre las variables estudiadas.Retrospective study that aimed at describing the clinic and

  6. Qualidade das anotações de enfermagem relacionadas à ressuscitação cardiopulmonar comparadas ao modelo Utstein Calidad de las anotaciones de enfermería relacionadas a la resucitación cardiopulmonar comparadas con el modelo Utstein Quality of nursing records related to cardiopulmonary resuscitation compared to the Utstein model

    Directory of Open Access Journals (Sweden)

    Ana Paula Fernandes

    2010-01-01

    Full Text Available OBJETIVO: Analisar a qualidade das anotações de enfermagem relacionadas à ressuscitação cardiopulmonar, comparando-as ao protocolo validado Utstein, em um hospital universitário. MÉTODOS: Estudo retrospectivo, exploratório, descritivo, de abordagem quantitativa, realizado por meio de consulta a prontuários de pacientes que sofreram parada cardiorrespiratória (PCR seguida de óbito. A coleta de dados foi realizada no período de 1° de maio a 30 de junho de 2009. RESULTADOS: Dos 144 prontuários consultados, 74 foram dispensados por não haver nenhuma informação registrada dos itens a serem estudados e, 70 constituíram a amostra do estudo. Nestes, não havia anotações referentes à causa imediata da PCR (92%, intervenções realizadas na tentativa de recuperação cardiorrespiratória (RCP (71%, ritmo inicial de PCR (59%, hora dos eventos (16%, drogas utilizadas (50% e profissionais envolvidos na RCP (88%. CONCLUSÕES: As anotações foram escassas e, frequentemente, não realizadas. A utilização do modelo Utstein favorece a anotação sequencial dos eventos, evitando a perda de dados.OBJETIVO: Analizar la calidad de las anotaciones de enfermería relacionadas a la resucitación cardiopulmonar, comparándolas con el protocolo validado Utstein, en un hospital universitario. MÉTODOS: Estudio retrospectivo, exploratorio, descriptivo, de abordaje cuantitativo, realizado por medio de consulta a fichas de pacientes que sufrieron parada cardiorespiratoria (PCR seguida de muerte. Los datos fueron recolectados en el período de 1° de mayo a 30 de junio de 2009. RESULTADOS: Entre las 144 fichas consultadas, 74 fueron liberadas por no haber ninguna información registrada de los ítems a ser estudiados y, 70 constituyeron la muestra del estudio. En estas, no habían anotaciones sobre la causa inmediata de la PCR (92%, intervenciones realizadas tratando de recuperar la parada cardiorespiratoria (RPC (71%, ritmo inicial de PCR (59%, hora de

  7. Motivações, Expectativas e Influências Relacionadas ao Título de Mestre em Ciências Contábeis pelo Programa UnB/UFPB/UFPE/UFRN

    Directory of Open Access Journals (Sweden)

    Orleans Silva Martins

    2010-08-01

    Full Text Available Este trabalho buscou investigar motivações, expectativas e influências relacionadas à obtenção do título de mestre em Ciências Contábeis, pelo Programa Multiinstitucional e Inter-Regional de Pós-Graduação em Ciências Contábeis da UnB/UFPB/UFPE/UFRN, com base nas avaliações e percepções de seus egressos. Para isto, lançou-se mão da fundamentação teórica que trata da Teoria do Capital Humano, da pós-graduação stricto sensu em nível de mestrado no Brasil e da pós-graduação em Ciências Contábeis. A metodologia adotada caracteriza-se como exploratório-descritiva apoiada no método indutivo, utilizando as técnicas da pesquisa bibliográfica e documental. Assim, aplicou-se um questionário a 96 egressos deste programa, entre os dias 01/07 e 31/08/2008, representando 70,07% da população investigada. Para efetuar a análise descritiva e estatística dos dados foram utilizados os softwares Excel e SPSS. Em seus resultados, observou-se que as principais variáveis que motivaram os respondentes a ingressarem no mestrado foram a “obtenção de mais conhecimentos”, a “obtenção de diferenciação profissional” e a “ampliação das oportunidades de emprego”; a principal expectativa atingida referiu-se à principal motivação (obtenção de mais conhecimento, seguida pela “ampliação da formação geral” e pela “capacitação em pesquisa”; e, os principais fatores influenciados pelo título foram: amadurecimento profissional, respeitabilidade e reconhecimento acadêmico/profissional e espírito acadêmico. Conclui-se, portanto, que o título influencia positivamente o desempenho acadêmico e profissional dos egressos, ratificando os pressupostos da Teoria do Capital Humano quanto ao aumento de sua empregabilidade, produtividade e rendimento potencial.

  8. Mudanças relacionadas ao amaciamento da graviola durante a maturação pós-colheita Changes related to softening of soursop during postharvest maturation

    Directory of Open Access Journals (Sweden)

    Maria Auxiliadora Coêlho de Lima

    2006-12-01

    Full Text Available Este trabalho teve por objetivo avaliar mudanças físicas, químicas e bioquímicas relacionadas ao amaciamento de graviola (Annona muricata L. Crioula durante a maturação. Os frutos foram colhidos no estádio de maturidade fisiológica, em plantas cultivadas na Estação Experimental da Embrapa Agroindústria Tropical, em Pacajus, Ceará, armazenados a 26,3±0,6 ºC e 88±12% de umidade relativa, durante 1, 2, 3, 4 e 5 dias. Utilizou-se o delineamento experimental inteiramente casualizado, com quatro repetições. As variáveis analisadas foram: perda de massa, amido, pectina total e solúvel, e atividades das enzimas amilase, pectinametilesterase, poligalacturonase, alfa-galactosidases e beta-galactosidases. Não houve variação significativa no conteúdo de pectina solúvel. Após cinco dias, a perda de massa atingiu 5%, mas não promoveu murcha dos frutos. As reduções nos conteúdos de amido e de pectina total coincidiram com período de expressiva atividade, respectivamente, das enzimas amilase e da poligalacturonase e beta-galactosidase de parede celular. As modificações mais acentuadas no conteúdo de amido, de pectina total, na solubilização de pectinas e na atividade das enzimas amilase, pectinametilesterase, poligalacturonase e beta-galactosidase de parede celular ocorreram no período do segundo ao quarto dia após a colheita.This work aimed to evaluate the physical, chemical and biochemical changes related to softening during maturation of Crioula soursop fruit (Annona muricata L.. Fruits were harvested at the physiological maturity stage from plants grown at Embrapa Agroindústria Tropical Experimental Station, in Pacajus, CE, Brazil, and were stored at 26.3±0.6 ºC and 88±12% relative humidity, during 1, 2, 3, 4 and 5 days. A completely randomized design was used with four replicates. The following variables were evaluated: weight loss; starch content; total and soluble pectin content and enzymatic activity of amylase

  9. Aptidão física relacionada ao desempenho motor em escolares de sete a 15 anos Physical fitness related to motor performance in scholars aged seven to 15 years

    Directory of Open Access Journals (Sweden)

    Samuel Carvalho Dumith

    2010-03-01

    Full Text Available Os benefícios do desenvolvimento da aptidão física sobre a saúde estão bem evidenciados na literatura científica. O objetivo do presente estudo foi descrever a aptidão física relacionada ao desempenho motor de crianças e adolescentes e examinar as diferenças de acordo com sexo, idade, tipo de escola (pública ou privada e região geográfica da escola (urbana ou rural. Uma bateria de cinco testes motores foi aplicada a 526 alunos entre sete e 15 anos do ensino fundamental de Rio Grande, RS: salto em distância parado, arremesso de "medicine-ball", barra modificada, corrida de 20 metros e quadrado. Os resultados apontam que o desempenho em todos os testes foi superior para os rapazes e aumentou diretamente com a faixa etária. Estes foram os principais preditores da aptidão física dentre as variáveis examinadas. O tipo de escola só teve influência sobre o desempenho no teste de arremesso de "medicine-ball", em que alunos da rede privada obtiveram valores médios maiores. Escolares da zona urbana atingiram um melhor desempenho em todos os testes, exceto no teste de barra modificada (sem diferença por região geográfica. A realização de pesquisas com o mesmo enfoque em outras regiões do Brasil permitirá explorar a consistência destes achados e compreender possíveis diferenças.There is strong evidence regarding the benefits of physical fitness development upon health. The aim of this study was to describe the physical fitness related to motor performance in children and adolescents, and to examine if there are differences according to sex, age, type of school (public or private and geographic region (urban or rural. A battery comprising of five motor tests were administered to 526 students aged seven to 15 years from elementary schools of Rio Grande, Brazil: stationary long jump, medicine-ball throw, modified pull-up, 20-meter run and 4-meter shuttle-run. The results indicate that the performance in all tests were higher

  10. Evaluation of the health-related quality of life of hematopoietic stem cell transplantation patients Evaluación de calidad de vida relacionada a la salud de pacientes sometidos a trasplante de células madre hematopoyéticas Avaliação da qualidade de vida relacionada à saúde de pacientes submetidos ao transplante de células-tronco hematopoéticas

    Directory of Open Access Journals (Sweden)

    Carla Libralli Tostes dos Santos

    2011-12-01

    Cancer Therapy en todos los componentes llegando a alcanzar niveles encima del pretrasplante, especialmente en los aspectos físicos y emocionales, y en la relación con el médico.O objetivo deste estudo longitudinal consistiu em se avaliar a qualidade de vida relacionada à saúde de pacientes submetidos ao transplante autólogo e alogênico, em três momentos distintos: no pré-transplante, 30 e 180 dias pós-transplante . Para a coleta de dados, foram utilizados dois questionários: o primeiro para obtenção de dados clínicos e sociodemográficos, e o segundo constituído por uma escala específica, o Functional Assessment Cancer Therapy. A amostra inicial foi constituída por 30 pacientes, sendo 26 avaliados nos três momentos. O conjunto de resultados permitiu visualizar impacto positivo da qualidade de vida relacionada à saúde, ao final dos seis meses pós-transplante. Apesar de algumas funções se apresentarem mais prejudicadas, como a função física, funcional e preocupações adicionais com 30 dias, houve melhora nos escores do Functional Assessment Cancer Therapy em todos os componentes, chegando-se a alcançar patamares acima dos encontrados na fase do pré-transplante, especialmente nos aspectos físicos, emocionais e relacionamento com o médico.

  11. Programa de intervenção com exercícios físicos melhora indicadores de aptidão física relacionada à saúde e ao desempenho motor em escolares com sobrepeso e obesidade

    Directory of Open Access Journals (Sweden)

    Kelin Cristina Marques

    2014-10-01

    Full Text Available Objetivo: verificar se um programa de intervenção, com exercícios físicos, melhora os indicadores de aptidão física relacionada à saúde e ao desempenho motor em escolares com sobrepeso e obesidade. Método: estudo quase-experimental composto por um programa de intervenção interdisciplinar com exercícios físicos, orientação nutricional, postural e bucal. A amostra foi composta por 20 escolares do grupo experimental e 19 do grupo controle, de ambos os sexos, com idades entre 7 a 16 anos. As avaliações (pré e pós-teste foram realizadas através de protocolos do PROESP-BR. O programa de intervenção, com exercícios físicos, teve a duração de 16 semanas consecutivas, com frequência de três vezes por semana e com 60 minutos cada sessão. Foi utilizado o programa SPSS v. 20.0 para a análise estatística dos dados. Resultados e considerações finais: em relação à aptidão física relacionada ao desempenho motor dos escolares, o grupo experimental apresentou melhora significativa para força de membros inferiores (p=0,009 e para agilidade (p=0,001. Para os indicadores de saúde relacionados à saúde, observa-se que o grupo experimental melhorou significativamente a flexibilidade (p=0,008. Dessa forma, ressalta-se a importância da implementação de programas com exercícios físicos na infância e adolescência, com o intuito de melhorar os indicadores de aptidão física relacionada à saúde e ao desempenho motor e evitar agravos precoces à saúde.

  12. Intervenção multiprofissional melhora a aptidão física relacionada à saúde de adolescentes com maior efeito sobre as meninas em comparação aos meninos

    Directory of Open Access Journals (Sweden)

    Josiane Aparecida Alves BIANCHINI

    Full Text Available Resumo Este estudo teve como objetivo verificar as diferenças entre as respostas de meninos e meninas a um programa multiprofissional de tratamento da obesidade sobre a aptidão física relacionada à saúde. Fizeram parte do estudo 163 adolescentes com excesso de massa corporal e idade entre 10 e 18 anos. Foram avaliados parâmetros antropométricos, composição corporal, flexibilidade, força e resistência abdominal e aptidão cardiorrespiratória antes e após 16 semanas de intervenção multiprofissional. A intervenção multiprofissional contou com a participação de profissionais de educação física, nutrição, psicologia e pediatria e teve como foco principal o incentivo a mudanças nos hábitos alimentares e de atividade física que pudessem promover alterações positivas nos parâmetros analisados. A intervenção teve frequência semanal de três sessões, sendo uma hora de intervenções teóricas com os profissionais de educação física, nutrição e psicologia e a outra hora destinada à prática regular de exercícios físicos, com predominância de exercícios físicos resistidos, aeróbios e prática de basquetebol. Após a intervenção tanto as meninas quanto os meninos apresentaram melhoras significativas nas variáveis IMC, circunferência de cintura e quadril, massa gorda relativa e absoluta, massa magra, flexibilidade, força/resistência abdominal e aptidão cardiorrespiratória, porém com resultados mais expressivos para as meninas sobre a circunferência de cintura, gordura corporal (kg, VO2max e força/resistência abdominal.

  13. Variação da ecogenicidade difusa em parênquima hepático homogêneo relacionada aos achados bioquímicos e hematológicos em cães

    Directory of Open Access Journals (Sweden)

    Fernanda P. Medeiros

    2013-12-01

    Full Text Available No presente estudo foi analisado o parênquima hepático com características homogêneas e ecogenicidade difusa reduzida (G1, aumentada (G2 e normal (G3, em relação ao perfil dos animais, dimensão do fígado e achado bioquímico e hematológico. Amostras de sangue obtidas por punção venosa da jugular ou da cefálica do antebraço foram encaminhadas para realização de hemograma e dosagem sérica de ALT, FA, proteínas totais, albumina, globulina, uréia e creatinina. Dos 30 cães que compuseram o G1, 30 (100% apresentaram evidenciação das paredes portais e da parede da vesícula biliar, 23 (76,67% fígado com dimensão preservada e bordos em ângulos agudos, 15 (50% faixa etária entre 1 e 6 anos de idade e 8 (26,67% eram da raça Lhasa apso. Não houve predisposição quanto ao sexo, assim como não foram identificadas alterações significativas nos exames bioquímicos e hematológicos dos cães do G1. Quanto aos diagnósticos clínicos atribuídos para estes cães, houve maior prevalência de gastroenterite (43,33%. Dos 30 cães do G2, 27 animais (90% apresentaram hepatomegalia e arredondamento dos bordos hepáticos, 18 (60% tinham idade superior a 9 anos, 16 (53,33% eram fêmeas e 9 (30% eram da raça poodle. Houve elevação da atividade sérica de FA e elevação de ALT, redução nos níveis de proteínas séricas totais, albumina, globulinas, eritrócitos e volume globular, além de leucocitose por neutrofilia, com desvio à esquerda, eosinopenia, linfopenia e monocitose nos cães do G2. Neste grupo houve prevalência de doenças metabólicas (54%, como diabetes mellitus e hiperadrenocorticismo, além das hepatopatias crônicas (17%, atribuídas ao uso contínuo e prolongado de corticóide e drogas anticonvulsivantes. Dos 30 cães do grupo controle (G3, 22 (73,33% apresentaram dimensões hepáticas inalteradas e bordos em ângulos agudos. Neste grupo de animais, não houve alterações significativas nos exames laboratoriais.

  14. Microcefalia e outras manifestações relacionadas ao vírus Zika: impacto nas crianças, nas famílias e nas equipes de saúde

    Directory of Open Access Journals (Sweden)

    Decio Brunoni

    Full Text Available Resumo O presente estudo objetivou apresentar um panorama nacional e internacional atual dos estudos sobre o vírus Zika (ZIKV e, ancorado no avanço deste conhecimento, refletir sobre planos de ação voltados para as crianças, famílias e equipes de saúde envolvidas. Neste sentido, o estudo propôs a implementação de sistemas de seguimento para conhecer, descrever e caracterizar aspectos que devem estar relacionados à exposição pré-natal ao ZIKV, divididos em três eixos de atuação: 1. Avaliação diagnóstica e etiológica e rastreamento de problemas de desenvolvimento nas crianças incluídas como casos confirmados ou suspeitos. 2. Investigação do impacto emocional, da qualidade de vida, das estratégias de enfrentamento e da rede de apoio às famílias das crianças incluídas. 3. Capacitação de equipes multiprofissionais para avaliar e elaborar programas de intervenção ao longo do desenvolvimento das crianças, principalmente nos três primeiros anos de vida. Como conclusão, o presente trabalho ressalta que o sistema de assistência à saúde encontra-se diante de grandes desafios: entender o real significado de um potencial novo teratógeno; desvendar os mecanismos patogênicos do ZIKV, principalmente para o enfrentamento preventivo, e reconhecer o amplo espectro de manifestações clínicas para a elaboração de programas de intervenção.

  15. Incidência de infecção em pacientes com cateter peridural tunelizado Incidencia de infección en pacientes con cateter peridural tunelizado Infection incidence in patients with tunneled peridural catheter

    Directory of Open Access Journals (Sweden)

    Maria Cecilia Iksilara

    2005-04-01

    Full Text Available O cateter peridural tunelizado como via de administração de opiáceos vem sendo utilizado desde o início de 1980. Pacientes com dor crônica, que não obtêm alívio com medicamentos por outras vias, são muito beneficiados com infusão de opiáceo associado a um anestésico local por via peridural. Entretanto, ainda existem dúvidas sobre a eficácia do método, no manuseio e, conseqüentemente, quanto ao risco de infecção e outras complicações. Sendo a equipe de enfermagem fundamental para efetivar o tratamento para o alívio da dor, esse estudo propõe demonstrar como manter a técnica segura. Foram acompanhados 27 pacientes com dor crônica entre 2002 e 2004, que utilizaram o cateter peridural por 18 dias em média, implantados em nível torácico ou lombar. Não houve complicações como abcesso peridural, meningite ou hematoma peridural. A satisfação dos pacientes quanto a analgesia foi evidente.El cateter peridural tunelizado, como via de administración de opióides, es utilizado desde el comienzo de 1980. Pacientes con dolor crónico, que no tienen alivio con medicamentos por otras vias, son muy beneficiados con la administración de opióides, asociados a un anestésico local por via peridural. Sin embargo, aún existen dudas sobre la eficacia del método, en el manejo y, como consecuencia, en el riesgo de infección y otras complicaciones. Siendo el equipo de enfermería fundamental para ejecutar el tratamiento para alivio del dolor, esto estudio se propone a presentar como mantener la técnica segura. Vinte y siete pacientes con dolor crónica, entre 2002 a 2004, que utilizarón el cateter peridural por 18 dias en media, fuerón seguidos. Los cateteres fuerón implantados al nivele toracico o lumbar. No se presentaran complicaciones como absceso peridural, meningitis o hematoma peridural. La satisfacción de los pacientes quanto analgesia fué evidente.The tunneled epidural catheter as an administration access for opiates

  16. Decomposition of trimethylamine oxide related to the use of sulfites in shrimp Decomposição do óxido de trimetilamina relacionada ao uso de sulfitos em camarão

    Directory of Open Access Journals (Sweden)

    Israel H.A. CINTRA

    1999-12-01

    Full Text Available Currently, sulfites are employed on board to inhibit melanosis (blackspot on crustaceans. However, when used in excess this chemical compound not only can cause adverse reactions in SO2-sensitive individuals, but also favors the decomposition of trimethylamine oxide (TMAO into dimethylamine (DMA and formaldehyde (FA, thus compromising the quality of the product, which can be observed mainly through the texture change of the meat after cooking. This study was conducted to verify the increase of the contents of DMA and FA by the excessive use of sodium metabisulfite in white shrimp (Penaeus schmitti. For laboratory trials, shrimp were beheaded, washed and immersed in a 2% sodium metabisulfite solution for 10 minutes. Specimens were stored either on ice and maintained for 48 hours in refrigeration, or stored in a freezer for 48 hours. Samples were collected at intervals of 0, 24 and 48 hours, and analyzed for residual SO2, TMAO, TMA, DMA and FA. The immersion of shrimp in a 2% sodium metabisulfite for 10 minutes favored the decomposition of TMAO which greatly increased the contents of DMA and FA. The FA and DMA measured in fresh shrimp was low. Moreover, the storage of shrimp tails on ice resulted in a significant reduction of the TMA, DMA, FA and residual SO2 contents compared to the specimens under frozen storage.O uso de sulfitos é uma prática utilizada a bordo para prevenir a melanose (manchas pretas em crustáceos. No entanto, este composto, além de causar reações alérgicas em pessoas sensíveis ao SO2 quando usado em excesso, proporciona a decomposição do óxido de trimetilamina (OTMA em dimetilamina (DMA e formaldeído (FA, comprometendo assim a qualidade do pescado, principalmente no que se refere ao endurecimento da carne após cozimento. O presente trabalho foi desenvolvido com a finalidade de se verificar o aumento dos níveis de DMA e FA pelo uso em excesso de metabissulfito de sódio em camarão branco, Penaeus schmitti . Em

  17. Relações de causa e efeito em espigas de milho relacionadas aos tipos de híbridos Path analysis on maize spikes characteristics related of the hybrid type

    Directory of Open Access Journals (Sweden)

    Sidinei José Lopes

    2007-12-01

    Full Text Available O peso de grãos é um dos componentes determinantes do rendimento de grãos de milho, que apresenta relações complexas com várias características morfológicas da espiga. O objetivo deste trabalho foi verificar como o peso dos grãos das espigas de milho está relacionado diretamente ou indiretamente com as características morfológicas das espigas e se esta relação depende do tipo de híbrido: simples, triplo ou duplo. O experimento de milho foi realizado no ano agrícola de 2004/05, na Universidade Federal de Santa Maria, com seis tratamentos, que foram compostos de dois híbridos simples, dois híbridos triplos e dois híbridos duplos. O delineamento utilizado foi o de blocos completos ao acaso, com três repetições, com parcelas de duas filas de cinco metros de comprimento com 0,8 m entre filas e densidade de 55.000 plantas ha-1. As correlações entre as características morfológicas da espiga e o peso de grãos foram desdobradas em efeitos diretos e indiretos. O número de filas de grãos por espiga está correlacionado com o peso de grãos apenas nos híbridos duplos (0,5298, e esta correlação se deve ao efeito indireto positivo do número de grãos por espiga (0,8875 e negativo do peso de 100 grãos (- 0,3795. A seleção de espigas com maior peso de 100 grãos e maior número de grãos por espiga tem efeito direto sobre o aumento do peso de grãos por espiga nos híbridos simples e triplo, enquanto que, no híbrido duplo, apenas o número de grãos por espiga tem efeito. As relações entre as características de espigas são dependentes dos genótipos, o que deve complicar um pouco mais a tarefa dos melhoristas de plantas ao selecionar genótipos para maior peso de grão por espiga.The weight of grains is one of the decisive components of the income of corn yield, and presents complex relationships with several morphologic characteristics of the maize spikes. The objective of this research was to verify if the grain weight

  18. Nefroproteção relacionada ao uso de meio de contraste iodado: atenção de enfermagem Nefroprotección relacionada al uso de medio de contraste yodado: atención de enfermería Nephroprotection associated with the use of iodinated contrast: nursing care

    Directory of Open Access Journals (Sweden)

    Rosana Pires Russo Bianco

    2008-01-01

    Full Text Available OBJETIVO: Analisar estudos publicados sobre Nefropatia induzida por contraste, sua prevenção e o papel do enfermeiro nesta ação, bem como, propor intervenções de enfermagem. MÉTODOS: Foi realizada revisão de literatura nas bases de dados MEDLINE, SciELO, LILACS, publicados de 1977 a 2007. RESULTADOS: Em âmbito nacional não encontramos estudos quando associamos aos descritores nefroproteção e meio de contraste iodado a palavra enfermagem. Identificamos que na prática clínica o procedimento de hidratação antes do uso de meio de contraste é o mais utilizado. CONCLUSÃO: Sabendo-se que os meios de contraste podem gerar diferentes tipos de reações adversas nos pacientes, torna-se importante o enfermeiro estar habilitado cientificamente, para reconhecer estas injúrias e, assim, implementar intervenções pertinentes, eficazes e que minimizem as complicações.OBJETIVO: Analizar estudios publicados sobre Nefropatía inducida por contraste, su prevención y el papel del enfermero en esta acción, así como, proponer intervenciones de enfermería. MÉTODOS: Se realizó la revisión de literatura en las bases de datos MEDLINE, SciELO, LILACS, publicados de 1997 a 2007. RESULTADOS: En el ámbito nacional no se encontró estudios cuando se asoció a los descriptores nefroprotección y medio de contraste yodado la palabra enfermería. Identificamos que en la práctica clínica el procedimiento de hidratación antes del uso de medio de contraste es el más utilizado. CONCLUSIÓN: Sabiéndose que los medios de contraste pueden generar diferentes tipos de reacciones adversas en los pacientes, se torna importante que el enfermero esté habilitado científicamente, para reconocer estas agresiones y, así, implementar intervenciones pertinentes, eficaces y que minimicen las complicaciones.OBJECTIVE: To analyze studies published on CIN, its prevention and the nurse's role in this action, as well as to consider nursing interventions. METHODS

  19. Análise de sobrevivência relacionada ao sexo, após esplenectomia, em modelo animal Post-splenectomy survival analysis related to gender in animal model

    Directory of Open Access Journals (Sweden)

    Luiz R. Alberti

    2007-06-01

    Full Text Available É sabido que a esplenectomia causa propensão a infecções, principalmente aquelas causadas por microorganismos capsulados. Essas complicações acompanham-se de maior mortalidade e conseqüente menor sobrevida dos indivíduos asplênicos. O objetivo do presente trabalho foi avaliar a sobrevida em relação ao sexo de ratos submetidos a esplenectomia total. Foram estudados 34 ratos, distribuídos em dois grupos, sendo o Grupo 1 (n=14 controle, animais submetidos apenas a laparotomia e o Grupo 2 (n=20 submetidos a esplenectomia total. Os animais de cada grupo foram distribuídos em dois subgrupos iguais, sendo o Subgrupo A composto por machos e o Subgrupo B por fêmeas. Os ratos foram acompanhados por um período máximo de noventa dias com vista à sua sobrevivência. Observou-se que a mortalidade após esplenectomia total foi de 80% no Subgrupo dos animais machos e de 30% no das fêmeas. Não houve óbitos no Grupo 1. Os ratos esplenectomizados apresentaram sobrevida inferior à das ratas esplenectomizadas (p = 0,034. De acordo com os resultados obtidos, a esplenectomia diminui a sobrevida de ratos, e as fêmeas murinas apresentam maior resistência à asplenia e conseqüentemente menor mortalidade do que os machos.It is well known that splenectomy increases the risk of infections, mainly those caused by capsulated bacteria. These complications are associated with greater mortality and lower survival rates in asplenic individuals. The objective of the present work was to assess the survival of rats submitted to total splenectomy. Thirty-four rats were divided into 2 groups: Group 1 (n = 14: control animals, submitted only to laparotomy; Group 2 (n = 20: animals submitted to splenectomy. Both groups were subdivided into 2 subgroups, namely, subgroup A, male rats, and subgroup B, female rats. The animals were followed during a 90-day period to assess their survival. The mortality of animals in Group 2 was 80% for males and 30% for females. No

  20. Coesão e resistência ao cisalhamento relacionadas a atributos físicos e químicos de um Latossolo Amarelo de tabuleiro costeiro Cohesion and shear strength as related to physical and chemical properties of a Yellow Latosol of coastal plain

    Directory of Open Access Journals (Sweden)

    Apolino José Nogueira da Silva

    2007-10-01

    Full Text Available Os solos coesos de tabuleiros costeiros têm como característica peculiar horizontes minerais subsuperficiais, que apresentam consistência friável quando úmidos, porém, quando secos, têm consistência dura, muito dura ou extremamente dura. Este trabalho teve o objetivo de estudar o comportamento mecânico de horizontes coesos e não-coesos de um Latossolo Amarelo de tabuleiro costeiro por meio de características de cisalhamento relacionadas com propriedades físicas, químicas e teor de água do solo. Os resultados mostraram que a coesão do solo e a resistência ao cisalhamento aumentaram expressivamente com a redução do teor de água no horizonte coeso. Este horizonte apresentou os maiores valores de densidade do solo, microporosidade e óxidos de Fe, Si e Al, resultando em maiores valores de coesão do solo e resistência ao cisalhamento, em relação aos horizontes não-coesos. Os maiores valores de coesão do solo resultaram em maiores valores de resistência à penetração no horizonte coeso, em relação aos não-coesos. As características de cisalhamento (coesão do solo, ângulo de atrito interno e resistência ao cisalhamento mostraram-se sensíveis à identificação de horizontes coesos em solos de tabuleiros costeiros.The cohesive soils of Brazilian coastal plain have subsurface horizon with a peculiar characteristic - when wet the consistency is friablet, but of hard, very hard or extremely hard consistency when dry. The objective of this study was to evaluate the mechanical characteristics of cohesive and non-cohesive horizons of a Yellow Latosol of coastal tableland based on shear parameters related with soil physical and chemical properties and moisture. The results showed that soil cohesion and shear strength increased substantially with the reduction of the water content in the cohesive horizon. The cohesive horizon presented the highest values of bulk density, microporosity and Fe, Si and Al oxides, resulting in

  1. Citrus postharvest diseases and injuries related to impact on packing lines Doenças pós-colheita em citros e injúrias relacionadas ao impacto em linhas de beneficiamento

    Directory of Open Access Journals (Sweden)

    Ivan Herman Fischer

    2009-04-01

    'Valencia' e tangor 'Murcott', destinados à exportação, após diferentes etapas do beneficiamento em packinghouse e identificar os pontos críticos e a magnitude de impacto em linhas de beneficiamento. Os frutos foram coletados na chegada ao packinghouse, tanto após a pré-lavagem como após o desverdecimento, na banca de embalagem e no palete; e armazenados individualmente durante 21 dias a 25ºC e 85% de UR. A incidência de injúrias foi avaliada visualmente a cada três dias. Para a avaliação da magnitude de impactos (G, m/s² nos 19 pontos de transferência da linha de beneficiamento de citros empregou-se uma esfera instrumentada com registrador de aceleração. Observou-se uma baixa incidência de podridões nas diferentes etapas do beneficiamento dos frutos, com valores abaixo de 3,5% e levemente superior após o desverdecimento em laranja 'Valencia' e também redução de podridões após a aplicação de fungicidas em tangor 'Murcott'. Os principais patógenos encontrados em laranja foram Lasiodiplodia theobromae e Penicillium digitatum, sendo superados em tangor por Colletotrichum gloeosporioides. Na avaliação dos impactos na linha de beneficiamento, 94,7% dos impactos variaram entre a faixa de 30-95 G, causados principalmente por quedas em superfícies rígidas. Os maiores impactos foram observados quando os frutos foram transferidos da linha de beneficiamento para bins, destinados ao desverdecimento. Os danos mecânicos de oleocelose foram crescentes até a banca de embalagem.

  2. Produtividade da cana-de-açúcar relacionada ao nitrogênio residual da adubação e do sistema radicular Sugar cane yield related to the residual nitrogen from fertilization and the root system

    Directory of Open Access Journals (Sweden)

    André Cesar Vitti

    2007-02-01

    Full Text Available O trabalho foi desenvolvido, durante duas safras agrícolas, com colheita da cana-de-açúcar sem queima, a fim de avaliar o efeito residual da adubação nitrogenada da 2ª soca (safra 1999/2000, e o efeito do N e S do sistema radicular da cultura na produtividade do ciclo agrícola subseqüente (3ª soca - safra 2000/2001. O delineamento experimental foi em blocos ao acaso com seis tratamentos e quatro repetições. Os tratamentos da safra 1999/2000 foram 0, 35, 70, 105, 140 e 175 kg ha-1 de N com a fonte nitrato de amônio, aplicada sobre a palha. Na 3ª soca aplicaram-se 100 kg ha-1 de N em todos os tratamentos da safra anterior (2ª soca. Nas parcelas, no primeiro ano, foram inseridas microparcelas que receberam o fertilizante nitrato de amônio marcado em 15N na fração amônio. As doses de N proporcionam efeito linear altamente significativo na produtividade de colmos da 2ª soca e esse efeito mantém-se na 3ª soca, mesmo sendo aplicada uma única dose de N; a adubação nitrogenada e o conteúdo de N e S do sistema radicular correlacionam-se positivamente com a produtividade da cana-de-açúcar na safra seguinte.The work was carried out between two harvesting seasons, without burn, to evaluate the residual effect of the nitrogen fertilization on the 2nd ratoon crop of sugar cane (harvest 1999/2000, and the effect of N and S content in the root system on the following productivity of the next cycle (3rd ratoon crop - harvest 2000/2001. The experiment design was in randomized blocks with six treatments and four replications. The harvest 1999/2000 treatments were 0, 35, 70, 105, 140 and 175 kg ha-1 of N as ammonium nitrate, which was applied over the stove. In the 3rd ratoon crop 100 kg ha-1 of N were applied in all the treatments of the previous harvest season. The first year plots contained microplots, which received the ammonium nitrate labeled with 15N in the ammonium fraction. N doses showed high significant linear effect in the cane

  3. A precisão experimental relacionada ao uso de bordaduras nas extremidades das fileiras em ensaios de milho The experimental precision related by using border plants at the ends of rows in corn trials

    Directory of Open Access Journals (Sweden)

    Alberto Cargnelutti Filho

    2003-08-01

    Full Text Available Foram conduzidos quatro experimentos de competição de cultivares de milho, durante o ano agrícola de 2000/2001, e três no ano 2001/2002, na área experimental do Departamento de Fitotecnia da UFSM, Santa Maria, com o objetivo de verificar se o uso de bordadura nas extremidades das fileiras melhora a precisão experimental. Foi usado o delineamento em blocos ao acaso com três repetições, sendo os blocos espaçados entre si de um metro, e as parcelas constituídas por duas fileiras espaçadas de 0,8m com 5,0m de comprimento, com a área útil formada pelos quatro metros centrais. Para a variável rendimento de grãos de milho, procedeu-se a verificação das pressuposições do modelo, a análise da variância com teste F e a aplicação do teste Scott-Knott para as comparações entre as médias estimadas na área útil e na área total. A estatística diferença mínima significativa pelo teste de Tukey foi usada como principal indicador da precisão, cuja significância foi testada pelo teste F dos respectivos quadrados médios do erro. Todas as pressuposições do modelo matemático, nos sete experimentos, foram atendidas. Para o rendimento de grãos, o descarte dos resultados da bordadura nas extremidades das fileiras não altera a precisão experimental na comparação de cultivares.Seven experiments of corn cultivar competition were carried out to quantify the experimental precision improvement by evaluating border plants at the ends of rows of corn trials. The experiments were conducted during 2000 and 2001 grown seasons at the experimental area of the Fitotecnia Department, Federal University of Santa Maria, RS, Brazil. Each cultivar was replicated three times in plots of two rows of 5.0m separated by 0.80m following a randomized complete block design. The 0.5m of the ends of the same plot rows was considered as border plants and was separated evaluated. Data on grain yield of plot and total yield including border plants were used

  4. A riqueza das formigas relacionada aos períodos sazonais em Caxiuanã durante os anos de 2006 e 2007 The ants wealth in relation to seasonal Caxiuanã periods during years 2006 and 2007

    Directory of Open Access Journals (Sweden)

    Sérgio Rodrigo Quadros dos Santos

    2012-09-01

    Full Text Available A variabilidade temporal da fauna de formigas coletadas em Caxiuanã -PA, durante o protocolo de formigas de serrapilheira do Projeto TEAM/Caxiuanã , foram estudadas a partir das condições meteorológicas locais observadas nos meses de janeiro a abril (estação chuvosa, e julho a outubro (estação menos chuvosa, para os anos de 2006 e 2007. Para isso, foram utilizados dados meteorológicos da torre micrometeorológica de Caxiuanã . Durante a estação chuvosa, notou-se o predomínio de elevados valores de precipitação e umidade do solo, e baixas temperaturas do ar. Na estação menos chuvosa, observou-se comportamento oposto ao período chuvoso. Em geral, observou-se que a frequência de formigas é maior quando há redução da precipitação e da umidade do solo; e do aumento da temperatura do ar. Os gêneros das formigas Crematogaster, Hypoponera, Pheidole e Solenopsis apresentaram maior quantidade de indivíduos. Percebeu-se ainda, que as correlações estatísticas com função polinomial de segunda ordem, entre as variáveis atmosféricas e a frequência de formigas, mostram claramente que estas ocorrem de modo inverso com a precipitação e a umidade do solo, e direta com a temperatura do ar. Assim, os resultados deste estudo corroboram a alta variação da abundância dos quatro gêneros de formigas supracitados, em função das variáveis atmosféricas em áreas tropicais.The temporal variability of ant fauna collected in Caxiuanã -PA during the leaf litter ants protocol of the Project TEAM/Caxiuanã were studied based on the local meteorological conditions observed during the months from January to April (rainfall season, and July to October (dry season to 2006 to 2007. Data from the micrometeorological tower at Caxiuanã were used. During the rainfall season the predominance of high values of precipitation and soil moisture and low values of air temperatures is noted. In the dry season the opposite behavior compared to the

  5. Resistência específica do solo de um pomar frutícola relacionada ao manejo entrelinhas e intensidade de tráfego Resistência específica do solo de um pomar frutícola relacionada ao manejo entrelinhas e intensidade de tráfego Orchard soil reology related to cover crop management and traffic intensities

    Directory of Open Access Journals (Sweden)

    Laura Draghi

    2005-08-01

    Full Text Available O tráfego necessário à exploração de pomar frutícola tem características que se denominam "tráfego controlado", já que se realiza sempre sobre os mesmos caminhos do espaço entrelinhas. No alto Valle do Rio Negro, Argentina, a essa situação deve ser agregado, como fator de predisposição das sobrecompactações, o fato de que ocorre com freqüência um excesso de irrigação, que obriga ao tráfego sobre um solo úmido e, portanto, com baixa capacidade de suporte e alta predisposição à compactação. O presente trabalho teve o objetivo de estabelecer a possibilidade de sustentabilidade do sistema produtivo, que se conseguiria com a redução do tráfego resultante das mudanças das aplicações fitossanitárias de calendário fixo, pelas propostas no Projeto Frutícola Integrado (PFI do INTA (Instituto Nacional de Tecnologia Agropecuária. Em um pomar de macieiras, foi simulado, sobre duas condições de solo, com e sem cobertura vegetal, o tráfego correspondente ao somatório de um ano para cada sistema. Para os tratamentos de tráfego, foi utilizado um conjunto trator-pulverizador padrão. O parâmetro que se vinculou à compactação, foi a resistência à penetração. O estado do solo anteriormente à aplicação do tráfego foi tomado como testemunha. A medição de sobrecompactações sobre o solo nu testemunha foi mais freqüente que sobre o coberto por vegetação. Depois dos tratamentos, a reologia dos solos foi diferente. Concluiu-se que as diminuições do tráfego, como as que foram propostas no PFI, são de significativa importância na busca da sustentabilidade do sistema produtivo.Orchard production traffic demands have characteristics that is called controlled traffic. Tractors and its machines, always use the same tracks in each of their passage. Not only this negative condition, but the fact that the irrigation used is usually excessive, it leads to a highly potential condition to enhance over-compaction in

  6. Incidência cumulativa anual de doenças musculoesqueléticas incapacitantes relacionadas ao trabalho em uma área urbana do Brasil Cumulative annual incidence of disabling work-related musculoskeletal disorders in an urban area of Brazil

    Directory of Open Access Journals (Sweden)

    Norma Suely Souto Souza

    2011-11-01

    Full Text Available Estimou-se a incidência cumulativa anual (ICA das doenças musculoesqueléticas incapacitantes que acometem a região cervical e/ou membros superiores (DMEMS relacionadas ao trabalho, entre trabalhadores do Regime Geral da Previdência Social (RGPS de Salvador, Bahia, Brasil. Trabalhadores que receberam benefícios por incapacidade temporária por DMEMS relacionadas ao trabalho foram considerados casos, em 2008. Os dados provêm dos sistemas administrativos do Instituto Nacional do Seguro Social (INSS e do Ministério do Trabalho e Emprego (MTE. A ICA foi de 15 por dez mil trabalhadores. Mulheres, os de menor renda e aqueles que trabalhavam no ramo de atividades financeiras e indústria de transformação tinham maior ICA-DMEMS do que os seus referentes. Mulheres com o menor rendimento (um salário mínimo: R$ 415,00 tiveram a maior ICA-DMEMS, de 123 casos por dez mil. Isso sugere desigualdade na ocorrência dessas enfermidades, indicando a necessidade de priorizar não só ações de prevenção, com foco na ergonomia e organização do trabalho, como também o diagnóstico precoce, tratamento e reabilitação profissional.This study focused on the annual cumulative incidence (ACI of disabling work-related musculoskeletal disorders affecting the neck and/or upper limbs (ULMSD among workers covered by the National Social Insurance System in the city of Salvador, Bahia State, Brazil. Cases were workers who received disability compensation benefits when unable to work due to ULMSD, during the year 2008. The data were obtained from the administrative systems of the National Social Insurance Institute and Ministry of Labor and Employment. ACI was 15 per 10,000 workers. Increased ACI of ULMSD was associated with female gender, lower income, and work in financial activities or manufacturing. Women earning the minimum wage (US$ 64.00 per month or less had the highest ACI of ULMSD (123 per 10,000, suggesting inequalities in the occurrence of these

  7. Cateter peridural deslocado: uma causa de falha de analgesia. Relato de caso

    Directory of Open Access Journals (Sweden)

    Sudbrack Guilherme

    2002-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A migração do cateter peridural é uma ocorrência rara. No entanto, quando não se obtém bloqueio condutivo após injeção de anestésico local através do mesmo, deve-se suspeitar de que ele não esteja no local esperado. O objetivo deste relato é descrever um caso de migração de cateter peridural (L3-L4 para o interior do músculo psoas maior direito, confirmado radiologicamente. RELATO DO CASO: Paciente feminina com 58 anos, portadora de tromboangeíte obliterante foi submetida à amputação do hálux esquerdo sob técnica combinada raqui-peridural. A punção subaracnóidea foi feita em L4-L5 e o cateter peridural foi passado em L3-L4 com o objetivo de fazer analgesia controlada pelo paciente (ACP, por via peridural, no pós-operatório. Como a ACP não apresentou resultados no pós-operatório, suspeitou-se de migração do cateter peridural que foi confirmada por estudo radiográfico contrastado. O cateter saiu pelo forâmen intervertebral e ficou alojado no músculo psoas maior direito. CONCLUSÕES: A ausência de efeitos após injeções repetidas de soluções analgésicas através de cateter peridural faz suspeitar que o mesmo não esteja no local apropriado. Estudo radiológico com contraste pôde confirmar o diagnóstico.

  8. A prática do (a enfermeiro (a de unidade de terapia intensiva na inserção do cateter de Folley: limites e possibilidades

    Directory of Open Access Journals (Sweden)

    Magno Conceição Merces

    2013-01-01

    Full Text Available A enfermagem tem importante papel na prevenção e controle da infecção do trato urinário. A inserção de cateter urinário representa a topografia local com maior índice de infecção hospitalar. O cateter de Folley é um procedimento privativo do enfermeiro, e exige técnicas assépticas durante a sua realização, prevenindo assim, riscos ao cliente. A pesquisa, teve como objetivos avaliar a prática do (a enfermeiro(a na inserção do cateter de Folley e apontar limites e possibilidades dessa prática em pacientes de Unidade de Terapia Intensiva (UTI de um Hospital Geral do Interior da Bahia (HGIB. Metódos: Trata-se de um estudo qualitativo do tipo exploratório e descritivo. A coleta de dados foi realizada através de entrevista semi-estruturada. Após análise dos dados foram apreendidas duas categorias, a saber: a prática do (a enfermeiro (a na inserção docateter de Folley em pacientes de UTI e os limites e possibilidades da prática do (a enfermeiro (a de UTI na inserção do cateterde Folley. Utilizou-se a análise de conteúdo de Bardin para a análise dos dados. Resultados: O estudo aponta que a prática do (a enfermeiro (a na inserção do cateter de Folley em pacientes de UTI é apreendida a partir do uso de técnicas assépticas para a prevenção da infecção urinária, do conhecimento teórico e prático na inserção do cateter de Folley em pacientes de UTI, do conhecimento sobre infecção do trato urinário e as relações com a inserção da sonda vesical e que os limites e possibilidades da prática do (a enfermeiro (a na inserção do catéter de Folley, apresentam-se através de medidas para minimizar os riscos de infecção hospitalar proveniente da sondagem vesical de demora na UTI. Os (as enfermeiros (as sinalizam que os riscos de infecção hospitalar são inerentes à sondagem vesical de demora (SVD. Aspecto importante, pois, o conhecimento ou a suaausência pode se constituir em limite ou possibilidade para

  9. Escolhas Associadas ao Automóvel por Homens e por Mulheres: confluência ou divergência? Choices associated with automobiles for Men and Women: convergence or divergence? Opciones relacionadas con el Automóvil por Hombres y por Mujeres: ¿convergencia o divergencia?

    Directory of Open Access Journals (Sweden)

    LICHT, René Henrique Götz

    2009-03-01

    Full Text Available RESUMOO aumento do poder de compra das mulheres tem levado empresas a adotarem estratégias de diferenciação de produtos e a produzirem produtos específicos para o público feminino. A indústria automobilística não está imune a este fenômeno, uma vez que as mulheres representam aproximadamente metade das vendas de automóvel no país. Considerando as diferenças de consumo e de comportamento entre mulheres e homens é colocada a seguinte questão: há diferenças entre escolhas associadas ao automóvel por homens e mulheres? Foram apresentados aos participantes itens presentes no dia-a-dia das pessoas, e que são por elas valorizados; e foi solicitado aos participantes que escolhessem e associassem estes itens ao automóvel. A análise dos resultados revelou haver mais semelhanças do que diferenças entre escolhas associadas ao automóvel por homens e escolhas associadas ao automóvel por mulheres. A semelhança entre as escolhas sugere que as representações, os significados e valores atribuídos ao automóvel por homens e por mulheres são similares e, desta forma, a estratégia de diferenciação de produtos não se aplica à indústria automobilística.ABSTRACTThe increase of the women purchase power has led some companies to adopt strategies of products differentiation as well as to produce specific products to the female public. The auto industry is not immune to this phenomenon, once the women represent, approximately, half of the automobile sales in the country. Considering the consumption and the behavior differences between women and men, it has set the following question: are there differences between the choices associated to the automobile by men and the choices associated to the automobile by women? It has been presented to the participants items found in the people’s day-by-day, which are valorized by them, and the participants have been asked to choose and associate these items to the automobile. The results analysis

  10. Tamponamento cardíaco em dois recém-nascidos causado por cateter umbilical Cardiac tamponade caused by central venous catheter in two newborns

    Directory of Open Access Journals (Sweden)

    Andrey José Monteiro

    2008-09-01

    Full Text Available Tamponamento cardíaco secundário ao uso de cateter venoso central é uma complicação rara, porém potencialmente tratável, quando identificada a tempo. Nós relatamos dois casos de tamponamento cardíaco, diagnosticados por ecocardiograma transtorácico, seguido de pericardiocentese de urgência e drenagem pericárdica cirúrgica como complicação de cateterização venosa umbilical. Em um caso, a ponta do cateter estava adequadamente localizada e, no outro caso, não. Em ambos os casos, solução hiperosmolar estava sendo infundida. Apesar de situação incomum, esta deve ser sempre considerada em neonato, evoluindo com choque cardiogênico sem causa aparente.Cardiac tamponade secondary to the use of central venous catheter is a rare complication; however, it is potentially reversible when it is caught in time. We report two cases of cardiac tamponade that was diagnosed using a transthoracic echocardiography, followed by urgent pericardiocentesis and surgical pericardial drainage as a complication from umbilical venous catheterization. In one case, the tip of the catheter was properly placed, and in the other case, it was not. In both cases, a hyperosmolar solution was being injected. Although it may be an uncommon situation, it should be always considered as a possibility in a newborn who develops cardiogenic shock without an apparent cause.

  11. Síndrome de Guillain-Barré com flutuações relacionadas ao tratamento com imunoglobulina humana endovenosa (curso trifásico: relato de caso Fluctuations in Guillain-Barré syndrome related to treatment with intravenous human immunoglobulin (trifasic course: case report

    Directory of Open Access Journals (Sweden)

    MÁRIO EMÍLIO DOURADO

    1998-09-01

    Full Text Available Os autores apresentam um caso de síndrome de Guillain-Barré (SGB, com tetraplegia e ventilação mecânica, que foi tratado com imunoglobulina humana endovenosa (IgEV, 2 g/kg, apresentando melhora clínica inicial, tendo piorado na segunda semana. Foi realizada uma segunda sessão de IgEV, também com melhora inicial, seguida de piora aos 65 dias de doença. Uma terceira etapa de IgEV foi realizada, sendo a melhora definitiva e sem outros episódios após 3 anos de seguimento. Os autores revisam a literatura sobre flutuações relacionadas ao tratamento. Concluem que na SGB é importante uma observação clínica rigorosa nas primeiras semanas após tratamento com IgEV e que seriam necessários estudos para elaborar protocolos alternativos de prevenção nesses casos.The authors report the case of a patient with severe Guillain-Barré syndrome (tetraplegic and on mechanical ventilation, that was treated with intravenous immunoglobulin (IVIg, 2 g/Kg. At first, there was clinical improvement, followed by clinical deterioration two weeks later. On the second course of IVIg there was, again, clinical improvement and then deterioration, 65 days after treatment. Finally, on the third course of treatment definitive recovery was achieved and no more relapses happened so far (three years after the treatment. The authors review the literature about fluctuations related to treatment with IVIg. Conclusions are that these patients should be closely observed during the first weeks after IVIg treatment, and that further studies are still necessary to elaborate alternative protocols on the prevention of these cases.

  12. Avaliação das práticas de adesão à higienização das mãos relacionadas com linhas vasculares em uma Unidade de Terapia Intensiva | Evaluation of hand hygiene practices related to placement of intravascular lines in an intensive care unit

    Directory of Open Access Journals (Sweden)

    Francisca Jane Gomes de Oliveira

    2015-11-01

    Full Text Available O estudo objetivou avaliar a conformidade e não conformidade das práticas de adesão à higienização das mãos com linhas vasculares na prevenção de infecção de corrente sanguínea relacionada ao cateter venoso central de curta permanência. Trata-se de um estudo observacional, com abordagem quantitativa. A casuística baseou-se em 892 avaliações, realizadas através da observação direta, utilizando o Manual de Avaliação da Qualidade de Práticas de Controle de Infecção Hospitalar da Secretaria de Estado da Saúde de São Paulo. Os resultados mostraram que as práticas relacionadas à higienização das mãos apresentaram índice de conformidade geral nulo, evidenciando baixos índices de conformidade individual, principalmente no que se refere à prática de higiene das mãos antes e após a troca do sistema de infusão, apresentando o menor índice de conformidade de todas as práticas observadas (10,3%. Já a prática relacionada à higienização das mãos antes e após a coleta de sangue apresenta melhor índice de conformidade individual (36,1%. Existe a necessidade de elaborar estratégias que assegurem a adesão das práticas de controle e prevenção de infecção de corrente sanguínea relacionada ao cateter venoso central através de aderência ao processo de higienização das mãos, bem como instituir avaliações periódicas das condições de trabalho, no sentido de elevar os índices de conformidade. ============================================= The study aimed to evaluate the compliance and non-compliance of the intensive care unit staff with regard to hand hygiene practices when placing intravascular lines to prevent bloodstream infections related to central venous catheter placement. This was an observational study with a quantitative approach. The study was based on 892 reviews obtained through direct observation using the Manual of Quality Evaluation of Hospital Infection Control Practices of the State

  13. Psychological repercussions related to brachytherapy treatment in women with gynecological cancer: analysis of production from 1987 to 2007 Repercusiones psicológicas relacionadas al tratamiento de braquiterapia en mujeres con cáncer ginecológico: un análisis de la producción de 1987 a 2007 Repercussões psicológicas relacionadas ao tratamento de braquiterapia em mulheres com câncer ginecológico: análise da produção de 1987 a 2007

    Directory of Open Access Journals (Sweden)

    Gisele Curi de Barros

    2008-12-01

    importante pensar en un incremento de esta producción con investigaciones psicológicas que profundicen la comprensión de la vivencia de mujeres sometidas a la braquiterapia.Uma das modalidades radioterápicas para tratamento do câncer ginecológico é a braquiterapia, caracterizada pela colocação de materiais radioativos junto ao tumor. Essa terapêutica pode trazer efeitos colaterais às pacientes. Pensando nas questões emocionais, este trabalho objetivou, através de revisão de literatura, apreender estudos que se referissem a repercussões psicológicas relacionadas ao tratamento de braquiterapia em mulheres com câncer ginecológico. Os resultados revelaram produção embrionária, com apenas um trabalho produzido no Brasil. Houve maior concentração de estudos na área de enfermagem. Os trabalhos centraram-se nas repercussões psicossociais, buscando compreender a experiência das pacientes antes da aplicação, durante essa, e após o término do tratamento, evidenciando conseqüências físicas e psicológicas afetando a qualidade de vida. É importante pensar no incremento dessa produção com pesquisas psicológicas que aprofundem a compreensão da vivência de mulheres submetidas à braquiterapia.

  14. Sintomatologia músculo-esquelética relacionada ao trabalho e sua relação com qualidade de vida em bancários do Meio Oeste Catarinense Work-related musculoskeletal symptoms and its relationship with the quality of life of bank employees' in the Middle West of Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Cristian Robert Mergener

    2008-12-01

    Full Text Available O objetivo deste estudo foi estimar a prevalência de sintomatologia músculo-esquelética relacionada ao trabalho e sua relação com qualidade de vida em bancários do Meio Oeste Catarinense. Realizou-se um estudo transversal envolvendo todos os bancários (N = 263 das agências existentes nos 13 municípios da região. Aplicou-se questionário abordando questões de ordem sociodemográfica, de trabalho e referentes aos sintomas músculo-esqueléticos. Para as questões de qualidade de vida, utilizou-se o questionário WHOQOL-Bref. O relato de sintomatologia músculo-esquelética foi a variável dependente. Procedeu-se análise de regressão logística múltipla para testar a associação entre as variáveis do estudo. A prevalência de sintomatologia músculo-esquelética foi de 72,8%. Os bancários com posição não alternada de trabalho apresentaram prevalência 20% [RP 1,20 (IC95% 1,02-1,41] (p = 0,029 maior de sintomatologia músculo-esquelética comparada a seus colegas que trabalhavam em posições alternadas. A inexistência de pausa na jornada diária mostrou-se associada à ocorrência, obtendo-se uma prevalência 31% [RP 1,31 (IC95% 1,06-1,61] (p = 0,011 maior de sintomatologia músculo-esquelética em comparação aos bancários que tinham pausa. O estudo de correlação entre o número de sintomas músculo-esqueléticos e os aspectos da qualidade de vida mostrou correlações negativas fracas nos domínios psíquico, social e ambiental. Somente o domínio físico apresentou correlação negativa moderada (R = -0,411 (p The objective of the present study was estimate the prevalence of work-related musculoskeletal symptoms and their relationship with the quality of life of bank employees in the Middle West of Santa Catalina. A cross sectional study was carried out involving all bank workers (N = 263 of the 13 cities of the Middle West region of Santa Catalina, Brazil. Questionnaires regarding socio-demographic and work

  15. Uso excessivo do cateter vesical em pacientes internados em enfermarias de hospital universitário

    Directory of Open Access Journals (Sweden)

    Lucieni de Oliveira Conterno

    2011-10-01

    Full Text Available Este estudo de corte incluiu 254 pacientes adultos que usaram cateter vesical (CV durante a hospitalização em enfermarias de um hospital universitário. Foram avaliados: utilização do cateter, indicação, tempo de permanência, densidade de infecção urinária, mortalidade e permanência hospitalar. Durante o período de estudo, 14% dos pacientes internados usaram CV, totalizando 1.735 CV-dia. Em 23% dos casos, o procedimento não foi prescrito, nem sua indicação foi documentada. O tempo médio de uso do CV foi de 6,8 dias. Entre os pacientes clínicos, a indicação do CV foi inadequada em 29%; o tempo de permanência foi considerado inadequado em 49% dos pacientes clínicos e em 66,9% dos pacientes cirúrgicos. Pacientes com uso inadequado do CV tiveram mais infecção do trato urinário (RR 1,86 IC95% 1,4 a 3,04 e maior tempo de permanência hospitalar (11,9 e 8,9 dias, p=0,002. O estudo permitiu identificar no processo assistencial falhas potencialmente modificáveis e importantes para a prevenção da infecção do trato urinário por cateter vesical.

  16. Avaliação de custo-efetividade da passagem de cateter venoso central guiada por ultrassonografia comparada com a técnica convencional sob perspectiva da fonte pagadora

    Directory of Open Access Journals (Sweden)

    Danilo Teixeira Noritomi

    2016-03-01

    Full Text Available RESUMO Objetivo: Avaliar o custo-efetividade da inserção de cateter venoso central guiada por ultrassonografia em tempo real, em comparação com a técnica tradicional, que é baseada na técnica de reparos anatômicos externos, sob a perspectiva da fonte pagadora. Métodos: Uma simulação teórica, baseada em dados de literatura internacional foi aplicada ao contexto brasileiro, ou seja, ao Sistema Único de Saúde (SUS. Foi estruturada uma árvore de decisão, que apresentava as duas técnicas para inserção de cateter venoso central: ultrassonografia em tempo real versus reparos anatômicos externos. As probabilidades de falha e complicações foram extraídas de uma busca nas bases PubMed e Embase, e os valores associados ao procedimento e às complicações foram extraídos de pesquisa de mercado e do Departamento de Informática do Sistema Único de Saúde (DATASUS. Cada alternativa de passagem do cateter venoso central teve um custo calculado por meio do seguimento de cada um dos possíveis caminhos da árvore de decisão. A razão de custo-efetividade incremental foi calculada considerando-se a divisão do custo incremental médio da técnica de ultrassonografia em tempo real comparada à técnica de reparos anatômicos externos pelo benefício incremental médio, em termos de complicações evitadas. Resultados: O custo final médio avaliado pela árvore de decisão, considerando a incorporação da ultrassonografia em tempo real e a redução de custo por diminuição de complicações, para a técnica de reparos anatômicos externos foi de R$262,27 e, para ultrassonografia em tempo real, de R$187,94. O custo incremental final foi de -R$74,33 por cateter venoso central. A razão de custo-efetividade incremental foi -R$2.494,34 por pneumotórax evitado. Conclusão: A inserção de cateter venoso central com auxílio de ultrassonografia em tempo real esteve associada à diminuição da taxa de falhas e complicações, além de

  17. Pulmonary artery catheter complications: report on a case of a knot accident and literature review Complicações do cateter de artéria pulmonar: relato de caso de formação de nó verdadeiro revisão da literatura

    Directory of Open Access Journals (Sweden)

    Marcelo Cruz Lopes

    2004-01-01

    Full Text Available A particular event concerning a Swan-Ganz catheter complication is reported. A 41-year-old woman was admitted at the emergency room of our hospital with massive gastrointestinal bleeding. A total gastrectomy was performed. During the postoperative period in the intensive care unit , the patient maintained hemodynamic instability. Invasive hemodynamic monitoring with a pulmonary artery catheter was then indicated. During the maneuvers to insert the catheter, a true knot formation was identified at the level of the superior vena cava. Several maneuvers by radiological endovascular invasive techniques allowed removal of the catheter. The authors describe the details of this procedure and provide comments regarding the various techniques that were employed in overcoming this event. A comprehensive review of evidence regarding the benefits and risks of pulmonary artery catheterization was performed. The consensus statement regarding the indications, utilization, and management of the pulmonary artery catheterization that were issued by a consensus conference held in 1996 are also discussed in detail.É relatada uma complicação infreqüente , associada ao uso do Cateter de Artéria Pulmonar. Uma paciente de 41 anos foi admitida no Pronto Socorro do nosso hospital com hemorragia digestiva alta grave. A doente foi submetida à gastrectomia total. Na Unidade de Terapia Intensiva, evoluiu com instabilidade hemodinâmica, sendo indicada a monitorização hemodinâmica invasiva com cateter de artéria pulmonar. Durante as manobras para o correto posicionamento do cateter na artéria pulmonar, foi diagnosticado formação de nó verdadeiro, ao nível da veia cava superior. Os autores discutem as várias opções técnicas empregadas para a resolução desta complicação, através do emprego da radiologia intervencionista endovascular. Extensa revisão da literatura procurando discutir os benefícios e riscos envolvidos na monitorização hemodin

  18. Knowledge, attitude and practice related to the pap smear test among users of a primary health unit Conocimiento, actitud y práctica relacionada al examen de colposcopia entre usuarias de una unidad básica de salud Conhecimento, atitude e prática relacionada ao exame colpocitológico entre usuárias de uma unidade básica de saúde

    Directory of Open Access Journals (Sweden)

    Camila Teixeira Moreira Vasconcelos

    2011-02-01

    áveis sociodemográficas. A amostra foi composta por 250 mulheres. O conhecimento, a atitude e a prática sobre o exame foram adequados em 40,4, 28 e 67,6% das entrevistadas, respectivamente. Os resultados encontrados evidenciaram proporções mais altas de conhecimento e atitude adequados com escolaridade (>9 anos e idade (>35 anos. É essencial buscar respostas específicas a respeito dessa problemática, a fim de direcionar ações integradas de educação em saúde, garantindo, assim, o maior acesso, adesão e retorno das mulheres ao exame.

  19. Denervação Renal com Cateter Irrigado em Hipertensos Resistentes: Uma Estratégia Promissora?

    Directory of Open Access Journals (Sweden)

    Luciana Armaganijan

    2014-04-01

    Full Text Available Fundamento: A hipertensão arterial sistêmica constitui importante problema de saúde pública e significativa causa de mortalidade cardiovascular. A elevada prevalência e as reduzidas taxas de controle tensional despertaram o interesse por estratégias terapêuticas alternativas. A denervação simpática renal percutânea surgiu como perspectiva no tratamento de hipertensos resistentes. Objetivo: Avaliar a factibilidade e a segurança da denervação renal com cateter irrigado. Métodos: Dez hipertensos resistentes foram submetidos ao procedimento. O desfecho primário foi a segurança, avaliada por eventos adversos periprocedimento, função renal e anormalidade vascular renal aos 6 meses. Os desfechos secundários constituíram mudanças na pressão arterial (consultório e monitorização ambulatorial e no número de anti-hipertensivos aos 6 meses. Resultados: A média de idade foi de 47,3 (± 12 anos, 90% eram mulheres. No primeiro caso, houve dissecção de artéria renal causada por trauma da bainha, fato que não se repetiu após ajuste técnico, demonstrando efeito da curva de aprendizado. Nenhum caso de trombose/infarto renal ou óbito foi reportado. Não se observou elevação dos níveis séricos de creatinina durante o seguimento. Aos 6 meses, diagnosticou-se um caso de estenose significativa de artéria renal, sem repercussão clínica. A denervação renal reduziu a pressão arterial de consultório, em média, em 14,6/6,6 mmHg (p = 0,4 tanto para pressão arterial sistólica como para a diastólica. A redução média da pressão arterial pela monitorização ambulatorial foi de 28/17,6 mmHg (p = 0,02 e p = 0,07 para pressão arterial sistólica e diastólica, respectivamente. Houve redução média de 2,1 anti-hipertensivos. Conclusão: A denervação renal é factível e segura no tratamento da hipertensão arterial sistêmica resistente. Estudos maiores são necessários para confirmar nossos resultados.

  20. Quebra de cateter no espaço peridural Rotura de catéter en el espacio epidural Breakage of a catheter in the epidural space

    Directory of Open Access Journals (Sweden)

    Cristian Sbardelotto

    2008-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A quebra do cateter peridural durante sua remoção é rara, porém descrita. O conhecimento das possíveis complicações e o manuseio adequado são responsabilidades do anestesiologista. O objetivo deste relato foi apresentar caso de quebra de cateter peridural em analgesia de parto. RELATO DO CASO: Paciente do sexo feminino, 33 anos, GII, PI, deu entrada na maternidade em trabalho de parto. Após duas horas de evolução, a paciente solicitou analgesia. Ao exame, encontrava-se em fase ativa do trabalho de parto, com dilatação cervical de 5 cm, dinâmica uterina regular, bolsa rota, com dor classificada pela Escala Visual Analógica - VAS 10. Iniciada a analgesia de parto pela técnica combinada com dupla punção. Durante a evolução foi feita uma complementação analgésica pelo cateter. Na retirada houve pequena dificuldade e conseqüente rompimento do mesmo. Optou-se pela realização de uma tomografia axial computadorizada e radiografia da região lombar que não mostrou evidência do fragmento do cateter. Visto que a paciente evoluiu assintomática clinicamente, sem sinais de irritação radicular, dor ou infecção, procedeu-se às devidas orientações e alta hospitalar. CONCLUSÕES: Cateteres peridurais em região lombar são, em ocasiões raras, difíceis de remover. Fatores que podem aumentar as chances de formação de nós e risco de quebra do cateter foram relacionados. Neste caso, um dos principais fatores envolvidos foi a introdução excessiva do cateter peridural lombar. Felizmente, as complicações neurológicas são ainda mais raras, e seguindo as diretrizes de uma tração lenta e suave na ausência de parestesias, na maioria das vezes, o cateter é removido com sucesso.JUSTIFICATIVA Y OBJETIVOS: La rotura del catéter epidural durante su retirada es rara, pero ya se ha descrito. El conocimiento de las posibles complicaciones y el manejo adecuado es de total responsabilidad del anestesi

  1. A colocação de cateteres venosos periféricos em ambiente de aulas práticas simuladas e orientadas influência o sucesso da primeira colocação de cateter em contexto real ensino clínico/ estágio?

    OpenAIRE

    Preto, Leonel

    2011-01-01

    O objectivo deste trabalho foi descrever as primeiras punções venosas periféricas, com colocação de cateter, realizadas a pacientes do foro médico-cirúrgico, por alunos de enfermagem em ensino clínico/estágio; relatando as dificuldades sentidas na execução deste cuidado, e relacionando o sucesso na execução da técnica com o tipo de aulas práticas simuladas e orientadas que os alunos previamente tiveram em ensino teórico. Um questionário estruturado foi aplicado aos alunos que terminaram o ...

  2. Atividade antimicrobiana do metronidazol gel associado ao hidróxido de cálcio e ao cimento Portland frente às bactérias anaeróbias relacionadas a reações periapicais do tipo crônica = The antibacterial activity of the metronidazole gel associated with calcium hydroxide and cement portland front the anaerobic bacterias related to cronic periapical lesions

    Directory of Open Access Journals (Sweden)

    Mendonça, Eduarda Rodrigues da Silva

    2007-01-01

    Full Text Available As pesquisas com o intuito de descobrir novas substâncias com finalidade para medicação intracanal é uma realidade. Tem como objetivos principais a melhoria das propriedades dos medicamentos utilizados usualmente, tais como o hidróxido de cálcio para com isso suprir algumas deficiêcias que possam existir. Este trabalho teve como propósito a análise in vitro da ação do metronidazol gel em associação ao hidróxido de cálcio e cimento Portland, como medicação intracanal. Os testes foram realizados em bactérias anaeróbias facultativas, as quais compõe a flora de dentes portadores de reação periapical crônica. O hidróxido de cálcio é, ainda, a medicação intracanal mais utilizada, visto que, possui efeito antibacteriano pronunciado contra a maioria dos microrganismos existentes no interior de canais radiculares infectados. O metronidazol veio a ser testado por possuir capacidade bactericida atuante, principalmente, em bactérias anaeróbias estritas. Podendo atuar nos microrganismos que são resistentes à ação do hidróxido de cálcio. Entretanto, ao término deste experimento, o metronidazol gel quando testado, comparado e associado ao hidróxido de cálcio e cimento Portland não teve resposta superior a ação do hidróxido de cálcio puro como medicação intracanal, tendo o cimento Portland apenas melhorado as propriedades físico/química dessa pasta

  3. Relato de caso: implante transparietohepático de cateter de longa permanência para diálise Case report: transhepatic insertion of long-term dialysis catheter

    Directory of Open Access Journals (Sweden)

    Felipe Nasser

    2007-12-01

    Full Text Available O implante transhepático de cateteres de diálise de longa permanência é um procedimento de exceção, utilizado para obter um acesso em pacientes com oclusão de veias centrais de membros superiores e inferiores. O caso descrito relata um paciente jovem, com história de 15 anos de diálise, que foi submetido no passado a um transplante renal sem sucesso. Esse paciente encontrava-se em urgência dialítica e oclusão comprovada de veias centrais de membros superiores e de veias ilíacas. Foi realizado o implante do cateter de longa permanência pelo acesso transparietohepático sob anestesia geral. A ponta do cateter foi posicionada ao nível do átrio direito. A diálise foi realizada satisfatoriamente no mesmo dia.Transhepatic insertion of long-term dialysis catheter is an exception procedure used to obtain access in patients with central vein occlusion of lower and upper limbs. We report on a case of a young patient with history of dialysis for 15 years, who was submitted to an unsuccessful renal transplantation. This patient was in dialytic emergency and had confirmed occlusion of upper limb central veins and iliac veins. Transhepatic insertion of a long-term catheter was performed under general anesthesia. The catheter tip was placed at the level of the right atrium. Dialysis was satisfactorily performed on the same day.

  4. Caracterização das infecções relacionadas à assistência à saúde em uma Unidade de Terapia Intensiva | Description of Infections Related to Health Care (IRAS of patients in an Intensive Care Unit

    Directory of Open Access Journals (Sweden)

    Francisco Gilberto Fernandes Pereira

    2016-02-01

    Full Text Available Objetivo: Analisar as Infecções Relacionadas à Assistência à Saúde (IRAS de pacientes em Unidade de Terapia Intensiva. Método: Estudo epidemiológico, retrospectivo, realizado em Hospital Universitário de Fortaleza, no período entre 2008 a 2011. Os dados foram coletados por formulário, organizados em tabelas e analisados por meio da estatística descritiva. Resultados: Houve média equilibrada em relação ao sexo e média de idade de 58,3 anos. O tempo de internação e diagnóstico da infecção foi de 21,2 e 11,7 dias, respectivamente. O cateter venoso central foi realizado em 89,3% dos pacientes. A topografia mais incidente foi a respiratória em 48,1%, e a Pseudomonas aeruginosa foi o principal patógeno encontrado em 18,3%. Os antimicrobianos mais utilizados foram os glicopeptídeos, representados pela Vancomicina e Teicoplanina. O desfecho clínico mais frequente foi o óbito em 65,4%. Conclusão: As IRAS no ambiente da terapia intensiva acometem um grande percentual de pacientes, sendo necessário a implementação de estratégias que visem reduzir as estatísticas e promover um ambiente hospitalar seguro. ================================================ Objective: to analyze Infections Related to Health Care (IRAS of patients in an Intensive Care Unit. Method: epidemiological retrospective study conducted at the University Hospital of Fortaleza, between 2008 and 2011. Data were collected, organized in tables, and analyzed using descriptive statistics. Results: equal number of female and male patients; average age of 58.3 years; average length of hospitalization and of diagnosis of infection of 21.2 and 11.7 days, respectively; central venous catheter performed in 89.3% of patients; most frequent topography: respiratory in 48.1% of patients; main identified pathogen: pseudomonas aeruginosa in 18.3% of patients; most used antimicrobials: glycopeptides, represented by vancomycin and teicoplanin; and, most frequent clinical

  5. Levantamento sobre a infecção na inserção do cateter de duplo lúmen Inventario sobre la infección en la inserción del cateter de doble lúmen Survey about infection at the site of a double-lumen catheter insertion

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Helú Mendonça Ribeiro

    2008-01-01

    Full Text Available OBJETIVO: Identificar o índice de infecção, o agente etiológico, as complicações infecciosas e o tempo de permanência do cateter de duplo lúmen em um mesmo período em anos alternados. MÉTODOS: Trata-se de um estudo retrospectivo realizado no Centro de Hemodiálise do Hospital de Base de São José do Rio Preto-SP, e foram incluídos todos os pacientes com infecção no local de inserção do cateter de duplo lúmen. RESULTADOS: Dos 80 pacientes em tratamento hemodialítico no primeiro período de janeiro a junho de 2002, 21% eram portadores de cateter e três anos depois dos 186 pacientes nas mesmas condições, 10,7% apresentavam terapia por cateter. Houve diminuição de infecções da corrente sangüínea de 9,4% no último período. A complicação infecciosa mais freqüente foi a bacteremia, e o agente etiológico mais encontrado o Staphylococcus aureus, o tempo médio de permanência do cateter foi de 43 dias nos dois períodos avaliados. CONCLUSÃO: Este estudo demonstrou que houve melhora significativa quanto aos índices de infecção nessa população.OBJETIVO: Identificar el índice de infección, el agente etiológico, las complicaciones infecciosas y el tiempo de permanencia del catéter de doble lumen en un mismo período en años alternos. MÉTODOS: Se trata de un estudio retrospectivo realizado en el Centro de Hemodiálisis del Hospital de Base de São José de Rio Preto-SP, y fueron incluidos todos los pacientes con infección en el lugar de inserción del catéter de doble lumen. RESULTADOS: De los 80 pacientes en tratamiento hemodialítico en el primer período de enero a junio del 2002, el 21% eran portadores de catéter y tres años después de los 186 pacientes en las mismas condiciones, el 10,7% presentaban terapia por catéter. Hubo disminución de infecciones de la corriente sanguínea del 9,4% en el último período. La complicación infecciosa más frecuente fue la bacteremia, y el agente etiológico m

  6. Detecção da produção de slime por estafilococos coagulase-negativa isolados de cateter venoso central

    Directory of Open Access Journals (Sweden)

    E. L. Pizzolitto

    2009-01-01

    Full Text Available

    A produção de slime é um importante fator de virulência dos estafilococos coagulase-negativa, permitindo-lhes aderir sobre as superfícies lisas de biomateriais, e por isso, é associada aos processos de infecção de implantes. No presente estudo a produção de slime em 27 cepas de estafilococos coagulase-negativa foi investigada por cultura em ágar vermelho Congo (77,7% de positividade, método espectrofotométrico ou da microplaca (81,4% de positividade e microscopia eletrônica de varredura (88,9% de positividade. Foi também avaliada a resistência de estafilococos coagulasenegativa a vários antimicrobianos usando a técnica do disco difusão. A porcentagem de resistência à penicilina G, oxacilina, eritromicina, clindamicina e gentamicina em estafilococos produtores de slime foi respectivamente de 88,9%; 70,4%; 81,5%; 66,7% e 59,2%; todos os estafilococos coagulase-negativa foram vancomicina sensíveis. As cepas isoladas de cateter venoso central foram identificadas por método convencional e sistema API Staph. Os 27 estafilococos coagulase-negativa foram identificados como: S. saprophyticus (3,7%, S. xylosus (7,4%, S. haemolyticus (14,8%, S. epidermidis (37,0%, S. warneri (14,8%, S. lugdunensis (7,4%, S. hominis (7,4%, S. schleiferi (3,7% e S. chromogenes (3,7%. Pode-se concluir que entre a maioria das espécies Staphylococcus coagulase-negativa houve associação entre a produção de slime, origem nosocomial das cepas e reduzida sensibilidade aos antimicrobianos, sugerindo potencial patogênico no ambiente hospitalar. Palavras-chave: estafilococos coagulase-negativa; slime; fatores de virulência; polissacarídeo extracelular; biofilme; sensibilidade aos antimicrobianos.

  7. Manejo do cateter venoso central totalmente implantado em pacientes oncológicos: revisão integrative Manejo del catéter venoso central totalmente implantado en pacientes oncológicos: revisión integrativa Management of totally implanted catheter in patients with cancer: an integrative review

    Directory of Open Access Journals (Sweden)

    Christiane Inocêncio Vasques

    2009-10-01

    Full Text Available O cateter totalmente implantado é amplamente utilizado durante o tratamento de pacientes com câncer e é capaz de minimizar complicações decorrentes da terapia intravenosa periférica. Assim, buscou-se identificar os cuidados de enfermagem relacionados ao manuseio de cateter totalmente implantado nesses pacientes. Para tanto, realizou-se revisão integrativa da literatura que resultou na análise de 15 artigos. O conhecimento produzido está direcionado para o tempo de permanência do cateter, complicações inerentes ao uso, manuseio do dispositivo, percepção do paciente em relação ao cateter e informações ao paciente. Além de demonstrar a complexidade da assistência de enfermagem no manuseio desses dispositivos, os achados podem auxiliar, igualmente, os profissionais que não atuam em oncologia, na aplicação de conhecimentos na prática clínica.El catéter totalmente implantado es ampliamente utilizado durante el tratamiento de pacientes con cáncer y es capaz de minimizar las complicaciones consecuentes de la terapia intravenosa periférica. Así, en este trabajo, se buscó identificar los cuidados de enfermería relacionados a la manipulación del catéter totalmente implantado en esos pacientes. Para tal efecto, se realizó una revisión integrativa de la literatura dando como resultado el análisis de 15 artículos. El conocimiento producido está orientado hacia el tiempo de permanencia del catetér, complicaciones inherentes al uso, manipulación del dispositivo, informaciones y percepción del paciente en relación al catéter. Aparte de demostrar la complejidad de la asistencia de enfermería en la manipulación de esos dispositivos, los hallazgos pueden auxiliar, igualmente, a los profesionales que no actúan en oncología, en la aplicación de conocimientos en la práctica clínica.Totally implanted catheter, which is effective in deceasing complications related to peripheral intravenous therapy, is widely used in

  8. Método bundle na redução de infecção de corrente sanguínea relacionada a cateteres centrais: revisão integrativa Método bundle en la redución de infecciones relacionadas a catéteres centrales: una revisión integrativa Care bundle to reduce central venous catheter-related bloodstream infection: an integrative review

    Directory of Open Access Journals (Sweden)

    Juliana Dane Pereira Brachine

    2012-12-01

    Full Text Available Trata-se de uma revisão integrativa da literatura, que objetivou identificar intervenções baseadas em evidência que compõem o método bundle, designados à redução de infecção de corrente sanguínea relacionada ou associada a cateter intravenoso central. Para a coleta de dados online, em bases nacionais e internacionais, foram utilizados a palavra-chave bundle e os descritores catheter-related infection, infection control e central venous catheterization, resultando, após aplicação dos critérios de inclusão, amostra de quinze artigos. Este trabalho evidenciou cinco intervenções como as mais frequentemente empregadas na construção dos bundles: higienização das mãos, gluconato de clorexidina como antisséptico para pele, uso de barreira máxima de precaução durante a inserção cateter, evitar acessar veia femoral e verificar necessidade diária de permanência do cateter, com sua remoção imediata quando não mais indicado. A maioria dos estudos demonstrou resultados estatisticamente significantes na redução de infecção de corrente sanguínea relacionada ou associada a cateter intravenoso central.Esta es una revisión integradora tuvo como objetivo identificar intervenciones basadas en evidencias que componen método bundle de reducción de infección sanguínea relacionadas o asociadas con catéter intravenoso central. Para recopilar los datos en las bases brasileñas e internacionales, utilizando la palabra clave bundle y los descriptores infecciones relacionadas con catéteres, control de infecciones y cateterización venosa central, identificando, con los criterios de inclusión, muestra de quince artículo. Este estudio muestra cinco intervenciones como comúnmente empleadas en los métodos bundles: higiene de las manos, clorhexidina como antiséptico para la piel, uso de precaución de barrera máxima durante la inserción del catéter, evitar el acceso de la vena femoral y comprobar la necesidad diaria del cat

  9. PL2 production of english word-final consonants: the role of orthography and learner profile variables Produção de consoantes finais do inglês como L2: o papel da ortografia e de variáveis relacionadas ao perfil do aprendiz

    Directory of Open Access Journals (Sweden)

    Rosane Silveira

    2012-06-01

    Full Text Available The present study investigates some factors affecting the acquisition of second language (L2 phonology by learners with considerable exposure to the target language in an L2 context. More specifically, the purpose of the study is two-fold: (a to investigate the extent to which participants resort to phonological processes resulting from the transfer of L1 sound-spelling correspondence into the L2 when pronouncing English word-final consonants; and (b to examine the relationship between rate of transfer and learner profile factors, namely proficiency level, length of residence in the L2 country, age of arrival in the L2 country, education, chronological age, use of English with native speakers, attendance in EFL courses, and formal education. The investigation involved 31 Brazilian speakers living in the United States with diverse profiles. Data were collected using a questionnaire to elicit the participants' profiles, a sentence-reading test (pronunciation measure, and an oral picture-description test (L2 proficiency measure. The results indicate that even in an L2 context, the transfer of L1 sound-spelling correspondence to the production of L2 word-final consonants is frequent. The findings also reveal that extensive exposure to rich L2 input leads to the development of proficiency and improves production of L2 word-final consonants.O presente estudo examina fatores que afetam a produção de consoantes em segunda língua (L2 por aprendizes que foram consideravelmente expostos à língua-alvo em um contexto de L2. Um dos objetivos do presente estudo foi investigar com que frequência os participantes utilizam processos fonológicos que resultam da transferência da correspondência entre ortografia e som da língua materna (L1 para a L2, quando produzem consoantes da língua inglesa em posição de final de palavra. O segundo objetivo consistiu em examinar o relacionamento entre índice de transferência grafo-fonológica e fatores ligados ao

  10. Análise biomecânica de variáveis relacionadas à resistência ao arrancamento dos parafusos do sistema de fixação vertebral Biomechanical analysis of the variables related to the pullout strength of screws in the vertebral fixation system

    Directory of Open Access Journals (Sweden)

    Rodrigo César Rosa

    2008-07-01

    Full Text Available OBJETIVO: Observar a influência do diâmetro do orifício-piloto nos diferentes modos de preparo: sonda de ponta romba, sonda de ponta cortante e broca, com o propósito de avaliar o nível de resistência ao arrancamento de parafusos com diâmetro diverso. MÉTODOS: Parafusos de 5, 6 e 7mm foram inseridos nos corpos de prova de osso bovino. O orifício-piloto foi confeccionado por meio de sonda de ponta romba, sonda de ponta cortante e broca. O diâmetro da perfuração foi menor, igual e maior do que o diâmetro interno do parafuso. Após a inserção dos implantes, nos três diferentes diâmetros para cada modo de preparo do orifício-piloto, foram realizados os ensaios mecânicos de arrancamento. Os ensaios mecânicos realizados em máquina universal de ensaio Emic®, software Tesc 3.13, célula de carga de 2.000N, velocidade de aplicação de força de 2mm/min, pré-carga de 5N e tempo de acomodação de 10 segundos. A propriedade avaliada nos ensaios mecânicos foi a força máxima de arrancamento. RESULTADOS: No grupo de parafusos de 5 e 6mm foi observado aumento na resistência ao arrancamento quando o diâmetro do orifício-piloto era menor que o diâmetro interno do parafuso em todos os modos de preparo (sonda de ponta romba, sonda de ponta cortante e broca. Não foi observada diferença estatística no grupo de parafusos de 7mm para todos os diâmetros de perfuração e modo de preparo do orifício-piloto. CONCLUSÃO: O diâmetro do orifício-piloto influencia a resistência ao arrancamento dos parafusos de sistema de fixação vertebral. A realização de orifício-piloto de diâmetro maior que o diâmetro interno do parafuso reduz a resistência ao arrancamento do implante, independente do modo de preparo do orifício-piloto.OBJECTIVE: To observe the relevance of the pilot hole in the different manners of preparation: dull-tipped probe, cutting-tip probe, and burr, for the purpose of evaluating the level of pullout strength of

  11. Biofilme em cateter vesical de demora e a segurança do paciente: uma revisão da literatura | Biofilm in indwelling urinary catheter and patient safety: a literature review

    Directory of Open Access Journals (Sweden)

    Écila Campos Mota

    2017-08-01

    Full Text Available Introdução: A infecção do trato urinário associada a cateter vesical de demora (ITU-CVD representa cerca de 40,0% das infecções relacionadas à assistência à saúde (IRAS. Objetivo: Identificar através da literatura os principais fatores associados à formação do biofilme em cateter vesical de demora (CVD. Método: Revisão nas bases de dados: Lilacs, Ibecs PubMed e Portal Capes, utilizando os descritores: “infecção do trato urinário”; “cateteres urinários” e “biofilme” de artigos publicados na íntegra entre 2009 e 2016, nos idiomas inglês, espanhol ou português. Resultados: Foram selecionados oito artigos, sendo quatro revisões sistemáticas e quatro estudos observacionais. Os biofilmes nos CVD são formados pela fixação de patógenos que se inicia pela deposição de urina na superfície do cateter. Os fatores associados à formação do biofilme no CVD foram: tipo de microrganismos (87,5%, presença de flagelos, motilidade e produção de urease, conformação estrutural (37,5% em látex (superfícies irregulares hidrofóbicas e hidrofílicas que permitem a adesão e colonização por vários microrganismos, e o sexo feminino (12,5%. Conclusões: a presente revisão identificou os fatores associados à formação do biofilme no CVD e assim contribuiu para a proposição de medidas eficazes na prevenção com foco na segurança do paciente. ============================================= Introduction: Urinary tract infection associated with indwelling urinary catheter accounts for about 40.0% of health care-related infection. Objective: To identify, based on literature review, the factors associated with biofilm formation in an indwelling urinary catheter. Method: An integrative review conducted in the databases: Medline, Lilacs, IBECS, PubMed and Portal Capes, using the descriptors “urinary tract infections”, “urinary catheters” and “biofilm”, with articles published in full between 2009 and 2016 in

  12. Características de solos construídos após mineração de carvão relacionadas ao processo de construção e à composição do material utilizado Constructed soils characteristics after coal mining related to construction process and to material composition utilized

    Directory of Open Access Journals (Sweden)

    Oscar Rafael Gadea Quinõnes

    2008-09-01

    Full Text Available A mineração de carvão a céu aberto envolve a remoção do solo e de camadas geológicas, que devem ser repostos na seqüência original, visando a reabilitação das áreas mineradas. Este processo altera as características originais do solo e da paisagem. Neste sentido, perfis de solos construídos há 24 e 2 anos, em duas áreas mineradas no município de Minas do Leão (RS, foram avaliados quanto ao processo e à composição dos materiais utilizados na construção. Quanto ao processo de construção, foram determinadas as características morfológicas, a densidade, a condutividade hidraulica saturada e a capacidade de infiltração de água no solo. Em relação à composição dos materiais, determinaram-se granulometria, capacidade de traoca de cátions (CTC, teor de carbono orgânico (CO e potenciais de neutralização e acidificação. Em ambas as áreas reconstituídas, o processo de construção aumentou a densidade e diminuiu a condutividade hidráulica saturada e a capacidade de infiltração de água no solo. A granulometria, a CTC e o teor de CO foram similares nas duas áreas amostradas, indicando que o processo de construção e os materiais utilizados foram semelhantes. A diminuição dos potenciais de neutralização e acidificação nos perfis de solos construídos há 24 anos indicou um avanço da sulfurização com o tempo de construção dos solos. Os solos em ambas as áreas apresentam sérias limitações para o desenvolvimento de vegetação, influindo negativamente para a recuperação dessas áreas e de áreas adjacentes.Coal stripmining involves the removal of upper soil and geological layers, which must be relocated in a similar way that in the original profile when reconstructing the landscape. As this process changes soil and landscape characteristics, this study evaluated changes related to composition of materials and construction process in soils reconstructed 2 and 24 years ago, in Boa Vista Coal Mining

  13. Ablação de arritmias por cateter com mapeamento eletroanatômico exclusivo: uma série de casos

    Directory of Open Access Journals (Sweden)

    Leonardo Martins Pires

    2013-09-01

    Full Text Available FUNDAMENTO: A ablação por cateter possibilita tratamento curativo para diversas arritmias cardíacas. A fluoroscopia é utilizada para localizar e direcionar os cateteres aos pontos causadores de arritmias. Contudo, a fluoroscopia apresenta diversos riscos. O mapeamento eletroanatômico (MEA apresenta imagem tridimensional sem utilizar raios X, reduzindo os riscos da fluoroscopia. OBJETIVO: Descrevemos uma série de pacientes nos quais foi realizada ablação de arritmias cardíacas com o uso exclusivo de MEA. MÉTODOS: Foram selecionados prospectivamente, de março de 2011 a março de 2012, pacientes com arritmias cardíacas refratárias ao tratamento farmacológico para realização de ablação de arritmias com o uso exclusivo de MEA. Não participaram aqueles com indicação de estudo eletrofisiológico diagnóstico e ablação de fibrilação atrial, taquiarritmias de átrio esquerdo e arritmia ventricular hemodinamicamente instável. Observamos tempo total de procedimento, taxa de sucesso, complicações e se ocorreu necessidade de uso de fluoroscopia durante o procedimento. RESULTADOS: Participaram 11 pacientes, sendo sete do sexo feminino (63%, com idade média de 50 anos (DP ± 16,5. As indicações dos procedimentos foram quatro casos (35% de flutter atrial, três casos (27% de síndrome de pré-excitação, dois casos (19% de taquicardia supraventricular paroxística e dois casos (19% de extrassístoles ventriculares. A média de duração do procedimento foi de 86,6 min (DP ± 26 min. O sucesso imediato (na alta hospitalar do procedimento ocorreu em nove pacientes (81%. Não houve complicações durante os procedimentos. CONCLUSÃO: Neste estudo, foi demonstrado que é viável a realização de ablação de arritmias apenas com o uso do MEA, com resultados satisfatórios.

  14. Posição socioeconômica e duração do benefício por incapacidade devido a doenças musculoesqueléticas relacionadas ao trabalho Socioeconomic position and duration of disability benefit due to work-related musculoskeletal disorders

    Directory of Open Access Journals (Sweden)

    Norma Suely Souto Souza

    2012-02-01

    Full Text Available Neste estudo, estima-se o efeito da posição socioeconômica sobre a duração dos benefícios por incapacidade devido a doenças musculoesqueléticas. Dados de um inquérito conduzido pela Auditoria Regional do Instituto Nacional do Seguro Social, com todos os segurados que receberam benefício por incapacidade temporária por doenças musculoesqueléticas da região cervical e membros superiores, em 2008, juntamente com os registros administrativos, foram utilizados para formar uma coorte de 563 trabalhadores. Todos eram residentes em Salvador, Bahia. Entre os trabalhadores sindicalizados e com alta demanda psicossocial no trabalho, a posição socioeconômica se associava positivamente com a duração do benefício (RR = 1,89; IC95%: 1,25-2,87. Esses resultados correspondem ou a uma situação de iniquidade ou ao uso desnecessário do seguro pelos trabalhadores com posição socioeconômica alta. Investigações futuras que visem a elucidar as diferenças na utilização dos benefícios são necessárias para subsidiar a abordagem apropriada dessa questão pelos gestores do seguro social.This study estimated the effect of socioeconomic position on the duration of disability benefits due to musculoskeletal disorders affecting the neck and/or upper limbs. A cohort study including 563 insured workers from the city of Salvador, Bahia, Brazil, registered inthe General Social Security System and who received temporary disability benefits due to musculoskeletal disorders affecting the neck and/or upper limbs, , was performedin 2008 using data from the National Social Security Institute. The results show that among union member workers with high psychosocial demands at work, those with low socioeconomic status are almost twice as likely to receive benefit for a shorter period of time compared to those with a higher socioeconomic position (RR = 1.89; 95%CI: 1.25-2.87. These results reveal aninequitable situation or unnecessary use of insurance for

  15. Conhecimento de enfermeiros de Neonatologia acerca do Cateter Venoso Central de Inserção Periférica

    Directory of Open Access Journals (Sweden)

    Marcela Patricia Macêdo Belo

    2012-02-01

    Full Text Available O Cateter Central de Inserção Periférica (PICC vem sendo utilizado como acesso venoso seguro para neonatos de risco. Objetivou-se descrever o conhecimento e prática dos enfermeiros das cinco unidades públicas de Terapia Intensiva Neonatal, de Recife-PE, sobre a utilização do PICC. A amostra foi composta por 52 enfermeiros; os dados foram coletados de janeiro a fevereiro de 2010. Nos resultados verificou-se que 64,8% dos enfermeiros não possuíam habilitação para inserção do PICC. Apenas duas unidades utilizavam o PICC rotineiramente. Sobre a indicação desse acesso, houve nível de acerto acima de 70%. Na unidade B apenas 8,3% dos enfermeiros referiram localização inicial adequada da ponta do cateter. Conclui-se que é necessário maior incentivo à capacitação dos enfermeiros para utilização do PICC.

  16. Differences in morphological and physiological leaf characteristics between Tabebuia aurea and T. impetiginosa is related to their typical habitats of occurrence Diferenças em características morfológicas e fisiológicas foliares entre Tabebuia aurea e T. impetiginosa estão relacionadas aos seus ambientes típicos de ocorrência

    Directory of Open Access Journals (Sweden)

    Juliana Pfrimer Capuzzo

    2012-09-01

    condições semelhantes de alta luminosidade. A espécie savânica apresentou maiores valores de espessura foliar, massa foliar específica, espessura do pecíolo, assimilação máxima de CO2, condutância estomática, transpiração e concentração foliar de carotenóides. A espécie de mata destacou-se pelos maiores valores de área foliar específica, comprimento do pecíolo e de assimilação de CO2 em base de massa, parâmetros que contribuem para maior taxa de crescimento e de tolerância ao sombreamento. Esta distinção funcional entre as duas espécies em vários atributos foliares, mesmo quando situadas num mesmo tipo de ambiente, pode ser o resultado da história evolutiva dessas espécies em resposta às diferentes pressões seletivas nos ambientes típicos de ocorrência.

  17. Propriedades físico-químicas relacionadas ao desenvolvimento de membranas de Nafion® para aplicações em células a combustível do tipo PEMFC Physicochemical properties related to the development of Nafion® membranes for application in fuel cells

    Directory of Open Access Journals (Sweden)

    Carlos E. Perles

    2008-01-01

    Full Text Available Embora não seja tecnologia recente, as células a combustível ou Fuel Cells (FC continuam recebendo grande atenção, pois são consideradas como "fontes de energia do futuro" devido a características como alto rendimento energético e baixa emissão de poluentes, permitindo a extensão o tempo de vida das reservas fósseis e contribuindo para a melhoria da qualidade de vida. Atualmente, as pesquisas estão direcionadas, principalmente, ao desenvolvimento de FC para aplicações em sistemas móveis e portáteis. De todas as tecnologias existentes, a mais promissora para essa finalidade é a célula a combustível de eletrólito polimérico, conhecida como PEMFC (Polymer Electrolyte Fuel Cell cuja pesquisa encontra-se focada, principalmente, no desenvolvimento de membranas poliméricas, com o objetivo de reduzir os custos de produção. Este trabalho será focado nos aspectos físico-químicos do desenvolvimento de membranas poliméricas. Serão discutidos aspectos estruturais do Nafion® relacionado-os as seguintes propriedades físico-químicas: fluxo eletrosmótico, permeabilidade gasosa, transporte de água através da membrana, estabilidade química e térmica. Toda a discussão será realizada para polímeros perfluorados, utilizando o Nafion® como modelo representante dessa classe de polímeros.Fuel Cells (FC continue to receive growing attention, in spite of not being a new technology, for they are considered as the "energy source of the future" owing to characteristics such as high energetic yield and low emission of pollutants. FC technology may lead to a reduction in the negative impact from energy sources on the enviroment, thus improving the quality of life and extending the lifetime of fossil combustible reserves. The mainstream of research in FC is now directed at mobile, portable systems, for which the most promising technology is the Polymer Electrolyte Fuel Cells, also known as PEMFC (Polymer Electrolyte Fuel Cell. Research

  18. Shifts in composition of avian communities related to temperate-grassland afforestation in southeastern South America Alterações na composição de comunidades de aves relacionadas ao florestamento de campos temperados no sudeste da América do Sul

    Directory of Open Access Journals (Sweden)

    Rafael A. Dias

    2013-03-01

    plantações de eucalipto e campos nativos no sul do Brasil entre 2006-2009 e nos valemos de amostragem e análise aninhada para separar os efeitos do florestamento da variabilidade natural dos campos. Registramos uma diferença significativa na composição entre as assembleias de aves do campo e de plantações de eucalipto. Espécies adaptadas a áreas abertas destituídas de árvores foram afetadas negativamente pelo florestamento, ao passo que aves florestais ou de borda de floresta foram favorecidas pela plantação de eucalipto. O florestamento está sistematicamente substituindo a assembleia de aves de campos de topos de morros por uma coleção de espécies de floresta e de borda comuns em matas ciliares e de encosta. Apesar de a maioria das espécies campestres afetadas negativamente pelas plantações de árvores serem comuns e de ampla distribuição, as taxas de florestamento observadas e previstas no sudeste da América do Sul podem gerar reduções populacionais regionais num futuro próximo.

  19. Cateter venoso profundo recoberto com antibiótico para reduzir infecção: estudo piloto Antibiotic coated catheter to decrease infection: pilot study

    Directory of Open Access Journals (Sweden)

    Pedro Kurtz

    2008-06-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A bacteremia associada a cateter venoso central (CVC aumenta a morbidade e mortalidade hospitalar em pacientes internados em unidade de terapia intensiva (UTI. Os cateteres recobertos com rifampicina e minociclina (RM reduzem a freqüência de colonização e bacteremia. No entanto, resultados de estudos recentes questionaram o seu impacto clínico. O objetivo deste estudo foi comparar a incidência de colonização e bacteremia associada à CVC recobertos com RM e não recobertos numa coorte de pacientes admitidos em UTI. METODO: Estudo prospectivo, controlado em UTI mista clínico-cirúrgica. Os pacientes receberam um CVC recobertos com RM ou não recoberto. Após remoção do CVC, foi feita cultura de ponta do cateter e hemoculturas foram coletadas. Avaliou-se a freqüência de colonização e bacteremia. RESULTADOS: Cento e vinte CVC foram inseridos e 100 puderam ser avaliados, 49 no grupo não recobertos e 51 no grupo recoberto. As características clínicas foram similares nos 2 grupos. Dois casos de bacteremia associada ao cateter (BAC (3,9% ocorreram em pacientes que receberam CVC recobertos com RM comparado a 5 (10,2% casos de BAC no grupo não recobertos (p = 0,26. Seis (11,8% cateteres recobertos foram colonizados, comparados a 14 (28,6% no grupo não recoberto (p = 0,036. A análise de Kaplan-Meier não demonstrou diferença no risco de colonização ou BAC entre os dois grupos estudados. A taxa de BAC foi de 4,7 por 1000 cateteres-dia no grupo com CVC recobertos e 11,4 por 1000 cateteres-dia no grupo que recebeu cateteres não recobertos (p = 0,45. CONCLUSÕES: Neste estudo piloto, demonstrou-se menor freqüência de colonização em cateteres recobertos com RM, quando comparados a cateteres não recobertos. A freqüência de BAC não foi diferente entre os dois grupos.BACKGROUND AND OBJECTIVES: Nosocomial catheter related bloodstream infections (CR-BSI increase morbidity and mortality in critically ill

  20. Questões relacionadas ao gênero no diagnóstico e classificação de transtornos por uso de álcool entre pacientes mexicanos que buscam serviços especializados Gender-related issues in the diagnosis and classification of alcohol use disorders among Mexican patients seeking specialized services

    Directory of Open Access Journals (Sweden)

    Shoshana Berenzon

    2011-05-01

    Full Text Available OBJETIVO: O objetivo do estudo foi examinar o papel do gênero no endosso dos sintomas incluídos tanto na Classificação Internacional de Doenças-10ª Edição quanto no Manual Diagnóstico e Estatístico de Transtornos Mentais-4ª Edição. MÉTODO: Seiscentos pacientes tratados por problemas ligados ao álcool em serviços ambulatórios de saúde no México foram avaliados com o Módulo sobre Abuso de Substâncias da Composite International Diagnostic Interview. RESULTADOS: A análise fatorial confirmatória com a Classificação Internacional de Doenças-10ª Edição e o Manual Diagnóstico e Estatístico de Transtornos Mentais-4ª Edição produziu dois fatores, que incluíram uma combinação de abuso/uso nocivo de álcool e sintomas de dependência, que explicaram 40% e 49,2% da variância total, respectivamente. No grupo de pacientes abuso/uso nocivo, os sintomas e as consequências sociais diferiram entre os gêneros: síndrome de abstinência, falta de controle e problemas jurídicos foram mais frequentes nos homens, enquanto as mulheres apresentaram maiores taxas de tentativas de abandonar o álcool e dificuldades para realizar atividades diárias. Fatores específicos de gênero diferenciaram abuso/uso nocivo da dependência, como a perda de controle e o tempo gasto para beber, no caso dos homens, e do desejo de beber entre as mulheres, de acordo com os critérios de dependência do Manual Diagnóstico e Estatístico de Transtornos Mentais-4ª Edição, e presença de sintomas físicos em homens, problemas sociais/família, e desejo e esforço fútil de parar de beber em mulheres, segundo o critério de dependência da Classificação Internacional de Doenças-10ª Edição. CONCLUSÃO: Futuros sistemas de classificação da toxicomania devem levar em conta as diferenças entre os sexos, a fim de ajudar a suprimir a lacuna de tratamento para as mulheres.OBJECTIVE: The objective of the study was to examine the role of gender in the

  1. Capacidade de enraizamento de estacas de Maytenus muelleri Schwacke com a aplicação de ácido indol butírico relacionada aos aspectos anatômicos Rooting capacity of Maytenus muelleri Schwacke cuttings with indolebutyric acid application related to anatomical aspects

    Directory of Open Access Journals (Sweden)

    D.M. Lima

    2011-01-01

    Full Text Available A espinheira-santa (Maytenus muelleri - Celastraceae é a planta medicinal nativa do Sul do Brasil, cujas folhas são tradicionalmente utilizadas pela medicina popular para o tratamento de úlceras e outros problemas gástricos. Existem poucos trabalhos publicados sobre a produção de mudas e técnicas de propagação vegetativa da espécie. A propagação de espinheira-santa por estaquia poderia ser um método eficiente para obtenção de material homogêneo, com características genéticas desejáveis, produzido a partir de plantas matrizes selecionadas. O presente trabalho teve por objetivo estudar os efeitos da aplicação de ácido indol butírico (AIB, em solução e em pó, no enraizamento de estacas de espinheira-santa coletadas nas quatro estações do ano (abril/2005 a janeiro/2006, bem como averiguar, por meio de análises anatômicas e histoquímicas das estacas, a presença de possíveis impedimentos à iniciação do enraizamento adventício. Estacas provenientes de ramos de plantas matrizes de seis anos cultivadas da Estação Experimental do Canguiri, Pinhais, PR, foram coletadas e tratadas com AIB (0, 1500, 3000 mg L-1 ou mg kg-1, em solução alcoólica (50% v/v e em talco. Aos 365 dias foram avaliadas as porcentagens de estacas enraizadas e mortas, número e comprimento médio de raízes formadas por estaca. Análises anatômicas e histoquímicas com lugol e cloreto férrico foram realizadas. A estação mais promissora para o enraizamento foi o verão/2006 com 62,50% para o tratamento controle, devido à menor lignficação dos ramos no período de intenso crescimento vegetativo. O número médio de raízes formadas por estaca foi de 6,94 (solução e o comprimento médio de raízes formadas/estaca chegou a 4,82 cm nesta mesma estação. As concentrações de AIB aplicadas não foram eficientes na indução radicial, independentemente do modo de aplicação. Foi detectada a presença de uma camada quase contínua de fibras e

  2. Trombectomia com cateter de Fogarty no tratamento da tromboflebite jugular experimental em eqüinos Thrombectomy with Fogarty's catheter as a treatment of induced jugular thrombophlebitis in horses

    Directory of Open Access Journals (Sweden)

    Carlos A. Hussni

    2009-01-01

    Full Text Available Trombose da veia jugular é problema freqüente na medicina eqüina, implicando muitas vezes em conseqüências fatais. O objetivo deste trabalho foi avaliar em eqüinos a aplicabilidade da trombectomia com cateter de Fogarty, técnica rotineiramente empregada pela medicina humana, no restabelecimento da perviedade vascular. Foram utilizados 10 eqüinos divididos em dois grupos de cinco animais, em que se induziu a trombose da veia jugular direita, através do acesso cirúrgico à veia e aplicação de sutura estenosante e injeção de glicose a 50%. No grupo controle avaliou-se a evolução da tromboflebite sem qualquer tipo de intervenção terapêutica. Os animais do grupo tratado foram submetidos à trombectomia com cateter de Fogarty. Foram avaliados os parâmetros clínicos gerais, regionais, ultra-sonográficos e angiográficos, nos momentos pré-indução (M-PRÉ, indução da trombose (MTI e 10 dias de evolução da trombose (M10. A técnica empregada induziu a tromboflebite, que obstruiu completamente um segmento da veia jugular de todos os animais. Os animais do grupo controle mantiveram os trombos obstruindo totalmente o lume vascular até o final do período de avaliação, sendo que avaliações regionais mostraram principalmente o edema parotídeo e o ingurgitamento vascular, cranial à tromboflebite da veia jugular. O grupo tratado apresentou as veias jugulares pérvias ao final do experimento, confirmadas pelos exames ultra-sonográficos e angiográficos, com remissão total dos sinais clínicos. Concluiu-se que a técnica da trombectomia com cateter de Fogarty foi eficiente na desobstrução da veia jugular submetida à trombose experimental.Thrombosis of jugular vein is a common problem in the equine medicine, implying frequently in fatal outcomes. The diagnosis is relatively simple, based on the clinical findings, angiographics images and ultrasonographycs. The therapeutic employed to a large extent of the cases is

  3. Lesiones bucales relacionadas con las enfermedades digestivas

    Directory of Open Access Journals (Sweden)

    José A. Pacho Saavedra

    2006-09-01

    Full Text Available Muchas de las lesiones de la mucosa en la cavidad bucal están relacionadas con trastornos anatómicos y funcionales de los órganos del aparato digestivo; algunas forman parte del cuadro clínico de la entidad y otras aparecen como complicaciones de estas. Generalmente son de orígenes inmunológicos, nutricionales o carenciales. Estas lesiones son difíciles de tratar, por lo que es importante conocer las características clínicas que faciliten una adecuada interpretación y al mismo tiempo ofrecer una conducta terapéutica correcta. Se presenta una revisión actualizada de las características semiológicas de las lesiones bucales que forman parte del cuadro clínico de diversas enfermedades digestivas, con el fin de que los médicos generales, clínicos, estomatólogos y gastroenterólogos puedan diagnosticarlas y brindar mejor orientación y tratamiento a los pacientes.Many of the lesions of the mucosa in the oral cavity are related to anatomical and functional disorders of the organs of the digestive system. Some of them are part of the clinical picture of the entity and others appear as complications of them. Generally, they have an immunological, nutritional, or deficiency origin. These lesions are difficult to be treated and that's why it is important to know the clinical characteristics making easy an adequate interpretation, and to follow a suitable therapeutic conduct at the same time. An updated review of the semiological features of the oral lesions corresponding to the clinical picture of diverse digestive diseases is presented, so that the general physicians, clinicians, stomatologists and gastroenterologists be able to diagnose and give a better guidance and treatment to the patients.

  4. Differences in exoenzyme production and adherence ability of Candida spp. isolates from catheter, blood and oral cavity Diferenças na produção de exoenzimas e habilidade de aderência entre isolados de espécies de Candida provenientes do cateter, sangue e cavidade bucal

    Directory of Open Access Journals (Sweden)

    Carolina Rodrigues Costa

    2010-06-01

    élula epitelial foi contada. Uma porcentagem de 88,1 e 55,9% de C. albicans e 69,8 e 37,7% de isolados de Candida não albicans produziram proteinase e fosfolipase, respectivamente. Candida não albicans obtidas do cateter foram mais proteolíticos que isolados de Candida albicans (p < 0,001. Isolados do sangue foram mais proteolíticos do que isolados do cateter e cavidade bucal, enquanto isolados da cavidade bucal produziram mais fosfolipase do que aqueles isolados do sangue e cateter. C. albicans isoladas da cavidade bucal e do cateter foram mais aderentes à célula epitelial bucal do que isolados de Candida não albicans, mas não houve diferença na adesão entre os três locais analisados. Os resultados indicaram diferenças na produção de fosfolipase e proteinase e na habilidade de adesão à célula epitelial bucal entre os isolados de Candida das diferentes fontes. Este estudo sugere que a patogenicidade de Candida spp pode estar correlacionada ao local infectado.

  5. Poluição química relacionada ao ar de interiores no Brasil

    Directory of Open Access Journals (Sweden)

    Gioda Adriana

    2003-01-01

    Full Text Available During the last two decades there has been increasing concern within the scientific community related to the effects of indoor air quality on health. Changes in building design devised to improve energy efficiency and new synthetic building materials have contributed to increase pollutant concentrations. These factors have generated poor air quality and caused the development of a lot of symptoms known as Sick Building Syndrome (SBS. In Brazil, there are few studies in this area, collected in this review to support researches and awareness of the need to adopt preventive measures to reach a better quality for the Indoor Environment.

  6. Psicodiagnóstico de síndromes dolorosas cronicas relacionadas ao trabalho

    OpenAIRE

    Cruz,Roberto Moraes

    2001-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina - Centro Tecnológico. O objetivo desta pesquisa foi desenvolver um método de investigação dos transtornos psicológicos em síndromes dolorosas crônicas de incidência músculo-esquelética. Partimos do pressuposto, e tomando como base as principais teorias e pesquisas correntes em saúde mental e trabalho, de que existem relações recíprocas entre as síndromes dolorosas e o desenvolvimento de transtornos psicológicos, produzidas ou suscet...

  7. Proteinas relacionadas con el metabolismo del hierro corporal

    National Research Council Canada - National Science Library

    Parra-Sosa, Beatriz Elena; Corrales-Agudelo, Vanessa; Burgos-Herrera, Luis Carlos

    2016-01-01

    ...; sin embargo, los estudios y analisis realizados se basan en proteinas especificas y pocos integran, en un solo texto, las caracteristicas de estas moleculas relacionadas con el metabolismo del hierro corporal. Objetivo...

  8. A percepção do paciente referente a ser portador de um cateter de longa permanência La percepción del paciente respecto a ser portador de un catéter de permanencia prolongada Patients' perception regarding the use of a long-term catheter

    Directory of Open Access Journals (Sweden)

    Fernanda Titareli Merizio Martins

    2008-09-01

    Full Text Available Este trabalho buscou avaliar a percepção do paciente portador de Cateter Totalmente Implantado (CTI. Trata-se de um estudo descritivo, que utiliza a Técnica dos Incidentes Críticos (IC para análise dos dados. Foi desenvolvido em um Hospital Escola do interior paulista do qual participaram 15 portadores de CTI. Os dados foram agrupados em quatro categorias: Desempenho de Atividades (40% dos IC demonstraram maior independência do paciente e 60% evidenciaram restrição de algum tipo de atividade devido ao CTI; Alteração da Imagem Corporal (57% evidenciaram insatisfação do paciente pós-implante do CTI, 14% dos IC mostraram problemas pré-implante do CTI e 28% dos IC mostraram que o CTI favoreceu a estética corporal; Implantação do Cateter (75% dos IC mostraram a implantação do cateter como um procedimento traumatizante e 25% dos IC permaneceram tranqüilos e seguros durante o procedimento; Infusão de Quimioterapia (100% dos IC apontaram o cateter como um facilitador do tratamento quimioterápico.La finalidad del trabajo fue evaluar la percepción del paciente portador de un Catéter Totalmente Implantado (CTI. Se trata de un estudio descriptivo, que utiliza para el análisis de los datos la Técnica de los Incidentes Críticos (IC. Fue desarrollado en un Hospital Escuela del interior de Sao Paulo-Brasil, del cual participaron 15 portadores de CTI. Los datos fueron agrupados en 4 categorías: Desempeño de Actividades (el 40% de los IC demostraron mayor independencia del paciente, mientras que el 60% evidenció restricción de algún tipo de actividad debido al CTI; Alteración de la Imagen Corporal (el 57% evidenciaron insatisfacción post implante del CTI, el 14% mostró problemas pre-implante del CTI y el 28% de los IC mostró que el CTI favoreció la estética corporal; Implantación del Catéter (el 75% de los IC mostraron que la implantación del catéter es un procedimiento traumatizante, mientras que el 25% de los IC mostr

  9. Insuficiencia renal aguda relacionada con medicamentos en pacientes hospitalizados

    Directory of Open Access Journals (Sweden)

    Lujan Iavecchia

    2015-11-01

    Conclusiones: La mitad de los episodios de IRA intrahospitalaria se relacionaron con medicamentos. Los pacientes con IRA relacionada con medicamentos presentaron más antecedentes patológicos cardiovasculares, pero menos factores de riesgo de IRA y una menor mortalidad.

  10. Incapacidade relacionada à dor lombar crônica: prevalência e fatores associados

    Directory of Open Access Journals (Sweden)

    Marina de Góes Salvetti

    2012-10-01

    Full Text Available A incapacidade relacionada à dor lombar crônica (DLC é um fenômeno complexo e multifatorial. O objetivo desse estudo foi identificar a prevalência e os fatores associados à incapacidade em pacientes com dor lombar crônica. Estudo transversal com amostra composta por 177 pacientes com DLC, de três serviços de saúde; que responderam ao formulário com dados demográficos, ao Inventário de Depressão de Beck, às Escalas Oswestry Disability Index, de autoeficácia para dor crônica, Tampa de Cinesiofobia e de Fadiga de Piper. A prevalência de incapacidade foi de 65% (IC95%: 57,5 - 72,0 e era de moderada a grave em 80,7% dos pacientes. O modelo de regressão múltipla identificou três fatores independentemente associados à incapacidade: ausência de trabalho remunerado, autoeficácia baixa e depressão. Os fatores associados à incapacidade identificados são modificáveis. Intervenções como recolocação no trabalho, tratamento para a depressão e reconceitualização da crença de autoeficácia podem ter um impacto importante na prevenção e redução de incapacidade.

  11. Tratamento das uropatias obstrutivas fetais: experiência com novo cateter A new catheter in the treatment of fetal obstructive uropathies

    Directory of Open Access Journals (Sweden)

    Ana Paula B.M. Lopes

    1998-04-01

    Full Text Available A abordagem das uropatias diagnosticadas no período pré-natal é controversa, principalmente, porque o prognóstico desses fetos é variável. Contudo, trabalhos pioneiros têm demonstrado que a drenagem pré-natal do trato urinário obstruído pode melhorar o resultado em fetos selecionados. O objetivo deste trabalho é relatar a experiência do Serviço no tratamento das lesões obstrutivas do trato urinário, utilizando o cateter desenvolvido no Centro de Medicina Fetal do Hospital das Clínicas da UFMG. No total, 25/25 fetos com uropatia obstrutiva receberam o cateter. Três fetos necessitaram de mais de uma inserção; 10 dos 25 fetos que receberam o cateter (40% sobreviveram com boa função renal e pulmonar pós-natal. Ocorreram complicações em 12/25 casos (48% incluindo 6 com drenagem inadequada ou migração do cateter (24%; 1/25 (4% ascite urinária; 1/25 (4% descolamento prematuro de placenta; 1/25 (4% rutura prematura de membrana; 2/25 (08% trabalho de parto prematuro; 01/25 (04% fibrose ou cicatrização do parênquima renal. Três dos 25 fetos (12% morreram intra-útero e 12 (48% fetos morreram no período neonatal. Concluindo, a drenagem do trato urinário com esse cateter provou ser tecnicamente possível e segura para mãe e feto, com uma taxa de sobrevida de 40%.Management of prenatally diagnosed uropathies is controversial, mainly because the prognosis for these fetuses is quite different. However pioneering studies have shown that prenatal drainage of obstructed urinary tract can improve the outcome of selected fetuses. The aim of this study is to describe the experience of the Service with the treatment of fetal obstrutive uropathy with the catheter developed by the Centro de Medicina Fetal do Hospital das Clínicas da UFMG. A total of 25 fetuses with obstructive uropathy received the catheter. Three fetuses required more than one insertion. Ten of 25 (40% shunted fetuses survived with good postnatal renal and pulmonary

  12. Cuidados com cateter central de inserção periférica no neonato: revisão integrativa da literatura Cuidados con catéter central de inserción periférica en el neonato: revisión integrativa de la literatura Peripherally inserted central catheter care in neonates: an integrative literature review

    Directory of Open Access Journals (Sweden)

    Derdried Athanasio Johann

    2012-12-01

    Full Text Available O cateter central de inserção periférica é tecnologia comum empregada na terapia intravenosa de neonatos. Trata-se de revisão integrativa, cujo objetivo foi investigar e analisar as evidências disponíveis na literatura acerca da temática. As bases de dados pesquisadas foram Literatura Latino-Americana e do Caribe em Ciências da Saúde (LILACS e Biblioteca Nacional de Medicina dos Estados Unidos (PubMed. Resultados apontam lacunas no que tange à população neonatal; conhecimento insuficiente dos profissionais quanto indicações (n=1; e variados temas sobre uso de anticoagulantes (n=6, comparação com outros cateteres (n=4, diagnóstico por imagem (n=2, dor (n=2, infecção relacionada a cateter e sua prevenção (n=7, entre outros fatores. Conclui-se que há necessidade de atualização profissional, evidências científicas de fácil acesso e publicações nacionais.El catéter central de inserción periférica es una tecnología común empleada en terapia endovenosa de neonatos. Se trata de una revisión integrativa, cuyo objetivo fue investigar y analizar las evidencias disponibles en la literatura acerca de la temática. Se investigaron las bases de datos Literatura Latinoamericana y del Caribe en Ciencias de la Salud (LILACS y la Biblioteca Nacional de Medicina de los Estados Unidos (PubMed. Los resultados expresan omisiones en lo referente a la población neonatal; conocimiento insuficiente de los profesionales al respecto de las indicaciones (n=1, diagnóstico por imagen (n=2, dolor (n=2, infección relacionada al catéter y su prevención (n=7, entre otras. Se necesita de actualización profesional; evidencias científicas de fácil acceso y publicaciones nacionales.The peripherally inserted central catheter is a common technology employed in the intravenous therapy of neonates. This integrative review was performed with the objective to investigate and analyze the evidence available in the literature regarding this

  13. Ablação por cateter com radiofreqüência de vias acessórias esquerdas por abordagem transeptal Radiofrequency catheter ablation of left accessory pathways by transeptal approach

    Directory of Open Access Journals (Sweden)

    Márcio Augusto Silva

    2006-05-01

    Full Text Available OBJETIVO: Estudar uma série de pacientes submetidos a ablação por cateter, com radiofreqüência (RF de vias acessórias (VA esquerdas mediante abordagem transeptal (TS, comparando-os aos pacientes submetidos ao mesmo tipo de procedimento por abordagem arterial retrógrada (AR convencional. MÉTODOS: Cem pacientes consecutivos (56 masculinos; 34,3 ± 11 anos de idade, portadores de 100 VA esquerdas (62 manifestas e 38 ocultas foram submetidos a ablação por cateter por via TS (50 pacientes e por via AR (50 pacientes, de forma alternada. A análise foi baseada na intenção de tratar. RESULTADOS: A punção transeptal foi realizada com sucesso em 48 (96% pacientes. Por esse acesso foi obtido sucesso primário na ablação em todos os pacientes e nenhuma complicação foi observada. Ao compararmos com o grupo AR não verificamos diferença em relação ao sucesso primário (p = 0,2, taxa de recorrências (p = 1,0, tempos de fluoroscopia (p = 0,63 e total (p = 0,47. No grupo AR um paciente apresentou complicação vascular. A abordagem TS proporcionou um menor tempo de ablação (p = 0,01 e número de aplicações de RF (p = 0,003 em relação à abordagem AR convencional. As recorrências e insucessos da primeira sessão de cada grupo foram submetidos a novo procedimento pela técnica oposta (cross-over, obtendo-se assim um sucesso final na ablação de 100%. CONCLUSÃO: As abordagens TS e AR apresentam eficácia e segurança semelhantes para ablação de vias acessórias esquerdas. O tempo de ablação e o número de aplicações de RF foram menores com a abordagem TS. Quando as técnicas foram utilizadas de forma complementar, aumentaram a eficácia final da ablação.OBJECTIVE: To study a series of patients submitted to radiofrequency catheter ablation (RFA of left accessory pathways (AP using the transeptal approach (TSA as compared to the conventional retrograde arterial approach (RAA. METHODS: One hundred consecutive patients (56 male

  14. Duas grandes transformações ao mesmo tempo: atitudes em relação à alimentação e ao corpo em gestantes adolescentes

    OpenAIRE

    Carolina Marques Oliboni

    2014-01-01

    Introdução - Adolescência e gestação são caracterizadas por intensas transformações relacionadas ao corpo, e ocorrendo concomitantemente podem potencializar riscos para o surgimento de problemas com a imagem corporal, atitudes alimentares disfuncionais e comportamentos de risco para transtornos alimentares. Objetivo - Avaliar as atitudes em relação à alimentação, ao peso e ao corpo de um grupo de adolescentes grávidas. Métodos - Uma amostra de adolescentes grávidas (n=67) foi avaliada por mei...

  15. Heparina para desobstrução de cateter venoso central de inserção periférica no recém-nascido: estudo in vitro

    Directory of Open Access Journals (Sweden)

    Talita Balaminut

    2015-09-01

    Full Text Available ResumoObjetivo:Comparar a eficácia de duas concentrações de heparina para a desobstrução por coágulo do cateter venoso central de inserção periférica (CCIP neonatal in vitro.Métodos:Estudo experimental in vitro quantitativo que usou 76 CCIPs neonatais de tamanho 2 French coagulados in vitro. Os cateteres foram divididos em dois grupos com 38 CCIPs cada. Ambos os grupos receberam infusão de heparina de baixo peso molecular, com dose de 25UI/mL no Grupo I e de 50UI/mL no Grupo II. Os cateteres de ambos os grupos foram submetidos à técnica de pressão negativa com cinco, 15 e 30 minutos e com quatro horas e testou-se sua permeabilidade. Usou-se a análise de sobrevivência para verificar o desfecho dos grupos conforme os intervalos de tempo.Resultados:A comparação dos dois grupos no intervalo de tempo de cinco minutos mostrou um número maior de desobstrução de cateteres no Grupo II (57,9% em relação ao grupo 1 (21,1%. A análise de Kaplan Meier indicou menor tempo para desobstrução dos cateteres quando a heparina em maior concentração (50UI/mL foi usada (p<0,001.Conclusões:O uso de heparina de baixo peso molecular na concentração de 50UI/mL foi mais eficaz na restauração da permeabilidade de CCIPs neonatais ocluídos in vitro por coágulo e situou-se tal concentração dentro da margem de segurança indicada na literatura científica.

  16. Proposta de um software-protótipo para uso na assistência a pacientes com cateter central de inserção periférica (PICC Proposal for a software-prototype to assist patients with peripherally inserted central catheter (PICC

    Directory of Open Access Journals (Sweden)

    Luiz Célio Martins Freitas

    2017-04-01

    Full Text Available Objetivo: Propor um software-protótipo como estratégia para melhorar o processo de comunicação e os registros relativos ao cuidado de enfermagem a pacientes com cateter central de inserção periférica (PICC e descrever os passos para a construção de um protótipo de software. Método: Utilizou-se da Pesquisa de Intervenções, na modalidade de Processo de Intervenção e como método de operacionalização a Prototipação associados a instrumentos de informática. Resultado: Foi criado um modelo computadorizado de interface gráfica simples e projetado para uso em redes abertas ou fechadas. Conclusão: O desenvolvimento do software-protótipo para funcionar em rede web tornará o processo de implantação mais prático. Acrescenta-se que validação com equipe de saúde será realizada antes da utilização.

  17. The Use of the Peripherally Inserted Central Catheter (Picc in the Hospital Environment La utilización del catéter central de inserción periférica (CCIP en el ambiente hospitalario A utilização do cateter central de inserção periférica (CCIP no ambiente hospitalar

    Directory of Open Access Journals (Sweden)

    Graziella Gasparotto Baiocco

    2010-12-01

    prontuários do Grupo de Cateteres da Associação Hospitalar Moinhos de Vento, em Porto Alegre, RS, totalizando 229 cateteres inseridos. A curva de crescimento na utilização do cateter central de inserção periférica (CCIP foi de 1 cateter inserido em 2000 a 57 inseridos em 2007. A prevalência inerente à patologia foi a oncológica (17,9%, n=41. Em relação às indicações ao uso, prevaleceu a antibioticoterapia (54,1%, n=124. Na confirmação radiológica, a veia cava foi prevalente (68,1%, n=156. Pode-se concluir que a utilização do CCIP no ambiente hospitalar está em expansão e a enfermagem tem papel fundamental na inserção, manutenção e sua remoção.

  18. Incentivos ao investimento estrangeiro

    OpenAIRE

    Mendes, Valter Nuno Dias

    2015-01-01

    Dissertação de Mestrado apresentada ao Instituto de Contabilidade e Administração do Porto para a obtenção do grau de Mestre em Contabilidade e Finanças, sob orientação de Doutor José de Campos Amorim O presente estudo tem por tema os Incentivos ao Investimento Estrangeiro ao nível das pessoas singulares: o Regime Fiscal do Residente Não Habitual (RNH) e a Autorização de Residência para Atividade de Investimento (ARI) – Vistos Dourados (Golden Visa), tendo por objetivo a análise mais po...

  19. Prednisona e meloxicam no tratamento de ratos submetidos ao trauma agudo da medula espinhal

    Directory of Open Access Journals (Sweden)

    Graciane Aiello

    2015-01-01

    Full Text Available O objetivo deste estudo foi investigar o efeito da prednisona e do meloxicam na terapia de ratos submetidos ao modelo experimental de trauma agudo da medula espinhal, induzida pelo cateter de Fogarty 2Fr, mediante a avaliação dos parâmetros de estresse oxidativo, dos testes neurológicos e do exame histopatológico da medula espinhal. Foram utilizados 90 ratos Wistar, distribuídos em seis grupos, denominados controle salina ou GCS (n=15, controle prednisona ou GCP (n=15, controle meloxicam ou GCM (n=15, trauma mais salina ou GTS (n=15, trauma mais prednisona ou GTP (n=15 e trauma mais meloxicam GTM (n=15. Cada grupo foi redistribuído em três subgrupos de igual número, de acordo com o tempo de tratamento no pós-operatório de 24h, 72h e sete dias. Todos os grupos foram submetidos à laminectomia e, nos grupos GTS, GTM e GTP, após a exposição da medula espinhal, foi realizado o trauma medular compressivo, utilizando o cateter de Fogarty 2Fr. Os grupos GCS e GTS foram tratados com solução salina, os GSM e GTM receberam meloxicam e os GSP e GTP prednisona, sendo administrados pela via intraperitoneal. Em todos os ratos, foram avaliados os parâmetros de estresse oxidativo, testes neurológicos e exame histopatológico da medula espinhal. Os animais dos grupos GTS, GTM e GTP, nos diferentes tempos (24h, 72h e sete dias, tiveram pontuação zero na escala de Basso, Beattie e Bresnahan (BBB; no plano inclinado, permaneceram com pontuação três e perderam a percepção da dor profunda. Os grupos GTM e GTP apresentaram menor atividade da catalase e de níveis de TBARS, quando comparado ao grupo GTS. Foi constatada degeneração Walleriana e necrose da substância cinzenta de intensidades variáveis, não apresentando diferença entre os grupos submetidos ao trauma. O meloxicam e a prednisona apresentam possível efeito antioxidante, mas não impedem a necrose e a degeneração Walleriana da medula espinhal de ratos.

  20. LIMITAÇÕES E CONSEQUÊNCIAS NA VIDA DO TRABALHADOR OCASIONADAS POR DOENÇAS RELACIONADAS AO TRABALHO

    Directory of Open Access Journals (Sweden)

    Bruna Caroline Rodrigues

    2013-01-01

    Full Text Available El objetivo fue comprobar en la literatura el impacto de las enfermedades profesionales en la vida de los trabajadores y analizar las contribuciones de los estudios para la ciencia de enfermería, en especial para enfermería del trabajo. Revisión integradora con la siguiente pregunta: cuáles son las limitaciones y consecuencias causadas por trastornos de trauma acumulativo en la vida de los trabajadores, en la literatura científica de enfermería en los últimos cinco años (2006 a 2010. Se utilizaron como descriptores: Salud Ocupacional y Salud Ocupacional del Trabajador. Fueron seleccionados 14 trabajos que se agruparon según objetivos comunes, principales limitaciones y consecuencias causadas e informaciones que se pueden traducir en contribuciones para la Enfermería del Trabajo. La producción científica sobre el tema trae pocas contribuciones efectivas, y que se necesitan más estudios para subsidiar a las estrategias de atención dirigidas a promover la salud y la calidad de vida de estos trabajadores.

  1. A razão cintura para estatura relacionada ao perfil gligêmico elevado em meninos

    Directory of Open Access Journals (Sweden)

    André de Camargo Smolarek

    2012-05-01

    Full Text Available To verify the association of anthropometric indicators with risk factors for cardiometabolic diseases is extremely important especially in adolescents. The aim of this study was to investigate the association of waist height ratio (WHratio with the glucose profile (GL in boys of the town of Curitiba, Brazil the sample consisted of 123 boys from 14.25 ± 2.25 years old. Was measured weight, height, waist circumference, fasting GL, WHratio. The statistics used were mean, standard deviation and frequency percentile, Pearson correlation and binary logistic regression CI-95% and p

  2. Anormalidades metabólicas relacionadas aos níveis de adiponectina e à gordura da dieta

    OpenAIRE

    Anize Delfino von Frankenberg

    2015-01-01

    O diabetes tipo 2 está atingindo proporções epidêmicas em todo o mundo. A Organização Mundial de Saúde estima que 9% dos adultos com mais de 18 anos têm diabetes, sendo a maioria classificada como tendo diabetes tipo 2. A elevada produção de glicose hepática, a redução da secreção de insulina, a resistência à insulina e as alterações do metabolismo da glicose normalmente encontrados em indivíduos com obesidade, são os principais fatores relacionados à patogênese do diabetes tipo 2 e da síndro...

  3. Caracterização de comunidades microbianas relacionadas ao metabolismo de hidrocarbonetos leves presentes em amostras de solo.

    OpenAIRE

    Paula Brandão Miqueleto

    2010-01-01

    Solos apresentam hidrocarbonetos gasosos em quantidades variáveis e acredita-se que as formações de reservatórios de óleo podem ser detectáveis indiretamente utilizando-se bactérias no solo capazes de degradá-los. O presente estudo teve como objetivo caracterizar comunidades microbianas envolvidas com o metabolismo desses hidrocarbonetos. As amostras de solo Np (área não petrolífera) e Solo P (área petrolífera) foram analisadas através da construção de bibliotecas do gene RNAr 16S de bactéria...

  4. Morbidade neonatal e maternas relacionada ao tipo de parto Neonatal and maternal morbidity related to the type of delivery

    Directory of Open Access Journals (Sweden)

    Priscila Oliveira Cardoso

    2010-03-01

    Full Text Available Foi realizada uma análise da morbidade neonatal e materna e a mortalidade neonatal de acordo com o tipo de parto, cesariana ou vaginal. Foram estudadas prospectivamente 170 parturientes sem complicações gestacionais e com nascimento a termo: Grupo 1 (n = 95, puérpera com parto por via vaginal, Grupo 2 (n = 75, puérpera submetida à cesariana. Parâmetros maternos e fetais foram avaliados. Foi observada maior incidência de partos por via vaginal nas pacientes que estudaram até o ensino fundamental incompleto (p = 0,0045. Houve prevalência maior de partos prévios por via vaginal no Grupo 1 e de cesáreas no Grupo 2 (p An evaluation of infant morbimortality and mother morbidity was undertaken according to the type of delivery. A prospective study was undertaken on 170 puerperal patients divided into two groups: Group 1 (n = 95, natural or vaginal delivery, Group 2 (n = 75, submitted to caesarean delivery. Complications in mothers were classified in small, moderate and severe. The infant parameters were: period of pregnancy, weight on birth, Apgar score, necessity of intensive care and neurological disorders. Mothers who had not completed elementary school (p=0.0045 had more vaginal delivery. Previous vaginal deliveries were more common in Group 1 than caesarean section in Group 2 (p = < 0.001 (OR = 104.00; 21.11 < OR < 610.99. In Group 1, vaginal delivery was preferred by 78 (82,1% of mothers comparing to 28 (37.3% from Group 2, who preferred caesarean section (p = 0.0002 (OR = 4; 1.77 < OR < 9.17. Post-operative was more intense and frequent after caesarean section (8 cases than patients of Group 1 (2 cases (p = 0.018 (OR = 0.18; 0.03 < OR < 0.96. Obstetric trauma was found in 14 deliveries of Group 1 and 7 of Group 2 (p = 0.28. Infant hospitalization was greater in Group 2 (3.43 +/- 0.70 days in comparison with Group 1 (2.71 +/- 0.67 days (p < 0.0001. The infant morbidity was greater after vaginal deliveries, but maternal morbidity was greater after caesarean deliveries.

  5. Asbestos-related pleuropulmonary diseases: iconographic essay; Alteracoes pleurais e parenquimatosas relacionadas a exposicao ao asbesto: ensaio iconografico

    Energy Technology Data Exchange (ETDEWEB)

    Gustavo de Souza Portes Meirelles [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil); Rodrigues, Reynaldo Tavares; Nery, Luiz Eduardo [Universidade Federal de Sao Paulo (UNIFESP-EPM), Sao Paulo, SP (Brazil). Dept. de Diagnostico por Imagem; Bagatin, Ericson [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Dept. de Medicina Preventiva e Social; Terra-Filho, Mario [Instituto do Coracao (InCor). Sao Paulo, SP (Brazil)]. E-mail: gmeirelles@gmail.com

    2007-07-01

    The aim of this study is to illustrate the main imaging findings of asbestos-related diseases. Pleural and pulmonary asbestos-related diseases range from benign conditions, like pleural effusion and pleural plaques, to some neoplasias, such as lung cancer and malignant mesothelioma. Pleural effusion is the earliest finding after asbestos exposure, but the imaging findings are not specific. Diffuse pleural thickening involves the visceral pleura and pleural plaques are considered to be hallmarks of exposure. Asbestosis is the pulmonary fibrosis due to asbestos. Rounded atelectasis is a peripheral lung collapse in these individuals, generally related to pleural disease. Some neoplasias, like lung carcinoma and pleural mesothelioma, are more prevalent in asbestos-exposed subjects. (author)

  6. Fatores preditivos de qualidade de vida relacionada à saúde em adolescentes com diabetes mellitus do tipo 1

    OpenAIRE

    Tatiana de Sá Novato

    2009-01-01

    A avaliação da Qualidade de Vida Relacionada à Saúde (QVRS) de jovens com Diabetes Mellitus do Tipo 1 (DM1) tem sido considerada como parâmetro de avaliação de tratamento, além das medidas de controle fisiológico. A identificação dos fatores que influenciam na QVRS desses adolescentes permite a elaboração de estratégias que minimizem o impacto da doença e favoreçam a adesão ao tratamento e bem-estar. Os objetivos deste estudo foram avaliar a QVRS de jovens com DM 1, identificar os fatores ass...

  7. Cefalea relacionada con la actividad sexual en una unidad de cefaleas

    OpenAIRE

    Ontañón Gómez, Jesús

    2016-01-01

    La cefalea relacionada con la actividad sexual es un tipo de cefalea clasificada como primaria por la International Headache Society. Se encuadra en el grupo de “miscelánea”, junto con la cefalea relacionada con el ejercicio físico y la relacionada con la tos. Se define como cefalea que se desencadena durante el coito o masturbación. Pretendemos estudiar la frecuencia y características de la Cefalea relacionada con la actividad sexual en una Unidad de Cefaleas. Se consideraron todos los...

  8. Biomarcadores en enfermedades relacionadas con el sistema nervioso

    Directory of Open Access Journals (Sweden)

    Elso Manuel Cruz Cruz

    2014-12-01

    Full Text Available El estudio de biomarcadores, o marcadores biológicos para el diagnóstico y seguimiento al tratamiento de enfermedades, constituye referente frecuente en la literatura científica biomédica actual. Se realizó una revisión bibliográfica empleando los recursos disponibles en la red Infomed, específicamente Ebsco, The Cochrane Librery, PubMed, Hinari y SciELO, a través de los cuales se accedieron a las bases de datos: MEDLINE, Academic Search Premier, MedicLatina y Scopus. Se recopilaron varios artículos científicos, donde se hace referencia al empleo de biomarcadores en el diagnóstico de enfermedades relacionadas con el sistema nervioso. El factor de crecimiento endotelial, la inmunoglobulina G (IgG y el sistema arginina - óxido nítrico - citrulina, se refieren como indicadores prematuros de la hemorragia subaracnoidea. La disminución del amiloide beta y el aumento de las concentraciones de proteína tau en el líquido cefalorraquídeo, se cuentan entre los biomarcadores más prometedores e informativos que indiquen precozmente el Alzheimer y otras enfermedades neurodegenerativas. Estos mismos marcadores se comportan de manera contraria a nivel plasmático. La copeptina es un biomarcador fácilmente medible, que refleja la situación de estrés a la que está sometido el organismo y se propone su uso en el diagnóstico del síndrome de Burnout; además, niveles aumentados de α-amilasa y cromogranina A (CgA salivales pueden también ser utilizadas como indicadores de este síndrome. Se logró recoger en este artículo un compendio de ejemplos de marcadores biológicos, utilizados en el diagnóstico de enfermedades relacionadas de alguna forma con el sistema nervioso

  9. Carta ao Editor

    OpenAIRE

    Correia, Miguel

    2017-01-01

    Exmos. Senhores Editores-Chefe,Li com muito interesse o artigo de Sousa R e colaboradores, intitulado “Que fatores levam ao abandono de crianças do serviço de urgência antes da observação médica?”.

  10. Avaliação da qualidade de vida relacionada à saúde de pacientes com câncer sem possibilidades terapêuticas de cura

    OpenAIRE

    Maria Eliane Moreira Freire

    2014-01-01

    Atualmente, as pesquisas sobre qualidade de vida relacionada à saúde (QVRS) de pacientes com câncer têm contribuído para o planejamento de cuidado integral ao paciente e familiar. Este estudo teve como objetivo avaliar a QVRS de pacientes oncológicos, sem possibilidades terapêuticas de cura, de acordo com as dimensões do instrumento EORTC QLQ C-30 e sua associação com os aspectos sociodemográficos e clínicos. O referencial adotado foi o de QVRS de Ashing-Giwa. Trata-se de um estudo analí...

  11. Validação de procedimentos operacionais padrão no cuidado de enfermagem de pacientes com cateter totalmente implantado

    Directory of Open Access Journals (Sweden)

    Rita Paiva Pereira Honório

    2011-10-01

    Full Text Available Os protocolos de assistência são recursos tecnológicos importantes na prática de saúde e devem ser validados, para adquirirem credibilidade científica na prática profissional. O objetivo desta pesquisa foi validar os itens de proposta de procedimentos operacionais padrão (POPs quanto à punção, heparinização e curativo do cateter totalmente implantado, por meio da análise de conceito proposta por Hoskins. O estudo se deu em duas etapas. Na primeira, elaborou-se um formulário para validação dos POPs. Na segunda, avaliou-se o conteúdo dos POPs por peritos. As sugestões versaram sobre reformulação da redação; acréscimo de ações, tornando-o mais claro e abrangente; a ordem dos passos dos procedimentos; e o material para a adequação do instrumento. Constatou-se a necessidade de outros estudos que direcionem os profissionais, principalmente, quanto à heparinização dos cateteres e à troca do primeiro curativo após punção, no sentido de uniformizar condutas embasadas em evidências científicas seguras.

  12. Mapeamento tecnológico de patentes relacionadas a gamificação

    Directory of Open Access Journals (Sweden)

    Claudia Menezes

    2017-05-01

    Full Text Available http://dx.doi.org/10.5007/1518-2924.2017v22n49p33 Juntamente com a crescente popularidade dos jogos de vídeo, surgiu a gamification para defender a extensão e aplicação de elementos normalmente presentes em jogos de vídeo para o mundo real e em áreas muito longe de apenas entretenimento. A gamification é um fenômeno sócio tecnológico com potencial reivindicado para fornecer uma infinidade de benefícios relacionados a diversão, como também, benefícios sociais através de comunidades e interação social. Objetivo: Verificar os avanços e pesquisas tecnológicas que estão sendo realizadas sobre a gamification por intermédio de análise de prospecção tecnológica. Uma vez que com o avanço acelerado do sistema de inovação, faz necessário a verificação do panorama mundial dos documentos de patentes relacionados a tecnologia da gamification se atentando aos pedidos de depósitos em bancos de dados. Resultados: Constatou-se que, as pesquisas relacionadas a gamification são realizadas de forma recente e crescente. O dinamismo da tecnologia faz com que cada vez mais novos sistemas e métodos sejam desenvolvidas. Conclusão: Sendo assim o mapeamento tecnológico proporcionou verificar os avanços e pesquisas que estão sendo realizadas sobre a gamification.

  13. Incidencia de fracturas maxilofaciales relacionadas con el deporte

    Directory of Open Access Journals (Sweden)

    Juan Carlos Quintana Díaz¹

    1996-08-01

    Full Text Available Se realiza un estudio para analizar la incidencia de las fracturas maxilofaciales relacionadas con el deporte en los años 1991 al 1993. Se encontró que éstas correspondían al 7,1 % del total; fueron más frecuentes en el sexo masculino y en el grupo de edad de 15 a 24 años. El beisbol fue el deporte que más casos aportó a nuestro estudio; le siguieron el kárate y el baloncesto. La colisión con otro jugador y las caídas fueron las causas más frecuentes. La región nasal fue la más afectada con el 32,5 %. Se recomienda el correcto uso de los medios de prevención de: fracturas faciales, accidentes deportivos, traumatismos faciales y fracturas nasales.The authors carried out a study to analyze the incidence of maxillofacial fractures related to sports from 1991 to 1993. It was found that these were correspondent with 7,1 % of the total of fractures; that were more frequent in masculine sex, and in the 15 to 24 years old age group. Baseball was the sport that brought more cases to the study, followed by martial arts and basketball. Collisions with another players, and downfalls, were the most frequent causes. The nasal region was the most effected one, with 32,5 %. The authors recommend the correct usage of prevention media to avoid facial fractures, sports accidents, facial traumas and nasal fractures.

  14. Mortalidade por intoxicacao ocupacional relacionada a agrotoxicos, 2000-2009, Brasil

    Directory of Open Access Journals (Sweden)

    Vilma Sousa Santana

    2013-06-01

    Full Text Available OBJETIVO: Estimar o coeficiente de mortalidade por intoxicações ocupacionais relacionadas aos agrotóxicos no Brasil. MÉTODOS: Utilizaram-se dados do Sistema de Informações sobre Mortalidade de 2000 a 2009 referentes aos diagnósticos de intoxicação por agrotóxicos, T60.0-T60.4, T60.8 e T60.9, X48, Y18, e Z578 da CID-10, para a causa básica ou associadas; a natureza ocupacional foi identificada pelo registro no campo , e se a era na agropecuária. Foram excluídos homicídios e suicídios. Para cálculo da mortalidade, o número de trabalhadores da agropecuária foi obtido do Instituto Brasileiro de Geografia e Estatística, projeções do Sistema de Contas Nacionais. RESULTADOS: Foram encontrados registros de 2.052 óbitos por intoxicação por agrotóxicos no Brasil, dos quais 36,2% (n = 743 não continham dados sobre a ocupação. Dentre os 1.309 restantes, 679 (51,9% eram trabalhadores da agropecuária. A mortalidade por intoxicação ocupacional por agrotóxicos caiu de 0,56/100.000 (2000 a 2001 para 0,39/100.000 (2008 a 2009 entre trabalhadores no período, maior queda entre os homens que entre as mulheres. Os homens tiveram maiores estimativas de mortalidade por esse tipo de intoxicação em todos os anos. A maior parte dos óbitos foi causada por agrotóxicos do tipo organofosforados e carbamatos. O número de óbitos por esse tipo de intoxicação declinou em todas as regiões, exceto no Nordeste. CONCLUSÕES: É necessária a melhoria dos registros das declarações de óbito, em especial da ocupação e da relação dos diagnósticos com o trabalho, fundamentais para o controle e prevenção mais adequados para esses acidentes de trabalho. Atenção especial deve ser dirigida à região Nordeste do Brasil.

  15. Aspectos sociodemograficos e clinicos da qualidade de vida relacionada a saude bucal em adolescentes

    Directory of Open Access Journals (Sweden)

    Karen Glazer Peres

    2013-12-01

    Full Text Available OBJETIVO: Estimar a prevalência e identificar fatores sociodemográficos e parâmetros bucais associados ao impacto negativo da condição bucal na qualidade de vida de adolescentes. MÉTODOS: Foram analisados dados de 5.445 adolescentes entre 15 e 19 anos que participaram do inquérito nacional de saúde bucal (SBBrasil 2010, considerando a complexidade do desenho amostral. O desfecho foi a qualidade de vida relacionada à saúde bucal, avaliada por meio do questionário Oral Impacts on Daily Performance e analisada de forma discreta. As variáveis de exposição foram sexo, cor da pele, escolaridade, renda familiar, idade, cárie não tratada, perda dentária, dor de dente, oclusopatias, sangramento gengival, cálculo dentário e bolsa periodontal. Foram conduzidas análises de regressão de Poisson e apresentadas as razões de médias (RM, com respectivos intervalos de 95% de confiança (IC95%. RESULTADOS: Dos pesquisados, 39,4% relataram pelo menos um impacto negativo na qualidade de vida. Após o ajuste, a média do impacto negativo foi de 1,52 (IC95%1,16;2,00 vez maior no sexo feminino e 1,42 (IC95% 1,01;1,99, 2,66 (IC95% 1,40;5,07 e 3,32 (IC95% 1,68;6,56 vezes maior nos pardos, amarelos e indígenas, respectivamente, em relação aos brancos. Quanto menor a escolaridade, maior a média de impacto negativo (RM 2,11, IC95% 1,30;3,41, assim como em indivíduos com renda familiar até R$ 500,00 (RM 1,84, IC95% 1,06;3,17 comparados aos de maior renda. Encontrou-se maior impacto na qualidade de vida entre adolescentes com quatro ou mais lesões de cáries não tratadas (RM 1,53, IC95% 1,12;2,10, uma ou mais perdas dentárias (RM 1,44, IC95%1,16;1,80, com dor de dente (RM 3,62, IC95% 2,93;4,46 e com oclusopatia grave (RM 1,52, IC95% 1,04;2,23 e muito grave (RM 1,32, IC95% 1,01;1,72. CONCLUSÕES: Os adolescentes brasileiros relataram alto impacto negativo da saúde bucal na sua qualidade de vida. A iniquidade em sua distribuição deve ser

  16. Calidad de vida relacionada con heridas crónicas

    Directory of Open Access Journals (Sweden)

    Renata Virginia González-Consuegra

    Full Text Available El presente artículo hace una revisión bibliográfica que se inicia con un recorrido de la evolución del concepto de calidad de vida (CV y su aplicación en salud, el cual debe su importancia a la forma más amplia en que es concebido el estado de salud personal, al contener implícito el bienestar social, lo que ha generado el desarrollo de medidas que permiten captar la salud en sus dimensiones múltiples y también positivas, como las de salud percibida o de calidad de vida relacionada con la salud (CVRS. La medición de la CVRS ha mostrado su utilidad en la investigación, en la práctica clínica, en la evaluación de los servicios sanitarios y en salud pública, lo que permite -en gran medida- contribuir a mejorar la gestión del cuidado. Con el paso del tiempo y la evolución tecnológica, la esperanza de vida ha ido en aumento, con el consiguiente envejecimiento de la población, siendo frecuente la presencia de enfermedades crónicas y metabólicas que, en muchos casos, traen consigo la presencia de heridas crónicas (HC de difícil manejo, que afectan negativa y considerablemente la CVRS de la población mayor de 65 años, especialmente femenina. La literatura reciente, es profusa respecto a los diferentes instrumentos para la medición de CVRS, por lo que se hace necesario conocer de qué disponemos para poder hacer uso de las herramientas adecuadas, según la condición de salud de la persona, a fin de aproximarse a las necesidades reales de las personas a nuestro cuidado. La mayoría de las herramientas de medición de CVRS se han desarrollado en Europa y Estados Unidos, lo que exige que para ser utilizadas en poblaciones distintas a las de su origen se cumpla con la adaptación y validación respectiva, a fin de que sus resultados reflejen la percepción real de la población.

  17. Calidad de vida relacionada con la salud de adolescentes latinoamericanos

    Directory of Open Access Journals (Sweden)

    Dartagnan Pinto Guedes

    2014-01-01

    Full Text Available OBJETIVO: El objetivo del presente trabajo es determinar diferencias en relación con el sexo, la edad y el país de origen, en los componentes de la calidad de vida relacionada con la salud (CVRS, en una muestra de adolescentes de tres ciudades localizadas en Argentina, Brasil y Chile, utilizando datos recogidos mediante un cuestionario validado y reconocido internacionalmente: el KIDSCREEN-52. MÉTODOS: Se aplicó el cuestionario KIDSCREEN-52 a 1 357 adolescentes con edades comprendidas entre 12 y 17 años (48,6% varones en muestras seleccionadas en los tres países. Se utilizó el análisis de varianza univariada (ANCOVA y se identificaron diferencias entre países de los adolescentes, sexo y edad en cada componente de CVRS. RESULTADOS: Los datos indican diferencias significativas en componentes específicos de CVRS entre los tres países. Los varones consiguieron puntuaciones significativamente más elevadas que las mujeres en los componentes Bienestar físico (P < 0,001, Bienestar psicológico (P = 0,019, Estado de ánimo y emociones (P < 0,001, Autopercepción (P = 0,001, Autonomía (P < 0,001 y Relación con los padres y vida familiar (P = 0,008. Las puntuaciones medias atribuidas a los componentes Bienestar físico (P = 0,001, Bienestar psicológico (P = 0,001, Autopercepción (P = 0,038, Autonomía (P = 0,001, Relación con los padres y vida familiar (P = 0,001, Entorno escolar (P = 0,001 y Recursos económicos (P = 0,022 muestran un descenso significativo con el avance de la edad; en cuanto al componente Rechazo (social/bullying, los puntajes medios encontrados aumentaron significativamente con la edad (P < 0,001. CONCLUSIONES: Las evidencias encontradas sugieren que las intervenciones en prevención y promoción de la salud deberían ser concebidas para llegar a los grupos-objetivo específicos y tendrían que contemplar acciones de acuerdo con el sexo y la edad de los adolescentes.

  18. Mortalidade por leucemias relacionada à industrialização

    Directory of Open Access Journals (Sweden)

    Leal Carmen Helena Seoane

    2002-01-01

    Full Text Available OBJETIVO: Analisar a distribuição espacial da mortalidade por leucemia na população, buscando identificar agregados e estabelecer sua relação com os níveis de industrialização. MÉTODOS: O estudo foi realizado nas 43 regiões de governo do Estado de São Paulo, no qüinqüênio 1991-1995. Foi construído um "índice de industrialização relativo à leucemia" (IIRL baseado no número de indústrias e empregos industriais por 100.000 habitantes, valor adicionado fiscal, variedade de ramos industriais e indústrias com potenciais exposições de risco para a leucemia. O IIRL foi distribuído em cinco categorias. Verificaram-se os coeficientes padronizados de mortalidade por leucemia em cada uma das regiões, também distribuídos em cinco categorias e comparados ao mapa IIRL. RESULTADOS: As regiões mais industrializadas em ordem decrescente foram Campinas, Piracicaba, Jundiaí, Sorocaba e São Paulo. Não foi encontrada associação entre mortalidade, por nenhum tipo de leucemia, e industrialização. A região de Jales foi a que apresentou o mais alto coeficiente padronizado de mortalidade por leucemia. CONCLUSÕES: A distribuição da mortalidade por leucemia ocorreu de forma homogênea no Estado de São Paulo, não apresentando correlação com o nível de industrialização. Entretanto, aspectos relacionados ao método epidemiológico adotado -- estudo ecológico -- e ao uso do parâmetro "mortalidade por leucemia", doença cujo prognóstico tem mudado muito nas últimas décadas, limitaram a interpretação dos resultados.

  19. Ressalto no canto posteromedial do joelho relacionado ao músculo sartório

    Directory of Open Access Journals (Sweden)

    Marcello Henrique Nogueira-Barbosa

    2011-06-01

    Full Text Available As causas da síndrome de ressalto no joelho relatadas com maior frequência são relacionadas a anormalidades meniscais, ao tendão do músculo bíceps femoral e aos tendões grácil e semitendíneo. Neste trabalho é descrito um caso de ressalto no canto posteromedial relacionado à junção miotendínea do músculo sartório em um paciente do sexo masculino, de 58 anos de idade, com hiperextensão do joelho.

  20. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  1. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  2. Dimensionamento da dor durante a instalação do cateter central de inserção periférica em neonatos Medida de la intensidad del dolor durante la instalación del catéter central de inserción periférica en neonatos Measuring pain in neonates during placement of central line catheter via peripheral insertion

    Directory of Open Access Journals (Sweden)

    Priscila Costa

    2010-01-01

    Full Text Available OBJETIVO: Dimensionar a dor durante a instalação do cateter central de inserção periférica, comparando o momento da punção venosa com a progressão do cateter. MÉTODOS: Estudo descritivo exploratório com coleta prospectiva dos dados realizado na unidade neonatal de um hospital-escola de grande porte da cidade de São Paulo. Avaliou-se a resposta dolorosa ao procedimento de inserção do cateter em 28 neonatos utilizando-se a escala Premature Infant Pain Profile (PIPP nas etapas de pré-punção (15 segundos, punção venosa (30 segundos e progressão do cateter (30 segundos. RESULTADOS: O escore PIPP maior ou igual a sete, indicativo de dor moderada a intensa, ocorreu em 13 RN (59,1% na primeira punção venosa e 10 RN (45,5% na progressão do cateter do grupo que não recebeu analgésico ou sedativo. CONCLUSÃO: Os resultados apontam para a necessidade de se adotar medidas analgésicas, uma vez que neonatos internados em unidade de terapia intensiva neonatal são freqüentemente submetidos a procedimentos invasivos e dolorosos.OBJETIVO: Medir la intensidad del dolor durante la instalación del catéter central de inserción periférica, comparando el momento de la punción venosa con la progresión del catéter. MÉTODOS: Estudio descriptivo exploratorio con recolección prospectiva de los datos realizado en la unidad neonatal de un hospital-escuela de gran porte de la ciudad de Sao Paulo. Se evaluó la respuesta dolorosa al procedimiento de inserción del catéter en 28 neonatos, utilizándose la escala Premature Infant Pain Profile (PIPP en las etapas de pre-punción (15 segundos, punción venosa (30 segundos y progresión del catéter (30 segundos. RESULTADOS: El puntaje PIPP mayor o igual a siete, indicativo de dolor moderado a intenso ocurrió en 13 RN (59,1% en la primera punción venosa y 10 RN (45,5% en la progresión del catéter del grupo que no recibió analgésico o sedativo. CONCLUSIÓN: Los resultados apuntan que es

  3. AO Group Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, S

    2005-10-04

    The Adaptive Optics (AO) Group in I Division develops and tests a broad range of advanced wavefront control technologies. Current applications focus on: Remote sensing, High power lasers, Astronomy, and Human vision. In the area of remote sensing, the AO Group leads a collaborative effort with LLNL's Nonproliferation, Arms Control & International Security (NAI) Directorate on Enhanced Surveillance Imaging. The ability to detect and identify individual people or vehicles from long-range is an important requirement for proliferation detection and homeland security. High-resolution imaging along horizontal paths through the atmosphere is limited by turbulence, which blurs and distorts the image. For ranges over {approx}one km, visible image resolution can be reduced by over an order of magnitude. We have developed an approach based on speckle imaging that can correct the turbulence-induced blurring and provide high resolution imagery. The system records a series of short exposure images which freeze the atmospheric effects. We can then estimate the image magnitude and phase using a bispectral estimation algorithm which cancels the atmospheric effects while maintaining object information at the diffraction limit of the imaging system.

  4. Avaliação da qualidade de vida relacionada à saúde de cortadores de cana-de-açúcar nos períodos de entressafra e safra Evaluación de la calidad de vida relacionada con la salud de cortadores de caña de azúcar en los períodos de entre-cosecha y cosecha Assessment of health-related quality of life of sugarcane cutters in the pre-harvest and harvest periods

    OpenAIRE

    Luiz Carlos Soares de Carvalho Junior; Ercy Mara Cipulo Ramos; Alessandra Choqueta de Toledo; Aline Duarte Ferreira Ceccato; Mariângela Macchione; Alfésio Luis Ferreira Braga; Dionei Ramos

    2012-01-01

    OBJETIVO: Avaliar a qualidade de vida relacionada à saúde de cortadores de cana-de-açúcar. MÉTODOS: Estudo longitudinal em uma usina sucroalcooleira no Oeste do estado de São Paulo de abril (final da entressafra) a outubro (final da safra) de 2010. Foram avaliados 44 cortadores de cana-de-açúcar tabagistas e não tabagistas em três períodos: ao final da entressafra, no fim do terceiro mês de safra e no final da safra. A qualidade de vida relacionada à saúde foi avaliada pelo questionário Medic...

  5. Estudo comparativo entre as alterações histológicas na região do cateter intravascular com e sem o uso de corticosteróide local

    Directory of Open Access Journals (Sweden)

    Maíra Stathourakis Sampaio Amaral

    2015-10-01

    Full Text Available O acesso venoso central é um dos procedimentos cirúrgicos mais comuns na cirúrgica pediátrica em todo mundo, pois frequentemente são utilizados para tratamentos com antibióticos, fluidos com eletrólitos, quimioterapia, nutrição parenteral total, etc. As complicações loco-regionais decorrentes da permanência de cateteres venosos são descritas mais frequentemente como: trombose, infecção, edema e celulites locais, mobilização e perda do cateter. Estas complicações levam também à sua retirada precoce e à necessidade de novas cateterizações para administração dos medicamentos. Se houver possibilidade de minimizar os efeitos inflamatórios locais do vaso e nos tecidos adjacentes com o uso de costicosteróide local, será uma alternativa para a manutenção mais prolongada do cateter, evitando novos procedimentos. O objetivo do presente estudo foi o de analisar as diferenças entre as alterações inflamatórias vasculares e perivasculares nas flebotomias com catéteres de politetrafluoretileno (Intracath®, com e sem o uso de Corticosteroide local (Betametasona, comparando os resultados dessas alterações por meio de análise histológica do vaso sanguíneo com 15 (quinze e 30 (trinta dias e permanência do cateter. O uso de corticoide não impediu o processo inflamatório. Não parece existir diferença entre o processo inflamatório observado com 15 e 30 dias. A grande maioria das amostras no grupo controle não apresentou infiltrado linfoplasmocitário garantindo que os coelhos não apresentavam processo inflamatório antes da colocação do cateter.

  6. Habilidades sociales relacionadas con el proceso de comunicación en una muestra de adolescentes

    OpenAIRE

    Betancourth, Sonia; Zambrano, Christian; Ceballos, Ana Karen; Benavides, Vanessa; Villota, Nixon

    2017-01-01

    ResumenLas habilidades sociales son repertorios de comportamientos que los seres humanos utilizan para enfrentar diferentes situaciones de su vida, así como para establecer relaciones interpersonales de calidad. El objetivo del presente estudio es describir las habilidades sociales relacionadas con el proceso de comunicación en estudiantes de grado décimo, de un colegio ubicado en el sur occidente Colombiano, a través de la Escala Habilidades Sociales Relacionadas con el proceso de comunicaci...

  7. Resistência ao clopidogrel: prevalência e variáveis associadas

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.

  8. Complicação de derivação ventrículo-peritoneal: hérnia inguinal com migração do cateter para o saco escrotal. Relato de caso

    Directory of Open Access Journals (Sweden)

    Henriques José Gilberto de Brito

    2003-01-01

    Full Text Available A derivação ventrículo-peritoneal (DVP com válvula é o método de tratamento mais usado para o controle da hidrocefalia. Suas complicações mais frequentes são o mal funcionamento do sistema e infecções. O desenvolvimento de hérnia inguinal ou hidrocele em pacientes com DVP é condição pouco frequente e a migração do cateter abdominal para o saco escrotal é raramente descrita. A patência do processo vaginal, o aumento da pressão intra-abdominal pelo líquor e a idade do paciente são alguns dos fatores relacionados com a gênese deste tipo de complicação. Neste estudo é relatado caso de criança com hérnia inguino-escrotal desenvolvida após DVP com migração do cateter para o saco escrotal. São discutidas a revisão da literatura sobre o tema e a conduta a ser adotada.

  9. Significados Atribuídos ao Lazer na Terceira Idade: Observação Participante em Encontros Musicais

    Directory of Open Access Journals (Sweden)

    Fábio Francisco de Araujo

    2016-10-01

    Full Text Available Este estudo buscou investigar os significados atribuídos ao lazer em grupo por consumidores idosos. O estudo parte de uma revisão da literatura sobre consumo e lazer na Terceira Idade, enfatizando a passagem de uma perspectiva negativa, baseada em restrições ao consumo, para uma visão mais positiva do envelhecimento, nos estudos mais recentes. A pesquisa utilizou métodos oriundos da etnografia urbana, em particular a observação participante e as entrevistas em profundidade, adequados à natureza do fenômeno investigado. Foi escolhido, para a realização do trabalho de campo, um grupo de encontros musicais que se reúne no Palácio do Catete, no Rio de Janeiro. No decorrer da observação participante foram realizadas entrevistas informais com participantes, registradas em diário de campo, além do uso de fotografias e vídeos. Ao final da observação participante, que durou seis meses, foram realizadas 16 entrevistas em profundidade, gravadas e transcritas. Utilizaram-se técnicas de análise de discurso. Seis diferentes categorias de significados emergiram do trabalho de campo: (1 significado hedônico; (2 espaço de sociabilidade; (3 nostalgia; (4 qualidade de vida; (5 (reconstrução da identidade e; (6 aprendizado. Verificou-se que a imersão nesta atividade de lazer permitiu aos idosos participantes produzirem uma ressignificação da Terceira Idade.

  10. Programa de exercícios para prevenção de lesões músculo-esqueléticas ligadas ao trabalho em trabalhadores do sector das telecomunicações

    OpenAIRE

    Alcântara, Randa Mendes da Silva

    2014-01-01

    Mestrado em Fisioterapia As lesões músculo-esqueléticas relacionadas ao trabalho têm um impacto económico muito grande, especialmente por causa dos altos custos associados a ausência de trabalho. Assim o propósito deste estudo foi Avaliar a Prevalência das lesões músculo-esqueléticas relacionadas ao trabalho nos funcionários de loja Ginga Shopping, com vista a elaboração de uma proposta de prevenção baseado em um programa de ginástica laboral, para tal pretendemos identificar a prevalência...

  11. Lesão brônquica e pneumotórax após reintubação usando um cateter para troca da via aérea

    Directory of Open Access Journals (Sweden)

    Juliano P. de Almeida

    2013-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Relatamos um caso de pneumotórax causado por perfuração brônquica durante uma reintubação usando um cateter para troca da via aérea (CTVA em um paciente com câncer de cabeça e pescoço. RELATO DE CASO: Paciente do sexo masculino, 53 anos, com carcinoma de orofaringe, foi internado na UTI com pneumonia grave e síndrome da angústia respiratória aguda (SARA. O paciente foi identificado como sendo de difícil intubação e uma sonda endotraqueal (SET foi inserida através de um broncoscópio. Após uma semana de tratamento, observou-se ruptura do manguito endotraqueal. A troca da sonda endotraqueal foi necessária para obter uma ventilação pulmonar satisfatória. Um cateter para troca da via aérea (Cook, tamanho 14 foi usado para realizar a reintubação. Depois da reintubação, o paciente apresentou piora na saturação de oxigênio e uma radiografia revelou um grande pneumotórax. Um dreno torácico foi inserido e uma melhora imediata na saturação de oxigênio foi observada. A repetição da radiografia confirmou o posicionamento correto do dreno torácico e a reexpansão do pulmão direito. A broncoscopia realizada mostrou uma laceração posterior do brônquio principal direito. O paciente foi extubado no dia seguinte. Depois de quatro dias, o dreno torácico foi removido. A radiografia realizada um dia depois da retirada do dreno revelou um pequeno pneumotórax no lobo superior direito, mas o paciente permaneceu assintomático. CONCLUSÕES: O cateter para troca da via aérea é uma ferramenta valiosa para lidar com pacientes difíceis de intubar. Embora os médicos geralmente concentrem sua atenção em evitar um barotrauma causado pelo suplemento de oxigênio ou ventilação a jato através do CTVA, a preocupação com a técnica de inserção pode minimizar as complicações que ameaçam a vida e aumentar a segurança do CTVA.

  12. Dilatação por cateter-balão (dacrioplastia para tratamento das obstruções congênitas do ducto lacrimonasal Balloon-catheter dilatation (dacrioplasty for congenital nasolacrimal duct obstruction treatment

    Directory of Open Access Journals (Sweden)

    Roberto Murillo Limongi de Souza Carvalho

    2009-10-01

    Full Text Available OBJETIVO: Verificar o resultado da técnica, inédita no Brasil, de dilatação do ducto lacrimonasal usando cateter-balão para tratamento da obstrução congênita do ducto lacrimonasal. MÉTODOS: Foram tratadas crianças com idade entre dois e cinco anos, com obstrução congênita de vias lacrimais usando o cateter-balão (Lacricath® para dilatação das vias lacrimais. O cateter foi introduzido pelo ponto lacrimal superior, sob anestesia geral. RESULTADOS: Entre os 27 olhos tratados, 23 apresentaram desaparecimento dos sinais e sintomas de lacrimejamento (taxa de sucesso de 85,2%. Todos os procedimentos foram realizados sem intercorrências e o seguimento pós-operatório mínimo foi de um ano. CONCLUSÃO: A dilatação com balão mostrou-se segura e eficiente como primeiro procedimento para os casos de obstrução congênita das vias lacrimais em crianças com mais de dois anos.Purpose: To verify the results of balloon-catheter dilatation for the treatment of congenital lacrimal duct obstruction. To the best of author's knowledge this procedure has not been previously used in Brazil and deserves scientific studies. METHODS: Children between 2 and 5 years old, with congenital lacrimal duct obstruction, were treated with balloon-catheter dilatation (Lacricath®. Catheter was introduced by the superior lacrimal punctum, under general anesthesia. RESULTS: Twenty-seven eyes were treated and 23 presented total improvement of epiphora signs and symptoms (85.2% success rate. During a one year follow-up, all the procedures had good outcomes, without complications and all the children had 1 year of follow-up. CONCLUSION: Balloon-catheter dilatation is an efficient and safe procedure and might be used for congenital lacrimal duct obstruction treatment in children older than 2 years.

  13. ATLAS DIGITAL DE MORFOLOGIA COMPARADA: UMA FERRA-MENTA COMPLEMENTAR AO ENSINO DE HISTOLOGIA E HISTO-PATOLOGIA

    OpenAIRE

    Burity, Carlos Henrique de Freitas; UNIGRANRIO; Cardozo, Sergian Vianna; Unigranrio

    2014-01-01

    O objetivo do presente trabalho foi estruturar um atlas de morfologia comparada digital e disponibiliza-lo, como ferramenta digital complementar de auxílio ao estudo dos alunos, junto ao portal acadêmico da Universidade, facilitando o ensino e aprendizagem nas áreas de morfologia. Avaliou-se por meio de grupos comparativos o desempenho dos alunos nas disciplinas relacionadas, de 2009 a 2012, utilizando-se os parâmetros: alunos abaixo da média e o índice de reprovação. Os resultados demonstrar...

  14. Avaliação da qualidade de vida relacionada à saúde de cortadores de cana-de-açúcar nos períodos de entressafra e safra

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Soares de Carvalho Junior

    2012-12-01

    Full Text Available OBJETIVO: Avaliar a qualidade de vida relacionada à saúde de cortadores de cana-de-açúcar. MÉTODOS: Estudo longitudinal em uma usina sucroalcooleira no Oeste do estado de São Paulo de abril (final da entressafra a outubro (final da safra de 2010. Foram avaliados 44 cortadores de cana-de-açúcar tabagistas e não tabagistas em três períodos: ao final da entressafra, no fim do terceiro mês de safra e no final da safra. A qualidade de vida relacionada à saúde foi avaliada pelo questionário Medical Outcomes Study 36-Item Short-Form Health Survey (SF-36. Foram realizados análise de variância para medidas repetidas e teste de Friedman para comparar a qualidade de vida entre os períodos. Utilizou-se o teste de Goodman para identificar a frequência dos trabalhadores cujo escore aumentou nos períodos de safra em comparação com a entressafra (respondedores positivos, considerando-se as variáveis qualitativas dos domínios do SF-36. RESULTADOS: Ao final da entressafra, 23% dos trabalhadores desistiram do trabalho; 27% eram tabagistas. Houve decréscimo significativo no domínio vitalidade no final da safra em comparação com a entressafra. Os desistentes apresentaram maior escore no domínio aspecto social em relação ao grupo que permaneceu no trabalho. Não houve diferença na qualidade de vida relacionada à saúde entre tabagistas e não tabagistas. No entanto, observou-se maior percentual de respondedores positivos entre não tabagistas nos domínios aspecto físico, social e emocional nos três meses de safra e nos domínios estado geral de saúde e aspecto social nos seis meses de safra, quando comparados aos tabagistas. CONCLUSÕES: A qualidade de vida relacionada à saúde em cortadores de cana-de-açúcar mostrou-se diminuída após o período de safra no domínio vitalidade. Os trabalhadores que permaneceram na safra são os que apresentaram piores aspectos sociais, o que mostra a necessidade de promoção de pol

  15. Percepção e registro de abuso de álcool e de doenças relacionadas num hospital geral universitário

    Directory of Open Access Journals (Sweden)

    Rosa A. A.

    1998-01-01

    Full Text Available OBJETIVO: Avaliar a associação entre o resultado do teste CAGE aplicado em pacientes internados num hospital geral universitário (Hospital de Clínicas de Porto Alegre - HCPA e a percepção e registro de abuso de álcool e de doenças relacionadas pelas equipes de saúde. PACIENTES E MÉTODOS: O delineamento envolveu três fases: a aplicação do teste CAGE aos 385 pacientes adultos e adolescentes internados considerados elegíveis para o estudo; b revisão dos prontuários dos pacientes CAGE-positivo e de um número igual de pacientes CAGE-negativo, estratificados por área de internação e sorteados, para identificar hábitos alcoólicos e a presença de doenças relacionadas ao uso de álcool; c entrevista com os membros das equipes médicas responsáveis para avaliar sua percepção sobre o hábito alcoólico em seu paciente. As diferenças encontradas foram analisadas através do teste Qui-quadrado e do teste t de Student, com significância estatística em nível de 5% bicaudal. RESULTADOS: Foram encontrados 51 pacientes CAGE-positivo (13%. A equipe médica registrou abuso de álcool no prontuário de 51% dos pacientes CAGE-positivo e 10% dos CAGE-negativo, e a equipe de enfermagem fez este registro no prontuário de 31% dos pacientes CAGE-positivo e 8% dos CAGE-negativo (p=.724. Não houve diferença entre o registro e a percepção da equipe médica (p=.184. A prevalência de doenças relacionadas ao abuso de álcool foi 27% quando se examinou os prontuários médicos e 26% quando se entrevistou a equipe médica (p=.861, sendo maior entre os pacientes CAGE-positivo (43% do que entre os CAGE-negativo (10% (p=.0003. CONCLUSÕES: O abuso de bebidas alcoólicas e a presença de doenças associadas ao mesmo são condições prevalentes nos pacientes admitidos ao HCPA. Entretanto, mais de metade dos casos não foram detectados pela equipe de saúde, havendo correspondência entre os registros de prontuário e a entrevista.

  16. Atuação do enfermeiro no cuidado com o cateter central de inserção periférica no recém-nascido Actuación del enfermero en el cuidado con el cateter central de inserción periferica en el recién nacido Action of the nurse with peripherally inserted central catheter in the infant newborn

    Directory of Open Access Journals (Sweden)

    Zaira Simas Rodrigues

    2006-10-01

    Full Text Available Os avanços tecnológicos em Neonatologia vêm beneficiando os recém-nascidos que necessitam de um acesso venoso seguro. Objetivou-se investigar a atuação do enfermeiro no cuidado com o Cateter Central de Inserção Periférica (PICC na Unidade de Terapia Intensiva Neonatal em Fortaleza, CE. A amostra foi composta por 17 enfermeiros e os dados foram coletados de julho a agosto/2004 através de questionário estruturado. Nos resultados verificou-se que 09 citaram a veia basílica como a mais indicada para a punção; 17 mencionaram a lavagem das mãos antes e após o manuseio e a lavagem do cateter antes e após as medicações como os cuidados mais importantes. Conclui-se que o manuseio deste dispositivo requer conhecimento e habilidade por parte dos profissionais.Los avances tecnológicos en la Neonatología han beneficiando los recién nacidos de alto riesgo, que necesitan de un acceso venoso seguro. Este trabajo tuvo por objetivo investigar la actuación del enfermero en el cuidado con el Cateter Central de Inserción Periférica (PICC en la Unidad de Terapia Intensiva Neonatal en Fortaleza, CE. Los datos fueron recolectados de julio a agosto de 2004 a través de un cuestionario. En los resultados se verificó que 09 citaron la vena basílica como de más indicada para la punción; 17 mencionaron de entre los cuidados, el lavado de las manos antes y después de lo manoseo y el lavado del cateter antes y después de las medicaciones como los más importantes. Se concluye que lo manoseo de este dispositivo requiere conocimiento y habilidad por parte de los profesionales.Technological advances in Neonatology have benefited the infant newborn who need a safe venous access. This study aimed at investigating the actions of the nurse regarding Peripherally Inserted Central Catheter (PICC in the Neonatal Intensive Care Unit in Fortaleza, CE. The sample was composed by 17 nurses; the data were collected from July to August 2004 through a structured

  17. Avaliação funcional do apêndice atrial esquerdo ao ecocardiograma transesofágico antes e após valvotomia percutânea na estenose mitral Functional assessment of the left atrial appendage at transesophageal echocardiography before and after percutaneous valvotomy in the mitral stenosis

    Directory of Open Access Journals (Sweden)

    Solange Bernardes Tatani

    2005-06-01

    Full Text Available OBJETIVO: Avaliar os efeitos da abertura efetiva da valva mitral estenótica através da valvotomia percutânea por cateter balão na função do apêndice atrial esquerdo. MÉTODOS: Foram estudados 12 pacientes com estenose mitral sintomática, em ritmo sinusal, submetidos ao ecocardiograma transesofágico antes e após valvotomia percutânea por cateter balão efetiva. Em relação ao apêndice atrial esquerdo, foram analisadas ao Doppler pulsátil as velocidades máximas e respectivas integrais dos fluxos anterógrado e retrógrado, além da fração de ejeção calculada pela planimetria da área desta estrutura. RESULTADOS: Houve aumento significante das velocidades de fluxo anterógrado do apêndice atrial esquerdo após valvotomia percutânea por cateter balão (pré: média de 0,30 m/s; pós: média de 0,47 m/s; pOBJECTIVE: To assess the effects of the relief of the mitral stenosis by percutaneous ballon valvotomy in the function of the left atrial appendage. METHODS: Twelve patients with symptomatic mitral stenosis, in sinus rhythm, were studied. They were submitted to the transesophageal echocardiogram before and after effective percutaneous ballon valvotomy. Concerning the left atrial appendage, the peak flow velocities and the respective integral of the anterograde and retrograde flow, in addition to the ejection fraction calculated through the planimetry of the area of that structure, were analyzed at the pulsatile Doppler. RESULTS: There was a significant increase of the anterograde flow velocity of the left atrial appendage after percutaneous ballon valvotomy (pre: mean of 0.30 m/s; post: mean of 0.47 m/s; p<0.05 and their respective integrals. The same happened with the retrograde flow velocity (pre: mean of 0.35 m/s, post: mean of 0.53 m/s; p<0.05. There was a tendency of increase of the ejection fraction of the left atrial appendage after the procedure (pre: mean of 20%, post: mean of 31%; p=0.08. CONCLUSION: The effective

  18. Retinosquise juvenil ligada ao X

    Directory of Open Access Journals (Sweden)

    Cesar Gomes da Silveira

    2015-08-01

    Full Text Available RESUMO Relatar o caso de um paciente masculino de 28 anos que foi encaminhado ao Centro de Estudos e Pesquisas Oculistas Associados (RJ para avaliação de retina e apresentou os achados típicos de retinosquise juvenil ligada ao cromossomo X: maculopatia cistóide com formação de cistos na fóvea e retinosquise periférica. Foi realizado o manejo conservador, com atenção para as complicações.

  19. Nociones relacionadas con las cuevas en la lengua y cosmovisión tseltales

    Directory of Open Access Journals (Sweden)

    Marceal Méndez Pérez

    2014-01-01

    Full Text Available En el presente texto se estudian algunas nociones relacionadas con las cuevas entre los tseltales de Chiapas, las cuales sólo en lengua tseltal parecen tener sentido. Dichas nociones permiten conocer y comprender otras funciones importantes de las cuevas, como su carácter de entradas hacia el interior de la tierra y la montaña, o hacia el lugar llamado Inframundo.

  20. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; hide

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  1. Qualidade de vida relacionada com a visão em pacientes com degeneração macular relacionada à idade neovascular

    Directory of Open Access Journals (Sweden)

    Maria Picoto

    2015-08-01

    Full Text Available RESUMO Objetivo: Avaliar o impacto da degeneração macular relacionada à idade (DMRI na qualidade de vida relacionada com a visão (QVRV numa amostra de pacientes portugueses. Métodos: Estudo observacional em corte transversal, não comparativo no qual foram incluídos 68 pacientes seguidos no departamento de Retina Médica do Serviço de Oftalmologia do Centro Hospitalar de Lisboa Ocidental, entre janeiro e abril de 2011. A QVRV foi avaliada por meio do questionário National Eye Institute Visual Functioning Questionnaire (NEI-VFQ-25, traduzido para o português. Os scores obtidos foram analisados e correlacionados com os seguintes parâmetros idade, sexo, lateralidade da doença, tempo de follow-up, acuidade visual (AV e EFC iniciais e finais do melhor (MO e pior olho (PO. Resultados: A AV do PO apresentou valor preditivo nos scores global, atividade para longe, visão cromática, visão periférica, desempenho, função social e saúde mental (p<0,05. Num modelo de multivariáveis com inclusão de todos os parâmetros clínicos analisados, as variáveis estudadas explicaram 60% da variância do score global (SG com um valor preditivo de 0,08 (R2 0,57, p=0,088. Conclusões: A DMRI NV está associada a uma diminuição da QVRV. A AV do PO tem valor preditivo nos scores do NEI-VFQ-25.

  2. Síndrome neuroléptica maligna: relato de caso com recorrência associada ao uso de olanzapina

    Directory of Open Access Journals (Sweden)

    HANEL RICARDO A.

    1998-01-01

    Full Text Available A síndrome neuroléptica maligna (SNM consiste em reação idiossincrática a neurolépticos, provavelmente relacionada a bloqueio dos receptores dopaminérgicos nos gânglios da base, sendo por isso também conhecida como síndrome da deficiência aguda de dopamina.A SNM é caracterizada por hiperpirexia, alteração do nível de consciência, hipertonia, disfunção autonômica e insuficiência respiratória, podendo ainda ser encontrados rabdomiólise e leucocitose. O haloperidol é a droga mais frequentemente associada à síndrome. Relatamos o caso de um paciente de 30 anos que apresentou SNM em duas ocasiões diferentes, a primeira delas relacionada ao uso de haloperidol e clorpromazina e a segunda relacionada ao uso de olanzapina, fato este sem menção anterior na literatura indexada.

  3. Calidad de vida relacionada con la salud en pacientes con enfermedad renal crónica

    Directory of Open Access Journals (Sweden)

    Lilian Barros-Higgins

    2015-10-01

    Full Text Available Antecedentes. La calidad de vida relacionada con la salud se puede afectar en personas con enfermedad renal crónica. Objetivo. Determinar la calidad de vida relacionada con la salud de los pacientes con enfermedad renal crónica (ERC y su relación con variables sociodemográficas y datos clínicos. Materiales y métodos. Estudio analítico de corte transversal realizado en 80 personas con diagnóstico de enfermedad renal crónica. Participaron los pacientes que asistieron a la Unidad Renal y al servicio de hospitalización durante los meses de estudio. Se aplicó el cuestionario Kidney Disease Quality of Life (KDQOL-SF, valorando ocho dimensiones genéricas de la calidad de vida relacionada con la salud y tres específicas relacionadas con la enfermedad renal. Se compararon las variables socio demográficas y las relacionadas con la enfermedad con las dimensiones del KDQOOL-36. Resultados. El 23.5% de la población estudiada tenía entre 61 y 70 años y 51.3% eran hombres. Se obtuvieron promedios bajos en las dimensiones carga de la enfermedad renal (40.3, salud física (33.4 y salud mental (43.5 del componente genérico. Se encontró una correlación significativa de la edad con las dimensiones efectos de la enfermedad renal en la vida diaria (0.238, p=0.03 y el componente genérico salud física (-0.242, p=0.03. Un trabajo remunerado se correlacionó positivamente con los componentes genéricos salud física (0.499, p=0.001 y salud mental (0.375, p=0.001 y la carga de la enfermedad renal se correlacionó negativamente con el tiempo de diagnóstico de enfermedad renal (-0.241, p=0.02. Conclusión. La enfermedad renal crónica tiene una carga sobre la calidad de vida de los pacientes en términos de salud física, salud mental y carga de la enfermedad.

  4. Identificação de Zonas de Dor Relacionadas com Patologias Músculo- Esqueléticas num Grupo de Músicos

    Directory of Open Access Journals (Sweden)

    Mafalda Pires

    2016-12-01

    Full Text Available A dor relacionada com o uso excessivo dos músculos é um problema comum nos músicos (Steinmetz, Möller, Seidal e Rigotti, 2012. Esta, que pode variar desde um desconforto leve e passageiro a um desconforto prolongado e muito doloroso, é uma experiencia sensorial e emocional que normalmente se associa a uma lesão. Num artigo sobre esta temática, publicado em 2014, é afirmado que “o peso estático, os movimentos repetitivos, a ativação muscular excessiva, bem como a postura corporal extrema, são impostos ao corpo, causando danos, desde cedo na infância” (Nawrocka, Mynarski, Powerska, Grabara, Groffik e Borek, 2014: 29. Todos estes danos podem levar à dor crónica, sendo que, os músicos nestas condições têm mais tendência para atingir níveis elevados de ansiedade e pânico, do que músicos que não sofrem de dor (Zamorano, Riquelme,Kleber, Altenmüller, Hatem e Montoya, 2015. Também os anos de profissão, a frequência da prática musical e o tempo de estudo são os fatores que contribuem para o aumento de queixas da dor nos músicos. No sentido de perceber quais as principais queixas do foro músculo-esquelético apresentadas por músicos, o objetivo deste capítulo centra-se na identificação das zonas mais afetadas do corpo humano relacionadas com a prática instrumental, bem como as causas da dor que delas advém.

  5. REALIDADE AUMENTADA APLICADA AO DESIGN

    OpenAIRE

    Fernandes, Bruno Chagas Alves; Sánchez, Joaquín Fernández

    2008-01-01

    Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  6. Realidade aumentada aplicada ao design

    OpenAIRE

    Fernández Sánchez, Joaquín

    2008-01-01

    Este artigo apresenta o estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  7. Cometas: Das Lendas aos Fatos

    Science.gov (United States)

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  8. Reações tegumentares adversas relacionadas aos agentes antineoplásicos: parte II Adverse mucocutaneous reactions related to chemotherapeutic agents: part II

    Directory of Open Access Journals (Sweden)

    Paulo Ricardo Criado

    2010-10-01

    Full Text Available Os eventos e reações envolvendo quimioterapia são frequentes na prática oncológica. Agentes quimioterápicos são uma modalidade de tratamento amplamente utilizada. Efeitos colaterais podem variar de frequência e também ser confundidos com outras manifestações tegumentares do tratamento oncológico. Este artigo objetiva expor as informações sobre reações cutâneas à quimioterapia, em especial, aqueles para os quais o dermatologista é requisitado a emitir parecer e a comentar sobre a segurança e a viabilidade da readministração de uma droga específica. Os autores descrevem os aspectos associados a esses eventos, fazendo uma análise detalhada de cada um deles.Events and reactions involving chemotherapy are common in clinical oncology. Chemotherapeutic agents are widely used in therapy. Side effects range from the common to the rare and may be confused with other mucocutaneous manifestations resulting from the oncological treatment. The objective of this paper was to present data on skin reactions to chemotherapy, particularly those cases in which the dermatologist is requested to issue a report and asked to comment on the safety and viability of readministration of a specific drug. The authors describe aspects associated with these events, presenting a detailed analysis of each one of them.

  9. Avaliações biomecânicas e biológicas relacionadas às próteses implanto-suportadas e aos implantes osseointegrados

    OpenAIRE

    Barão, Valentim Adelino Ricardo

    2011-01-01

    Objetivos: (1) Investigar o papel de diferentes níveis de pH da saliva artificial (3; 6,5 e 9) no comportamento corrosivo do titânio comercialmente puro (cp-Ti) e da liga Ti-6Al-4V (Capítulo 1); (2) Avaliar a influência do processo de corrosão na afinidade do lipopolissacarídeo (LPS) de Escherichia coli para o cp-Ti e o Ti-6Al-4V (Capítulo 2); (3) Investigar a natureza tribocorrosiva do titânio em saliva artificial em presença de LPS (Capítulo 3); (4) Comparar o efeito de diferentes designs d...

  10. O conhecimento das adolescentes sobre questões relacionadas ao sexo Adolescent females' knowledge about pregnancy prevention methods and sexually transmitted diseases

    Directory of Open Access Journals (Sweden)

    Kelencristina T. Romero

    2007-02-01

    Full Text Available OBJETIVO: Avaliar o conhecimento sobre sexualidade, métodos contraceptivos e doenças sexualmente transmissíveis (DST entre adolescentes do sexo feminino, das zonas rural e urbana, de uma escola pública. MÉTODOS: Estudo transversal, realizado com 506 meninas, com idades entre 10 e 16 anos, da Escola Dr. Roberto Feijó, em Guararema, SP. Utilizou-se questionário semi-estruturado, contendo perguntas gerais sobre sexualidade e métodos de prevenção de gravidez e DST. O teste do Qui-quadrado foi usado para verificar a associação entre as variáveis. RESULTADOS: A média de idade da população adolescente da escola proveniente da área rural foi 13 anos e 11 meses e da área urbana foi 13 anos e 7 meses, não havendo diferença estatística entre as médias. Trinta e um por cento eram provenientes da zona rural e 69% da urbana. As jovens da zona rural buscaram mais informações sobre a sexualidade (81,2%, comparadas com as da zona urbana (72,2 % (pOBJECTIVE: To evaluate knowledge about sexuality, contraceptive methods and sexually transmitted diseases (STD by female adolescents from both rural and urban zone attending public school. METHODS: A cross sectional study was made with 506 teenagers, 10 to 16 years old, attending Dr. Roberto Feijó Public School in Guararema, São Paulo. A semi-structured questionnaire with general questions about sexuality, contraceptive methods and STD was administered. The Chi-square test was used to verify the association between variables. RESULTS: Mean age of the girls from the rural zone was13 years and 11 months and from the urban zone age was 13 years and 7 months, with no statistical difference. Of all the girls, 31% came from the rural and 69% from the urban zone. Adolescents from the rural zone looked for more information about sexuality (81.2% when compared to those from the urban zone (72.2 % (p<0.0568. Parents were the main source of information for both zones. The condom was the most familiar method in the rural (44% and the urban (45% zones (p=0.0022. AIDS was the best known STD by girls from the rural (43% and urban (39% zones (p=0.7843. CONCLUSION: Most of the surveyed female adolescents sought information about sexuality, however their knowledge about STD and contraceptive methods was inadequate.

  11. Avaliação ergonômica e prevalência das doenças relacionadas ao trabalho em empresas calçadistas

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Veiga Quemelo

    2009-12-01

    Full Text Available The footwear industry of the city of Franca is one of the largest in production in Brazil, what involves various risk factors with the worker's health and can result in more absences and more expenses for the companies and government. Thus, the study has as objective to do a rising of the prevalence of workers' absences, as well as to evaluate the pain symptoms, discomfort and it fatigues in workers of the footwear industry of Franca/SP. They raised the data of four different companies from the city of Franca regarding the number of workers' absences, as well as demographic and occupational data and osteomuscular complain of 39 workers of both sexes on footwear sector through a questionnaire, within an ergonomic approach. The data were tabulated and analyzed to verify what is the real need of the ergonomic intervention in the footwear industry. We observed that 69,2 % of the workers did not need the measuring corrective, 28,2% was necessary corrective measuring in the near future and 2,6% of the functionaries need corrections as brief as possible. However, more than half of the observed workers (71,8% feel pain in some area of the body, and 86% of the functionaries agree that this pain is related to the work, repetitive movement and overload. Thus, we can conclude that there are excessive load on this functionaries, being necessary to implement ergonomics in this industry.

  12. Lesão brônquica e pneumotórax após reintubação usando um cateter para troca da via aérea Lesión brónquica y neumotórax posterior a la reintubación usando un catéter para el cambio de la vía aérea Bronchial injury and pneumothorax after reintubation using an airway exchange catheter

    National Research Council Canada - National Science Library

    Juliano P. de Almeida; Ludhmila A. Hajjar; Júlia T. Fukushima; Rosana E. Nakamura; Rodolfo Albertini; Filomena R. B. G. Galas

    2013-01-01

    ... reintubação usando um cateter para troca da via aérea (CTVA) em um paciente com câncer de cabeça e pescoço. RELATO DE CASO: Paciente do sexo masculino, 53 anos, com carcinoma de orofaringe, foi internado na UTI com pneumonia grave e...

  13. Funcionalidade e qualidade de vida relacionada com a saúde em doentes com edema venoso

    OpenAIRE

    Almeida, Sara; Crisóstomo, Rute

    2015-01-01

    Objetivo: Avaliar a funcionalidade e a qualidade de vida relacionada com a saúde em indivíduos com edema venoso por insuficiência venosa crónica nos membros inferiores. Relevância: Pretende-se perceber quais as consequências da insuficiência venosa crónica, de forma a melhorar a intervenção da Fisioterapia. Amostra: Participaram 50 indivíduos, 24 no Grupo Edema e 26 no Grupo Controlo. Materiais e métodos: Foi realizado um estudo transversal, comparativo e correlacional, utilizando-...

  14. Prevalencia de lesiones músculo-esqueléticas relacionadas con el trabajo en fisioterapeutas

    OpenAIRE

    Rodríguez Barbas, Cristina

    2011-01-01

    Antecedentes: Diferentes estudios señalan la frecuencia de lesiones músculo- esqueléticas relacionadas con el trabajo en fisioterapeutas pero no se ha encontrado ninguno que lo haga en Madrid y Guadalajara. Los objetivos de la presente investigación fueron hallar la prevalencia de dichas lesiones en los fisioterapeutas, y relacionarlas con factores epidemiológicos como sexo, edad, años en activo y horas de trabajo semanales; encontrar con qué frecuencia ...

  15. Calidad del sueño relacionada con el rendimiento académico de

    OpenAIRE

    Salazar Carrillo, Katherine; Santos R., Gabriela; Carhuancho-Aguilar, José

    2013-01-01

    La calidad del sueño está directamente relacionada al buen funcionamiento de los procesos cognitivos, así como al bienestar de los seres humanos. En los estudiantes de Medicina Humana, los procesos de memoria a corto y largo plazo toman especial importancia para el aprendizaje del contenido académico.Objetivo: Demostrar la existencia de una relación entre la calidad del sueño y el rendimiento académico de los alumnos del curso de Fisiología Humana de la Facultad de Medicina Humana de la Unive...

  16. Calidad de vida relacionada con salud y redes de apoyo social en adultos mayores chilenos

    OpenAIRE

    Vargas Palavicino, Irma Isabel

    2014-01-01

    [ES]El estudio empírico que a continuación presentamos versa sobre la percepción de calidad de vida relacionada con salud (CVRS) y apoyo social en personas de 60 y más años que residían en las regiones octava y novena del sur de Chile, pertenecientes al mundo rural -indígenas, mapuche y no indígenas-, de estratos socioeconómicos bajos y medios-bajos. La metodología utilizada en el estudio fue mixta concurrente; en la fase cuantitativa participaron 220 personas mayores a los cuales se les apli...

  17. AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.

    Science.gov (United States)

    Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel

    2017-05-01

    Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.

  18. Fatores de risco associados ao câncer de mama em uma amostra de mulheres participantes de uma universidade da terceira idade

    OpenAIRE

    Bussolotto, Fernanda; Siviero, Josiane; Pio da Silva, Ana Carolina

    2013-01-01

    O câncer de mama é o tipo de câncer mais comum entre as mulheres, sendo considerado uma doença de extrema importância para a saúde pública em nível mundial. Acredita-se que sua incidência e mortalidade ascendentes estejam relacionadas à maior exposição a fatores de risco e ao envelhecimento populacional. O objetivo deste estudo foi descrever a presença de fatores de risco associados ao câncer de mama em mulheres participantes da Universidade da Terceira Idade da Universidade de Caxias do Sul ...

  19. REALIDADE AUMENTADA APLICADA AO DESIGN

    Directory of Open Access Journals (Sweden)

    Bruno Chagas Alves Fernandes

    2008-07-01

    Full Text Available Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  20. Calidad de vida relacionada con salud, resiliencia y felicidad en hombres privados de la libertad

    Directory of Open Access Journals (Sweden)

    Japcy Margarita Quiceno

    2012-01-01

    Full Text Available Objetivo. El propósito de este estudio fue evaluar las diferencias de la calidad de vida relacionada con la salud, la resiliencia y felicidad en hombres privados (n=21 y no privados (n=21 de la libertad. Método. Bajo un diseño descriptivo - comparativo, se utilizó el cuestionario de salud MOS SF-36, la escala de resiliencia (RS y la escala de felicidad subjetiva (SHT. Resultados. Los datos recogidos evidenciaron diferencias entre ambos grupos evaluados, en las categorías de ocupación, estrato socioeconómico y estado civil, más no en sus niveles de calidad de vida, resiliencia y felicidad, a excepción de la dimensión función social de la calidad de vida. Conclusión. Este estudio, aunque preliminar y exploratorio brinda información sobre el valor que tienen variables positivas, como la resiliencia, la felicidad y la calidad de vida relacionada con la salud en personas privadas de la libertad.

  1. Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Santos Saldanha

    Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.

  2. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube.   Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  3. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-06-01

    Full Text Available Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  4. Ablação por cateter do flutter atrial. Caracterização eletrofisiológica da interrupção da condução pelos istmos posterior e septal Catheter ablation of atrial flutter. Electrophysiological characterization of posterior and septal isthmus block

    Directory of Open Access Journals (Sweden)

    José Marcos Moreira

    1998-07-01

    Full Text Available OBJETIVO: Avaliar os tipos de bloqueio obtidos nos istmos posterior (entre o anel tricuspídeo e veia cava inferior e septal (entre o anel tricuspídeo e óstio do seio coronário, após ablação do flutter atrial (FLA. MÉTODOS: Foram submetidos à ablação por radiofreqüência (RF 14 pacientes com FLA tipo I (9 homens em 16 procedimentos. A ativação atrial ao redor do anel tricuspídeo foi avaliada em ritmo sinusal utilizando-se cateter "Halo" com 10 pares de eletrodos (H1-2 a H19-20, durante estimulação do seio coronário proximal (SCP e região póstero-lateral do átrio direito (H1-2, antes e após ablações lineares. De acordo com a frente de programação do impulso definiu-se: ausência de bloqueio (condução bidirecional, bloqueio incompleto (condução bidirecional com retardo num dos sentidos e bloqueio completo (ausência de condução pelo istmo. O intervalo desta ativação (deltaSCP/H1-2 foi analisado. RESULTADOS: Bloqueio completo foi obtido em 7 procedimentos (44% e incompleto em 4 (25%. O deltaSCP/H1-2 foi de 74 ± 26ms no primeiro grupo e de 30,5 ± 7,5ms no segundo (pPURPOSE: Evaluate the different types of conduction blocks obtained between inferior vena cava-tricuspid annulus (posterior isthmus and between tricuspid annulus-coronary sinus ostium (septal isthmus after radiofrequency (RF catheter ablation of atrial flutter (AFL METHODS: In 16 procedures, 14 patients (pts, 9 male, with type I AFL underwent RF ablation. Atrial activation around tricuspid annulus was performed with a 10-bipole "Halo" catheter (H1-2; H19-20. In sinus rhythm, isthmus conduction was evaluated during proximal coronary sinus (PCS and low lateral right atrium (H1-2 pacing, before and after linear ablation. According to the wave front of impulse propagation we assessed absence of block (bidirectional conduction; incomplete block (bidirectional conduction with delay in one front of impulse propagation and complete block (absence of conduction

  5. Impacto econômico da implantação das boas práticas agropecuárias relacionadas com a qualidade do leite

    Directory of Open Access Journals (Sweden)

    Marcel Gomes Paixão

    2014-10-01

    Full Text Available Objetivou-se, neste estudo, avaliar o impacto econômico da implantação das boas práticas agropecuárias (BPA, relacionadas com a qualidade higiênica sanitária do leite. A pesquisa consistiu na simulação de nove cenários, compostos por três diferentes níveis de BPA para a melhoria da qualidade do leite (baixo, médio e alto, em três diferentes situações (somente aplicação das BPAs; aplicação das BPAs e construção da sala do leite; e aplicação das BPAs, construção da sala do leite e aquisição do tanque de expansão. O rebanho leiteiro hipotético constava de 30 vacas em lactação, com média de dez litros de leite/animal/dia, ordenhadas duas vezes ao dia, em ordenhadeira tipo "balde ao pé". A receita consistiu na média da bonificação/penalização, praticadas por dez laticínios da região sudeste, considerando-se diferentes intervalos de contagem de células somáticas (CCS e contagem bacteriana total (CBT. A inclusão das BPAs para a melhoria da qualidade do leite, quando praticadas em seu nível máximo, mostrou-se com rápido retorno do capital investido (payback e ótima taxa interna de retorno (TIR apenas para aqueles pecuaristas que já possuíam a sala do leite e o tanque de expansão.

  6. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  7. EPIDEMIOLOGICAL PROFILE OF PRIMARY BLOODSTREAM INFECTIONS IN NEONATAL INTENSIVE CARE UNIT

    Directory of Open Access Journals (Sweden)

    Camilla Ferreira Catarino

    2013-01-01

    Full Text Available Objetivo: descrever o perfil epidemiológico das infecções primárias de corrente sanguínea associadas ao cateter venoso central na Unidade de Terapia Intensiva Neonatal de um hospital no Rio de Janeiro no ano de 2010. Método: estudo descritivo e retrospectivo. Foi elaborado um banco de dados no programa Epi_info para indexação dos dados e posterior análise. Resultados: 16 recém-nascidos (RN evoluíram para IPCS associadas ao CVC; 66,7% eram pré-termos e 92,3% receberam nutrição parenteral.  O cateter de inserção periférica foi o mais utilizado (55,6%, seguido do cateter umbilical venoso com 22,2%. Dos microrganismos isolados 42,8% eram Staphylococcus Coagulase Negativo, 28,5% eram Staphylococcus aureus e 14,2% eram Candida Albicans. Conclusão: Percebeu-se que condições relacionadas ao RN, à gestação e ao CVC são fatores que predispõem esta clientela, o que reforça a necessidade de programas específicos de prevenção e controle de IPCS.

  8. Prevalencia de bacteriemias relacionadas con el catéter de hemodiálisis en una unidad hospitalaria

    Directory of Open Access Journals (Sweden)

    Patricia Arribas Cobo

    2013-12-01

    Full Text Available En la actualidad ha aumentado el uso de catéteres tunelizados como acceso vascular permanente para los pacientes en hemodiálisis a pesar de las complicaciones que tiene asociadas, como puede ser la bacteriemia relacionada con el catéter. El objetivo de este trabajo es mostrar la tasa de prevalencia de bacteriemia relacionada con el catéter para hemodiálisis, obtenida con la aplicación estricta de un protocolo de cuidados del catéter tunelizado por un personal bien entrenado en la unidad de hemodiálisis del Hospital Universitario Infanta Leonor entre abril de 2008 y abril de 2013, así como describir las posibles causas de bacteriemia relacionada con el catéter, la relación con alguna de las variables y su evolución en los últimos años. Durante los 5 años de estudio tuvimos 9 episodios de bacteriemia relacionada con el catéter, lo que supone una tasa global de prevalencia de 0,25/1000 días de catéter. La tasa por cada uno de los años fue menor de 1/1000 días de catéter. Los pacientes que tuvieron una bacteriemia relacionada con el catéter tuvieron implantados mayor número de catéteres que los que no la tuvieron, siendo esta diferencia significativa (p=0,027. No se encontraron diferencias con respecto a la edad, el sexo, la diabetes mellitus, el índice de comorbilidad de Charlson y la localización de los catéteres entre los pacientes que padecieron una bacteriemia relacionada con el catéter de los que no.

  9. Diagnosis of AOS: definition and criteria.

    Science.gov (United States)

    Croot, Karen

    2002-11-01

    Presented in this article is a discussion of current progress in behavioral, cognitive, and neuroanatomic definitions of apraxia of speech (AOS). A behavioral definition summarizes the speech symptoms that should be considered diagnostic of AOS with or without co-occurring aphasia and dysarthria. AOS is defined in cognitive terms as an impairment in the translation of phonological representations into specifications for articulation. Progress toward a neuroanatomic definition of AOS will rely on mapping the processes described by increasingly sophisticated cognitive models of normal speech production to the brain. The article describes criteria that have been proposed for differentiating apraxic from phonological and dysarthric disorders and suggests that syndrome-based approaches to the diagnosis of AOS may obscure important differences between individual presentations of apraxic disruption as well as similarities between AOS and other speech-language disorders.

  10. Compras TIC relacionadas con la accesibilidad en la contratación pública en España

    OpenAIRE

    Tejerina Pérez, Rosa María

    2016-01-01

    En este informe se ofrecen datos cuantitativos sobre las compras públicas TIC relacionadas con la accesibilidad, así como un análisis de las palabras clave más significativas aparecidas en las mismas. Es el primer informe de compras públicas TIC relacionadas con la accesibilidad publicado en España. Las compras públicas tienen un carácter estratégico e impulsor. En este informe se destaca la importancia de la inclusión de requisitos de accesibilidad en todas las fases de la contratación de pr...

  11. Determinantes de la calidad de vida relacionada con la salud de pacientes en diálisis de Uruguay.

    OpenAIRE

    Ana I Galain; Inés Olaizola; Laura Schwartzmann; Carlos Zúñiga; Juan J. Dapueto

    2014-01-01

    Existen pocos estudios sobre la percepción subjetiva de la calidad de vida relacionada con la salud en pacientes renales cursando su etapa terminal, que vivan en países no industrializados. El propósito de este estudio fue comprender las relaciones subyacentes entre los diferentes determinantes de la calidad de vida relacionada con la salud, en los pacientes en tratamiento sustitutivo renal en Uruguay. Se realizó un estudio transversal en una muestra de 243 pacientes de cinco centros de hemod...

  12. Salud y conductas relacionadas con la salud según la atracción y la conducta sexual

    OpenAIRE

    Pérez, Glòria; Martí-Pastor, Marc; Gotsens, Mercè; Bartoll, Xavier; Diez, Elia; Borrell, Carme

    2015-01-01

    Objetivo: Describir la salud percibida, la salud mental y algunas conductas relacionadas con la salud según la atracción y la conducta sexual en los residentes en Barcelona en 2011. Métodos: Se analizó la salud percibida y mental, los trastornos crónicos y las conductas relacionadas con la salud, en 2675 personas de 15 a 64 años de edad teniendo en cuenta la atracción y la conducta sexual en el marco de la Encuesta de Salud de Barcelona 2011. Se ajustaron modelos multivariados de regresión...

  13. Avaliação cognitiva: leitura, escrita e habilidades relacionadas Evaluación cognitiva: lectura, escritura y capacidades relacionadas Cognitive evaluation: reading, writing and related abilities

    Directory of Open Access Journals (Sweden)

    Monilly Ramos Araujo

    2008-12-01

    Full Text Available A pesquisa teve como objetivo a análise dos múltiplos domínios envolvidos na leitura e escrita de crianças e adolescentes. Foram investigados 162 sujeitos, de ambos os sexos, com idades variando entre 08 e 16 anos, cursando a 2ª, 3ª e 4ª séries do Ensino Fundamental da rede pública de uma cidade do interior do Nordeste. O desempenho cognitivo das crianças foi analisado através de atividades que envolviam leitura e ditado de palavras e de pseudopalavras, consciência fonológica, processamento auditivo e visual e velocidade de processamento. Os resultados revelaram atraso no desenvolvimento das habilidades avaliadas, com imprecisão e distorções no uso das rotas fonológica e lexical. Conclui-se que é preciso delinear projetos de intervenção visando desenvolver as habilidades de consciência fonológica, processamento auditivo e velocidade de processamento em crianças nas fases iniciais da aquisição da leitura e escrita.La investigación tuvo como objetivo el análisis de los múltiples dominios envueltos en la lectura y escritura de niños y adolescentes. Se analizaron 162 sujetos, de ambos sexos, con edad entre 08 y 16 años, estudiando en 2ª, 3ª y 4ª series de la escuela primaria de la red pública de una ciudad en el interior del noreste. El rendimiento cognitivo de los niños se examinó a través de actividades relacionadas con lectura y dictado de palabras y pseudopalabras, conciencia fonológica, visual y auditiva y velocidad de procesamiento. Los resultados revelaron retraso en el desarrollo de las competencias evaluadas, con inexactitud y distorsiones en el uso de las rutas fonológica y lexical. Se deduce que es necesario esbozar proyectos de mediación para el desarrollo de las capacidades de conciencia fonológica, procesamiento auditivo y velocidad de procesamiento en niños en las primeras etapas de la adquisición de la lectura y escritura.Multiple domains involved in children and young people's reading and

  14. Asociacion entre diferentes indicadores socioeconomicos con la actividad fisica y aptitud fisica relacionada con la salud en adolescentes

    National Research Council Canada - National Science Library

    Diogo Henrique Constantino Coledam; Philippe Fanelli Ferraiol; Gustavo Aires de Arruda; Raymundo Pires Júnior; Marcio Teixeira; João Paulo de Aguiar Greca; Arli Ramos de Oliveira

    2013-01-01

    ... socioeconômicos com a atividade física e aptidão física relacionada à saúde em adolescentes. Métodos Participaram do estudo 716 adolescentes de ambos os sexos de 10 a 18 anos (46,8 % do sexo masculino...

  15. Limites e garantias do direito ao sigilo bancário em face da gestão de recursos públicos

    OpenAIRE

    Padilha Rebelo Marques, Karla

    2005-01-01

    A presente dissertação tem por escopo analisar o direito ao sigilo bancário sob diversos enfoques, situando-o ao longo da história da civilização mundial, demarcando-se, assim, sua íntima relação com a evolução do comércio, ainda antes de qualquer desenvolvimento de idéias relacionadas aos direitos da intimidade ou privacidade, típicos do pensamento liberal. Buscou-se, ainda, enfatizar a problemática da distinção entre o público e o privado no desenvolvimento do Estado brasilei...

  16. Creencias en salud en mujeres universitarias relacionadas con la toma de citología vaginal

    Directory of Open Access Journals (Sweden)

    Diana Carolina Rubio León

    2004-01-01

    Full Text Available Esta investigación se orientó al estudio de la relación existente entre las variables psicosociales propuestas por el Modelo de Creencias en Salud y la realización de la citología vaginal por parte de una muestra de mujeres universitarias entre los 18 y 27 años. En la primera fase del estudio se construyó una batería de instrumentos con el fin de evaluar las diferentes variables de interés: sociodemográficas, psicosociales, de riesgo, y relacionadas con la conducta saludable; en la segunda fase se realizó un estudio descriptivo correlacional exploratorio con una muestra de 110 mujeres universitarias. Se observaron diferentes asociaciones entre las variables evaluadas y la realización de la citología vaginal, en donde las variables barreras percibidas, motivación para la salud y señales para la acción, mostraron asociaciones importantes con la realización y mantenimiento de dicha conducta saludable.

  17. CREENCIAS EN SALUD EN MUJERES UNIVERSITARIAS RELACIONADAS CON LA TOMA DE CITOLOGÍA VAGINAL

    Directory of Open Access Journals (Sweden)

    Martha Restrepo Forero

    2004-06-01

    Full Text Available Esta investigación se orientó al estudio de la relación existente entre las variables psicosociales propuestas por el Modelo de Creencias en Salud y la realización de la citología vaginal por parte de una muestra de mujeres universitarias entre los 18 y 27 años. En la primera fase del estudio se construyó una batería de instrumentos con el fin de evaluar las diferentes variables de interés: sociodemográficas, psicosociales, de riesgo, y relacionadas con la conducta saludable; en la segunda fase se realizó un estudio descriptivo correlacional exploratorio con una muestra de 110 mujeres universitarias. Se observaron diferentes asociaciones entre las variables evaluadas y la realización de la citología vaginal, en donde las variables barreras percibidas, motivación para la salud y señales para la acción, mostraron asociaciones importantes con la realización y mantenimiento de dicha conducta saludable.

  18. Qualidade de vida relacionada à saúde de pessoas com diabetes mellitus tipo 2

    Directory of Open Access Journals (Sweden)

    Loisláyne Barros Leal

    2014-01-01

    Full Text Available El objetivo fue evaluar la Calidad de Vida Relacionada a la Salud de personas con Diabetes Mellitus tipo 2. Investigación transversal, realizada con 100 diabéticos. La recolección de datos se llevó a cabo entre marzo y abril de 2012, en dos equipos de la Estrategia Salud de la Familia de Picos, PI, Brasil, a través de entrevista individual. Se aplicó formulario con variables socioeconómicas, clínicas y el Medical Outcomes Study 36 – Item Short Form Health Survey (SF-36. El promedio entre los componentes del SF-36 osciló de 34,8 (Aspectos físicos a 72,0 (Salud mental. Hubo asociación estadísticamente significativa del dolor y la capacidad funcional con el sexo, así como de la capacidad funcional y los aspectos emocionales con la actividad física (p <0,05. En conclusión, los participantes presentaron mejor evaluación en la calidad de vida en las dimensiones que integran el componente mental.

  19. Direito e Risco: do Consumo ao Ambiente

    OpenAIRE

    Marques, Carlos Alexandre Michaello

    2014-01-01

    A presente Dissertação tem como tema de investigação “Direito e Risco: do Consumo ao Ambiente”. Para tanto, essa temática foi delimitada através da investigação sobre a capacidade do Direito a partir de uma leitura Sociológica e Antropológica de compreender e promover aprendizagem nas questões que envolvem o Risco como elemento decorrente do Consumo e que externa suas consequências ao Ambiente. Neste sentido, se direcionou a responder ao problema de saber: em que medida é possível e necessári...

  20. Uma aproximação semântica aos conceitos de urbano, rural e cooperativa

    Directory of Open Access Journals (Sweden)

    Francisco José Batista de Albuquerque

    Full Text Available No planejamento de políticas públicas vinculadas ao desenvolvimento rural, a definição de alguns conceitos, como os de ambiente rural, urbano e cooperativa são sumamente importantes. Considerando que a Psicologia pouco contribuiu no desenvolvimento rural, objetivou-se conhecer os significados que são socialmente atribuídos aos conceitos de rural, urbano e cooperativa. Através da participação de 318 estudantes do ensino médio, do estado da Paraíba (Brasil, pôde-se verificar que o rural é entendido como essencialmente rurícola; o ambiente urbano, por outro lado, é concebido como oposto ao rural e o conceito de cooperativa, tem uma significação eminentemente positiva, que engloba palavras como ajuda e união. Destaca-se a necessidade de se refletir criticamente acerca das políticas para o desenvolvimento rural e de pesquisas na área que contribuam para aclarar questões relacionadas ao desenvolvimento de propostas que contemplem o rural na sua totalidade, proporcionando rever conceitos e avaliar práticas de ações governamentais.

  1. Customer satisfaction and response to AOS

    Science.gov (United States)

    1999-01-01

    Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...

  2. Las Etapas de La Gestión del Conocimiento: Perspectivas relacionadas a las cadenas hoteleras

    Directory of Open Access Journals (Sweden)

    Carolina Sass de Haro

    2014-04-01

    Full Text Available Las Etapas de La Gestión del Conocimiento: Perspectivas relacionadas a las cadenas hoteleras - La gestión del conocimiento es una práctica organizativa que produce beneficios para la toma de decisiones. En un mercado cada vez más competitivo como la hotelería, trabajar efectivamente con la información y el conocimiento es importante. A partir de esto, el objetivo de este trabajo es analizar la aplicación de las cuatro etapas de la gestión del conocimiento (creación, transmisión, almacenamiento y aplicación en las cadenas hoteleras. Se trata de una investigación exploratoria con base en la bibliografía al respecto. Los resultados indican que la aplicación en las cadenas hoteleras de las cuatro etapas de la gestión del conocimiento es más que una tendencia, la gestión del conocimiento en hoteles se hace necesaria en un mercado cada vez más dinámico y globalizado.As Etapas da Gestão do Conhecimento: Perspectivas relacionadas a cadeias hoteleiras - A gestão do conhecimento é uma prática organizacional que produz benefícios para a tomada de decisões. Em um mercado cada vez mais competitivo, como o hoteleiro, trabalhar efetivamente com a informação e o conhecimento, é importante. A partir disto, o objetivo deste trabalho é o de analisar a aplicação das quatro etapas da gestão do conhecimento (criação, transmissão, armazenamento e aplicação nas cadeias hoteleiras. Trata-se de uma pesquisa exploratória e bibliográfica. Os resultados indicam que a aplicação das quatro etapas da gestão do conhecimento às cadeias hoteleiras é mais que uma tendência. A gestão do conhecimento em meios de hospedagem se faz necessária em um mercado cada vez mais dinâmico e globalizado.The Stages of Knowledge Management: perspectives related to the hotel chains - The knowledge management is an organizational practice that produces benefits for decision making. In an increasingly competitive market like the hotel industry, is

  3. Calidad de vida relacionada con la salud en la enfermedad de Parkinson

    Directory of Open Access Journals (Sweden)

    Roberto Cano-de la Cuerda

    2010-12-01

    Full Text Available La enfermedad de Parkinson (EP es un trastorno neurológico, discapacitante y progresivo caracterizado por múltiples síntomas motores y no motores que contribuyen al deterioro en la calidad de vida del paciente. La diversidad de síntomas asociados a la enfermedad y su manejo afectan a la funcionalidad y las expectativas del individuo sobre su bienestar físico, social y mental, que son los componentes fundamentales de la calidad de vida relacionada con la salud (CVRS. El objetivo del presente trabajo fue identificar las principales dimensiones de la CVRS afectadas en una población con EP con un grado de afectación leve-moderado. Treinta y seis pacientes con EP completaron este estudio transversal. Se emplearon el estadio de Hoehn y Yarh, el Unified Parkinson's Disease Rate Scale, la escala de actividades de la vida diaria de Schwab y England y el Test Get Up & Go. La calidad de vida fue valorada con el EuroQoL-5D y con el cuestionario Parkinson's Disease Questionnaire-39 items. Las dimensiones del PDQ-39, excepto el dominio PDQ-39 Dolor, así como el cuestionario EuroQoL-5D se correlacionaron de manera significativa con la gravedad de la enfermedad. La CVRS se correlacionó con el estado funcional de los pacientes. Únicamente el dominio PDQ-39 Dolor se correlacionó con el riesgo de caídas. Nuestros resultados sugieren que la CVRS de los pacientes con EP, en un estado leve-moderado de afectación, está muy influenciada por la gravedad de la enfermedad y el estado funcional.

  4. Diferencias relacionadas con la salud de mujeres y hombres adultos mayores

    Directory of Open Access Journals (Sweden)

    Ileana E Castañeda Abascal

    Full Text Available Introducción: la humanidad se enfrenta a la elevación del número de ancianos(as. Cuba no es una excepción. La salud en ancianos(as es diferente, debido a los factores biológicos, psicológicos y culturales a que están expuestos a lo largo de la vida, de ahí la necesidad de su estudio. Objetivos: identificar las diferencias relacionadas con la salud de mujeres y hombres adultos mayores en el área de salud Cuatro Caminos, durante el año 2009. Métodos: se realizó una investigación descriptiva y transversal. El universo estuvo constituido por los 1 562 ancianos (761 mujeres y 801 hombres residentes en el área de salud Cuatro Caminos. La información se recolectó a través de los registros de adultos mayores, hojas de cargo de los consultorios médicos de la familia, y una entrevista semiestructurada aplicada a la totalidad del universo. Resultados: las edades más representadas para ambos sexos estuvieron entre 60 y 79 años. Tanto mujeres como hombres padecían enfermedades crónicas, destacándose la hipertensión arterial. Las féminas fueron más frecuentes en los ancianos frágiles y en estado de necesidad. Los ancianos solos fueron mayoritariamente hombres. Las mujeres se realizaron más los exámenes periódicos de salud y recibieron atención domiciliaria. Conclusiones: la salud, las actividades que realizan y la atención geriátrica son diferentes en mujeres y hombres adultos mayores.

  5. Errores innatos del metabolismo de las purinas y otras enfermedades relacionadas

    Directory of Open Access Journals (Sweden)

    Jiovanna Contreras Roura

    2012-06-01

    Full Text Available Los errores innatos en el metabolismo de las purinas son trastornos hereditarios complejos de gran impacto clínico, que presentan síntomas variables de acuerdo con el tipo de enfermedad. Pueden presentarse problemas renales de origen desconocido, retardo mental con manifestaciones neurológicas, retardo del crecimiento, infecciones recurrentes, automutilación, inmunodeficiencias, anemia hemolítica inexplicable, artritis gotosa, historia familiar, consanguinidad y reacciones adversas a fármacos que son análogos de las purinas. Las investigaciones de estas enfermedades comienzan generalmente con la cuantificación del ácido úrico en suero y en orina, por ser el producto final del metabolismo de las purinas en humanos. La dieta y el consumo de medicamentos, entre otras condiciones patológicas, fisiológicas y clínicas, también pueden modificar los niveles de este compuesto. Esta revisión pretende divulgar información de los errores innatos en el metabolismo de las purinas, y facilitar la interpretación de los niveles del ácido úrico y otros marcadores bioquímicos útiles en el diagnóstico de estas enfermedades. Se incluyen tablas que relacionan estas enfermedades con los niveles de excreción de ácido úrico y otros marcadores bioquímicos, las enzimas alteradas, los síntomas clínicos, el modo de herencia y, en algunos casos, el tratamiento propuesto. Este trabajo nos permite afirmar que las variaciones en los niveles del ácido úrico y la presencia de otros marcadores bioquímicos en orina, constituyen una herramienta importante en la pesquisa de algunos errores innatos en el metabolismo de las purinas, así como de otras condiciones patológicas relacionadas.

  6. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Science.gov (United States)

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  7. Excesso de peso e qualidade de vida relacionada à saúde em adolescentes de Florianópolis, SC Exceso de peso y calidad de vida relacionada con la salud en adolescentes de Florianópolis, Sur de Brasil Overweight and health-related quality of life in adolescents of Florianópolis, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Nádia Kunkel

    2009-04-01

    Full Text Available OBJETIVO: Avaliar a qualidade de vida relacionada à saúde de adolescentes e sua associação com o excesso de peso. MÉTODOS: Estudo transversal com 467 adolescentes de 15 a 18 anos de idade de uma escola pública de Florianópolis, SC, e de seus respectivos pais, realizado em 2007. Sobrepeso e obesidade foram definidos pelo índice de massa corporal. A combinação de sobrepeso e obesidade foi considerada como excesso de peso. A qualidade de vida relacionada à saúde foi avaliada por meio do questionário sobre qualidade de vida pediátrica PedsQL 4.0, versões adolescente e pais. Análises dos dados incluíram estatística descritiva e regressão logística com estimação de razões de chances brutas e ajustadas. RESULTADOS: A taxa de resposta entre adolescentes foi de 99,4% e entre os pais 53,4%. As prevalências de sobrepeso e obesidade foram de 12,2% e 3,6%, respectivamente. O grupo com excesso de peso obteve menores escores de qualidade de vida que o grupo sem excesso de peso, exceto para o domínio emocional nos adolescentes e na saúde psicossocial para os pais. Após o ajuste, a chance de um adolescente com excesso de peso ter baixa qualidade de vida foi 3,54 vezes (IC 95% 1,94;6,47 maior que um adolescente sem excesso de peso. Adolescentes do sexo feminino apresentaram escores mais baixos de qualidade de vida. CONCLUSÕES: A qualidade de vida relacionada à saúde foi significativamente mais baixa em adolescentes com excesso de peso. Medidas dirigidas ao controle de peso na população adolescente e instrumentos de avaliação de qualidade de vida constituem-se importantes aliados para um melhor e mais completo entendimento deste importante problema de saúde pública.OBJETIVO: Evaluar la calidad de vida relacionada con la salud de adolescentes y su asociación con exceso de peso. MÉTODOS: Estudio transversal con 467 adolescentes de 15 a 18 años de edad de una escuela pública de Florianópolis, Sur de Brasil, y de sus

  8. MORTALIDADE E RISCOS ASSOCIADOS A INFECÇÃO RELACIONADA À ASSISTÊNCIA À SAÚDE

    Directory of Open Access Journals (Sweden)

    Ester Sena Souza

    2015-01-01

    Full Text Available La infección relacionada con la atención sanitaria es una de las principales causas de morbimortalidad entre los pacientes hospitalizados. El objetivo de este estudio epidemiológico fue determinar la mortalidad y los riesgos asociados con el fallecimiento de pacientes adultos con la infección relacionada con la atención sanitaria ingresados en un hospital universitario en el periodo de un año. Los datos de los pacientes se obtuvieron de registros de notificación de infecciones. La tasa de mortalidad asociada con las infecciones fue del 38,4%, y fueron clasificados como un factor que contribuye en el 87,1% de las muertes. La asociación de la infección relacionada con la atención sanitaria con el fallecimiento fue estadísticamente significativa entre pacientes clínicos (41,3%, que presentaron comorbilidad asociadas a el diagnóstico (55,8%, con infección cardiovascular (62,2%, neumonía (48,9%, que desarrollaron sepsis (69,0%, colonizados (45,2% o infectados (44,7% por microorganismos multirresistentes. Se concluyó que las infecciones contribuyeron a la muerte de la mayoría de los pacientes.

  9. Terminologia Baniwa relacionada às palmeiras Baniwa terminology related to Palms

    Directory of Open Access Journals (Sweden)

    Madalena Otaviano Aguiar

    2011-06-01

    Full Text Available O presente estudo faz uma análise da terminologia dos nomes dados às palmeiras (Arecaceae pelos índios Baniwa da comunidade indígena de Tunuí Cachoeira, alto rio Negro, AM, Brasil, com o objetivo de obter a tradução e/ou a significação das palavras. As coletas de dados foram feitas com aplicação de entrevistas estruturadas diretas e pessoais e semi-estruturadas em estudo de grupo e turnês-guiadas. A partir da análise dos termos, foi possível reconhecer características de nomeação relacionadas à morfologia (58%, à ecologia (29% e à cultura (13%. Também foi possível evidenciar que há termos superordenados (genéricos que relacionam por inclusão hierárquica os subordinativos (específicos, indicando uma categorização e subcategorização em ordem descendente. Isto está de acordo com o modelo berliniano que nomeia de lexema primário e secundário, respectivamente. Estas análises contribuem para uma melhor compreensão do conhecimento tradicional do povo Baniwa.The present study analyzes the naming terminology given to the palms (Arecaceae by the Baniwa Indians of the indigenous community of Tunuí Cachoeira, in the Upper Rio Negro, Amazonas, Brazil, in order to obtain the translation and/or the meaning of the words. Data collection was achieved through the use of direct structured and semi-structured personal interviews, group study, and guided site-visits (to the plants in question. In analyzing the terms, it was possible to recognize naming characteristics tied to morphology (58%, ecology (29% and culture (13%. It also was possible to demonstrate that there are superordinate terms (generics that connect by hierarchical inclusion the subordinate categories (specifics, indicating a categorization and subcategorization in descending order. This is in accord with the Berlinian model which names the primary lexeme and secondary lexeme, respectively. These analyses contribute to a better understanding of the traditional

  10. Zygostates alleniana (Orchidaceae: Epidendroideae: Cymbidieae: Oncidiinae: estructura floral relacionada con la polinización

    Directory of Open Access Journals (Sweden)

    Gómiz, Natalia E.

    2014-06-01

    Full Text Available The genus Zygostates Lindl. (Orchidaceae comprises about 20 species of small Neotropical epiphytic plants, represented in its southernmost limit by the species Z. alleniana. In this paper, we studied morphological and anatomical floral characteristics of this species related to pollination mechanism. We confirmed the presence of the unicellular trichomes on the base of the lip and side lobes secreting oil, constituting a trichomal elaiophore. The oil is deposited beneath the cuticle at the apex of the trichomes forming small blisters. The oil could represent a reward for the species Lophopedia nigrispinis, which would be a potential pollinator of Z. alleniana in a natural area within the geographic range of this plant species. Moreover, we prove that the reconfiguration of the pollinaruim is due to the dehydration of the walls cell. This reconfiguration could favor cross-pollination mechanism already described for other species of the family Orchidaceae. Finally, we discuss the floral characters present in Z. alleniana with closely related species.El género Zygostates Lindl. (Orchidaceae comprende aproximadamente 20 especies de pequeñas plantas epífitas con distribución neotropical, representado en su límite más austral por la especie Z. alleniana. En el presente trabajo se estudian morfológica y anatómicamente las características florales de esta especie relacionadas con el mecanismo de polinización. Se confirma la presencia de tricomas unicelulares en la base del labelo y lóbulos laterales que actúan secretando aceite, constituyendo un elaióforo tricomatoso. El aceite se deposita por debajo de la cutícula en el ápice de los tricomas formando pequeñas ampollas. El aceite podría representar una recompensa para la especie Lophopedia nigrispinis, la cual sería un posible polinizador de Z. alleniana en un área natural dentro del rango de distribución geográfica de esta especie vegetal. Por otro lado, se comprueba que la

  11. Calidad de vida relacionada con la salud de los pacientes postinfarto de miocardio

    Directory of Open Access Journals (Sweden)

    Ruby Elizabeth Vargas-Toloza

    2008-12-01

    Full Text Available Hoy en día las enfermedades cardiovasculares se consolidan como una de las primeras causas de muerte en el mundo entero. Según cifras del DANE, en Colombia murieron por infarto del miocardio en el año 2005, 24.081 personas, de las cuales el 56.22% correspondieron al sexo masculino y 43.78% al sexo femenino. Este comportamiento es muy similar en la ciudad de Cúcuta donde se presentaron en el mismo año 274 muertes de las cuales el 63.13% corresponden a personas de sexo masculino viéndose así que el grupo más afectado corresponde a mayores de 65 años con un 73.35%, donde se puede evidenciar la importancia que tiene esta entidad a nivel regional, nacional e internacional. De allí surge la inquietud de evaluar la calidad de vida relacionada con la salud de los pacientes postinfarto agudo de miocardio, debido a que estos no siempre recuperan la capacidad para mantener un autocuidado eficaz, y así de esta manera satisfacer sus necesidades físicas, biológicas y psíquicas, por lo cual pueden presentar distintos niveles de dependencia de los profesionales de la salud, cuidadores informales y hasta de su propia familia, convirtiéndose en una carga para ellos, generando en los pacientes estados de depresión, ansiedad y tristeza. Teniendo en cuenta que todos estos sentimientos son perjudiciales en la recuperación y a la vez, convirtiéndose en nuevos factores de riesgo tanto para la resentación de un nuevo infarto que e esta vez podría llegar a ser fatal o limitar gravemente las actividades de la vida diaria del paciente en tal grado que se pueda ver afectada su salud mental debido al estado de depresión en el cual puede caer el paciente.

  12. Ocorrência de hematoma peridural após anestesia geral associada à analgesia pós-operatória com cateter peridural em paciente em uso de heparina de baixo peso molecular: relato de caso Ocurrencia de hematoma postanestesia general asociada a analgesia postoperatoria con cateter peridural en paciente que usa heparina de bajo peso molecular: relato de caso Epidural hematoma after general anesthesia associated with postoperative analgesia with epidural catheter in patient using low molecular weight heparin: case report

    Directory of Open Access Journals (Sweden)

    Ranger Cavalcante da Silva

    2006-04-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Apresentar um caso de paciente com hematoma peridural, na vigência do uso de cateter peridural e heparina de baixo peso molecular, seu quadro clínico e tratamento. RELATO DO CASO: Paciente do sexo feminino, 75 anos, submetida à fixação de coluna lombar por via anterior, que desenvolveu no pós-operatório quadro clínico de paralisia progressiva nos membros inferiores, com perda de sensibilidade, sem apresentar dor radicular intensa. O tratamento foi descompressão medular imediata, com drenagem e limpeza cirúrgica de hematoma peridural, que se estendia da quinta até a décima vértebra torácica. Após a drenagem do hematoma a paciente recuperou gradualmente a força nos membros inferiores, recebeu alta em 10 dias com quadro de disfunção esfincteriana. Após três meses o quadro regrediu e não houve seqüela neurológica definitiva. CONCLUSÕES: O rápido diagnóstico com intervenção cirúrgica precoce é o tratamento mais eficaz para redução de lesão neurológica, em pacientes que desenvolvem hematoma peridural no pós-operatório. A utilização de heparina de baixo peso molecular, na vigência do uso de cateter peridural, exige a adesão estrita a protocolos estabelecidos, para que se reduzam os riscos do desenvolvimento de hematoma peridural.JUSTIFICATIVA Y OBJETIVOS: presentar el caso de una paciente con hematoma peridural, con uso actual de catéter peridural y heparina de bajo peso molecular, su cuadro clínico y tratamiento. RELATO DEL CASO: Paciente de 75 años, sometida a la fijación de columna lumbar por vía anterior, que desarrolló en el postoperatorio un cuadro clínico de parálisis progresiva en los miembros inferiores, con pérdida de la sensibilidad, sin presentar dolor radicular intenso. El tratamiento fue descompresión medular inmediata, con drenaje y limpieza quirúrgica de un hematoma peridural, que se extendía desde la quinta hasta la décima vértebra toráxica. Después del

  13. Percepção do consumidor frente aos riscos associados aos alimentos, sua segurança e rastreabilidade

    Directory of Open Access Journals (Sweden)

    Juliana Cunha de Andrade

    2013-09-01

    Full Text Available Nas últimas décadas, tem-se observado um crescente interesse dos consumidores pelas questões relacionadas à segurança dos alimentos. Os governos têm sido pressionados a adotar medidas que assegurem a inocuidade dos alimentos e, consequentemente, legislações rigorosas quanto à contaminação dos alimentos por agentes físicos, químicos e microbiológicos estão sendo implantadas. Dentro desse panorama, conhecer a percepção do consumidor brasileiro sobre o tema é extremamente relevante. No presente estudo, avaliaram-se, em duas grandes cidades brasileiras (Campinas-SP e Rio de Janeiro-RJ, os critérios utilizados por consumidores para a compra de produtos alimentícios e suas visões sobre os riscos potenciais de contaminação dos alimentos. Avaliou-se também a percepção dos consumidores sobre a rastreabilidade e seu papel na melhoria da segurança dos alimentos, utilizando-se a metodologia focus group. Três sessões de discussão foram conduzidas (duas em Campinas e uma no Rio de Janeiro, tendo sido observadas diferenças entre os consumidores das distintas praças. Os consumidores de Campinas mostraram-se mais preocupados e interessados no assunto do que os do Rio de Janeiro, pois relataram buscar mais informações nos rótulos de alimentos. Menções relacionadas a riscos, como intoxicação alimentar, botulismo e agrotóxicos foram comuns para os entrevistados das duas cidades e, entre os principais produtos considerados com risco à saúde, ficaram as carnes e os frutos do mar, sendo estes últimos com maior ênfase no Rio de Janeiro. Dentre os produtos reconhecidos como seguros, destacaram-se as frutas (produzidas sem agrotóxicos, os legumes e os produtos secos/desidratados. Em todos os grupos, observou-se grande preocupação com a contaminação por agrotóxicos e metais pesados. Em termos microbiológicos, ambas as praças destacaram os riscos com bactérias, especialmente a Salmonella. O tema rastreabilidade se

  14. Imunidade relacionada à resposta alérgica no início da vida

    OpenAIRE

    Correa,Joaquina M.M.; Zuliani,Antonio

    2001-01-01

    OBJETIVO: considerando-se que é na infância que as manifestações alérgicas mais comuns (asma, rinite, dermatite, alergia alimentar) ocorrem, porque é no início da vida que o sistema imune pode ser induzido à sensibilização ao invés de tolerância alergênica, analisamos as principais peculiaridades imunológicas do feto e da criança jovem, inerentes à sensibilização e resposta alérgica. MÉTODOS: os autores realizaram revisão literária detalhada concernente à resposta imune inespecífica (barreira...

  15. Nurses’ Knowledge about the Insertion Procedure for Peripherally Inserted Central Catheters in Newborns Conocimiento de los enfermeros sobre la técnica de inserción del catéter central de inserción periférica en recién nacidos Conhecimento dos enfermeiros sobre a técnica de inserção do cateter central de inserção periférica em recém-nascidos

    Directory of Open Access Journals (Sweden)

    Solange Antonia Lourenço

    2010-04-01

    sobre esa práctica para mejorar la calidad de la asistencia prestada a los recién nacidos.A utilização do cateter central de inserção periférica (PICC, principalmente em unidades de terapia intensiva neonatal, é uma conquista da enfermagem constituída por trajetória de esforços que conduziu a um novo desafio - o aperfeiçoamento do exercício dessa prática. Este artigo teve como objetivo verificar o conhecimento teórico-prático adquirido pelos enfermeiros, nos cursos de qualificação, sobre alguns aspectos da técnica de inserção do PICC em recém-nascidos. Trata-se de estudo descritivo, de natureza quantitativa, que utilizou como instrumento de pesquisa um questionário com nove questões. A população constituiu-se de 40 enfermeiros qualificados para inserção do PICC em neonatos. Os resultados mostraram que, segundo a atribuição conceitual estabelecida para o estudo, os enfermeiros apresentaram conhecimento ruim sobre esses aspectos, denotando a necessidade de atualização e aperfeiçoamento constante dos enfermeiros sobre essa prática para melhorar a qualidade da assistência prestada aos recém-nascidos.

  16. Cysticidal therapy: impact on seizure control in epilepsy associated with neurocysticercosis Impacto do tratamento cisticida no controle das crises epilépticas relacionadas a neurocisticercose

    Directory of Open Access Journals (Sweden)

    ISABEL CRISTINA DOS SANTOS

    2000-12-01

    ,2 anos; 83% dos pacientes apresentavam crises parciais simples e 17%; crises parciais complexas. O EEG foi normal em 38%. Em apenas 28% dos pacientes houve relação entre alterações focais do EEG e a localização do cisto. Em relação ao LCR; 33% apresentavam pleiocitose, 28% hiperproteinorraquia e apenas 22% apresentavam imunologia positiva para cisticercose . Foi observada relação entre localização do cisto e semiologia das crises em todos os pacientes com crises de início sensitivo-motor e sensorial especial (n= 11. Após tratamento cisticida, 83% tiveram redução de pelo menos 50% das crises . CONCLUSÃO: Na epilepsia relacionada a neurocisticercose predominam crises parciais simples e observa-se relação entre crises sensitivo-motoras ou sensoriais especiais e localização do cisto. O tratamento cisticida deve ser considerado nos pacientes com crises parciais com semiologia relacionada à localização do cisto.

  17. Contact lens-associated microbial keratitis Ceratites microbianas relacionadas a lente de contato

    Directory of Open Access Journals (Sweden)

    Aline Silveira Moriyama

    2008-12-01

    Full Text Available PURPOSE: Contact lens-associated microbial keratitis is a severe condition with sight-threatening potential and increasing incidence. Information regarding the etiological agents is essential in guiding management and may vary geographically. The aim of this study was to analyze the microbiological results of corneal scrapings collected from patients presenting with contact lens-associated microbial keratitis. METHODS: Retrospective analysis of the records of all patients who were clinically diagnosed with contact lens-associated microbial keratitis and had corneal scrapings sent to the Laboratory of Ocular Microbiology, UNIFESP/EPM during a 5-year period from January 2002 to December 2007. RESULTS: The etiological agent was identified in 239 patients. Bacterial isolates accounted for 166 (69.46% cases, Acanthamoeba for 95 (39.75% cases and fungi for 4 (1.67% cases. Among the bacterial infections, coagulase-negative Staphylococcus was demonstrated in 74 cases, while Pseudomonas spp was found in 32 patients. All coagulase negative Staphylococcus and Pseudomonas were susceptible to ciprofloxacin and ofloxacin. Resistance to gentamicin was documented in a single case of Pseudomonas. Fourth-generation flouoroquinolone resistance was not observed among Pseudomonas cases. CONCLUSION: Coagulase-negative Staphylococcus was the most frequent isolate, and such data must be considered when determining empiric treatment. Second-generation fluoroquinolones ciprofloxacin and ofloxacin and fourth-generation fluoroquinolones moxifloxacin and gatifloxacin showed a good antibacterial profile and therefore could be good options for initial management.OBJETIVO: A ceratite microbiana associada ao uso de lente de contato é uma condição clínica grave, com risco de perda visual e cuja incidência vem aumentando progressivamente. Os principais agentes etiológicos podem variar geograficamente e informações referentes aos agentes causais são essenciais para

  18. Mortalidade por leucemias relacionada à industrialização Mortality by industrialization-related leukemias

    Directory of Open Access Journals (Sweden)

    Carmen Helena Seoane Leal

    2002-08-01

    Full Text Available OBJETIVO: Analisar a distribuição espacial da mortalidade por leucemia na população, buscando identificar agregados e estabelecer sua relação com os níveis de industrialização. MÉTODOS: O estudo foi realizado nas 43 regiões de governo do Estado de São Paulo, no qüinqüênio 1991-1995. Foi construído um "índice de industrialização relativo à leucemia" (IIRL baseado no número de indústrias e empregos industriais por 100.000 habitantes, valor adicionado fiscal, variedade de ramos industriais e indústrias com potenciais exposições de risco para a leucemia. O IIRL foi distribuído em cinco categorias. Verificaram-se os coeficientes padronizados de mortalidade por leucemia em cada uma das regiões, também distribuídos em cinco categorias e comparados ao mapa IIRL. RESULTADOS: As regiões mais industrializadas em ordem decrescente foram Campinas, Piracicaba, Jundiaí, Sorocaba e São Paulo. Não foi encontrada associação entre mortalidade, por nenhum tipo de leucemia, e industrialização. A região de Jales foi a que apresentou o mais alto coeficiente padronizado de mortalidade por leucemia. CONCLUSÕES: A distribuição da mortalidade por leucemia ocorreu de forma homogênea no Estado de São Paulo, não apresentando correlação com o nível de industrialização. Entretanto, aspectos relacionados ao método epidemiológico adotado -- estudo ecológico -- e ao uso do parâmetro "mortalidade por leucemia", doença cujo prognóstico tem mudado muito nas últimas décadas, limitaram a interpretação dos resultados.OBJECTIVE: To analyze the spatial distribution of mortality by leukemia in the population, looking for clusters, and to establish an association with the level of industrialization. METHOD: The study was carried out in 43 state regions of the state of São Paulo, Brazil, in the period between 1991 and 1995. It was created an Index of Industrialization-Related Leukemia (IIRL based on number of manufactures and

  19. Eventos adversos e motivos de descarte relacionados ao reuso de produtos médicos hospitalares em angioplastia coronária Adverse events and reasons for discard related to the reuse of cardiac catheters in percutaneous transluminal coronary angioplasty

    Directory of Open Access Journals (Sweden)

    Margarete Ártico Batista

    2006-09-01

    Full Text Available OBJETIVO: Descrever os eventos adversos ocorridos durante e após angioplastia coronária (ATC, possivelmente relacionados ao reuso de produtos médico-hospitalares, além de quantificar e identificar os motivos de descarte em relação ao primeiro uso e ao reuso. MÉTODO: Foram estudados 60 pacientes, sendo que 29 (48,3% apresentavam angina instável, 27 (45% IAM e quatro (6,7% outros diagnósticos. Durante o procedimento e na permanência na Unidade Intensiva Coronariana, atentou-se à possibilidade de ocorrência dos eventos adversos febre, hipertensão, hipotensão, calafrios, sudorese, sangramento, náuseas e vômitos. Foram avaliados sete produtos médico-hospitalares: introdutor, cateter-guia, fio-guia 0.35, fio-guia 0.014, cateter- balão para angioplastia, seringa com manômetro para insuflar balão (indeflator e torneira de três vias (manifold. No total de produtos (76 de primeiro uso e 410 reprocessados, verificou-se se houve descarte e se isto ocorreu antes ou durante o procedimento e quais os motivos para tanto. Utilizou-se o teste Qui Quadrado, admitindo-se erro alfa de 5%. RESULTADOS: Vinte e seis pacientes apresentaram eventos adversos. A hipotensão foi o evento mais prevalente e ocorreu em 11(18,3% casos. Não houve, porém, significância estatística entre o evento adverso hipotensão e reuso ou não dos produtos médico-hospitalares. Por não estarem íntegros, foram descartados três produtos de primeiro uso e 55 produtos dos reutilizados. CONCLUSÃO: Os eventos adversos apresentados pelos pacientes submetidos à angioplastia não estão associados ao reuso dos produtos médico-hospitalares. A integridade e funcionalidade foram os motivos principais de descarte.OBJECTIVE: To describe the adverse effects that occur during and after percutaneous transluminal coronary angioplasty (PTCA possibly related to the reuse of medical equipment. An additional objective is to quantify and identify the reasons of discard in respect to

  20. Gorgonids from Curaçao Island

    NARCIS (Netherlands)

    Gordon, Isabella

    1925-01-01

    This report contains an account of a collection of Gorgonids made by Dr. C. J. VAN DER HORST at the island of Curaçao and also of a few specimens collected in the same locality by Ir. G. J. H. MOLENGRAAFF. The Majority of the specimens are taken from Caracas bay at a depth of not more than five

  1. Estados Unidos: do Iraque ao Brasil

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-12-01

    Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.

  2. Variáveis relacionadas com perda da produtividade no trabalho em pacientes com espondilite anquilosante

    Directory of Open Access Journals (Sweden)

    Renata Frauendorf

    2013-06-01

    Full Text Available A perda da produtividade no trabalho, como resultado da espondilite anquilosante, tem se tornado tema de interesse dado o seu impacto socioeconômico. Além das limitações físicas, outras variáveis parecem interferir na produtividade desses pacientes que muitas vezes são aposentados precocemente do mercado de trabalho. Assim, esse manuscrito de revisão buscou identificar artigos publicados na língua inglesa no período de janeiro de 2001 a dezembro de 2011 que discutissem essas variáveis por meio de estudos realizados com pacientes adultos com diagnóstico de espondilite anquilosante, de ambos os gêneros e que usaram instrumentos padronizados para a avaliação da atividade da doença e da capacidade produtiva no trabalho. Foram identificados 33 artigos atendendo aos critérios de inclusão e observou-se que a perda de produtividade no trabalho em pacientes com espondilite anquilosante é influenciada por variáveis demográficas, emocionais, socioculturais e ocupacionais e hábitos de vida. Compreender esses possíveis fatores de risco pode colaborar para a elaboração de estratégias preventivas para a manutenção de pacientes com espondilite anquilosante no mercado de trabalho.

  3. AoB PLANTS: origins and features.

    Science.gov (United States)

    Jackson, Michael B

    2009-01-01

    AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access helps sidestep library budgets which are struggling to purchase the increasing numbers of journals. Open Access makes research freely available both to the academic community and beyond while publishing online only eliminates the need to reject good manuscripts simply to control the size of the printed journal. Finally, the journal chose to go OA to ensure the widest possible international readership for the growing amount of high-quality plant science research being carried out worldwide in response to problems such as climate change and food shortages. Responses to a wide-ranging online questionnaire indicated strong international support for a journal such as AoB PLANTS. AoB PLANTS strives for fair and rapid peer review followed by fast publication of accepted papers. For an initial period, there will be no OA fees, and fees will remain modest once introduced. AoB PLANTS adopts double-blind peer review using published criteria for acceptability as a basis for decision-making. Accepted papers are published shortly after acceptance together with referees' analyses using Stanford University Libraries High Wire Press H2O platform. Authors retain ownership of the copyright in their papers.

  4. As lacunas do acordo antidumping relacionadas à determinação da prática dumping

    OpenAIRE

    Noman, Rafaela Teixeira Vieira

    2012-01-01

    A dissertação identifica as lacunas e imprecisões presentes no texto do artigo 2 do Acordo Antidumping relacionadas à determinação de dumping. São analisados o contexto do surgimento do conceito de dumping e das medidas antidumping, bem como da regulamentação multilateral sobre a matéria. É apresentada uma análise detalhada do texto do artigo 2 do Acordo Antidumping , em que são avaliadas as orientações do Acordo acerca da apuração da margem de dumping. Esse estudo detalhado...

  5. Algunas leyes fundamentales de la química y las magnitudes físicas relacionadas con el equivalente

    OpenAIRE

    Antonio M. Navarro López

    2010-01-01

    En este tema se tratan algunas leyes fundamentales de la química, tales como la Ley de la conservación de la materia, la Ley de las proporciones definidas o ley de los equivalentes, así como las magnitudes físicas relacionadas con el equivalente como son: La cantidad de sustancia en equivalente , masa molar del equivalente tanto de un elemento químico , de los ácidos, de las bases, de las sales ,todo expresado en el sistema Internacional de Unidades ....

  6. Patologías Relacionadas con el Tracto Reproductivo en Herbívoros, Carnívoros y Primates

    OpenAIRE

    J B Mesa-Cruz

    2010-01-01

    Una gran proporción del conocimiento en patologías relacionadas al tracto reproductivo en herbívoros, carnívoros y primates ha sido producto de la investigación realizada en animales de compañía o con importancia económica y de salud humana. Esta revisión bibliográfica tiene como objetivo abordar y describir brevemente  enfermedades del tracto reproductivo de origen infeccioso, no infeccioso y finalmente considerar algunos aspectos importantes en condiciones de cautiverio  que afectan la habi...

  7. Calidad de vida relacionada con la salud oral en adultos mayores de una población peruana

    OpenAIRE

    Gallardo Schultz, Adriana; Picasso Pozo, Miguel Ángel; Huillca Castillo, Nancy; Ávalos Márquez, Juan Carlos

    2013-01-01

    Objetivo. Determinar la autopercepción de la calidad de vida relacionada a la salud oral en personas atendidas en la Casa del Adulto Mayor de la Municipalidad de Chorrillos, Lima, Perú. Material y métodos. El estudio fue de tipo descriptivo. La muestra estuvo conformada por 164 adultos mayores seleccionados mediante muestreo no probabilístico con voluntarios. La información se obtuvo mediante una entrevista estructurada; el instrumento de recolección de datos incluyó información sobr...

  8. Expresión de enzimas relacionadas con el metabolismo de glucocorticoides en tejidos ováricos bovino

    OpenAIRE

    Michael López C.; Ayelen Amweg; Matías Stangaferro; Hugo Ortega

    2015-01-01

    Objetivo. Identificar la expresión de enzimas relacionadas con el metabolismo de glucocorticoides en tejidos ováricos bovinos. Materiales y métodos. Se obtuvieron muestras de tejidos provenientes de ovarios sanos (n=10) y con Enfermedad Quística Ovárica (COD) (n=10), a las cuales luego de su procesamiento histológico, se las incluyó en parafina. Mediante la técnica de inmunohistoquímica indirecta, se identificaron in situ en folículos primarios, secundarios, terciarios, atrésicos y quis...

  9. Qualidade de vida relacionada à saúde de pacientes com câncer em quimioterapia

    OpenAIRE

    Adriana Cristina Nicolussi; Namie Okino Sawada; Fernanda Mara Coelho Cardozo; Viviane Andrade; Juliana Maria de Paula

    2014-01-01

    Estudio transversal,cuyo objetivo fue evaluar la Calidad de Vida relacionada con la Salud en pacientes con cáncer en quimioterapia, identificar dominios afectados y asociarlos con datos sociodemográficos, clínicos y terapéuticos de la amuestra. Llevado a cado con 152 pacientes entre 2009-2011 en dos centros de quimioterapia, en Ribeirão Preto, SP, Brasil. Se utilizó el instrumento Quality of Life Questionnaire Core-30 . La Calidad de Vida general fue considerada buena, los dominios afectados ...

  10. Conciencia ambiental y conducta sustentable relacionada con el uso de energía para iluminación

    OpenAIRE

    Tonello, Graciela Lucia del Carmen; Valladares, Natalia

    2017-01-01

    La conciencia ambiental es definida como un concepto multidimensional que constituye la dimensión actitudinal del comportamiento pro ambiental. En un contexto global y local de crisis energética, el presente trabajo tuvo como objetivos investigar las interrelaciones entre las diferentes dimensiones de la conciencia ambiental y la posible sustentabilidad detrás de conductas relacionadas con el uso de la iluminación, en una muestra de estudiantes universitarios. La metodología incluyó el desarr...

  11. Prevalencia de complicaciones relacionadas con septoplastias realizadas en el hospital "José Carrasco Arteaga", Cuenca 2014

    OpenAIRE

    Ortega Barrazueta, Jorge Alfredo

    2014-01-01

    Antecedentes: La hemorragia es una de las complicaciones más comunes de la septoplastia. Ganesan y cols., reportaron que 5,4% de los procedimientos nasales realizados en su hospital entre 1997 y 1998, requirieron de internación por hemorragia. La fístula de líquido cefalorraquídeo es extremadamente rara y su aparición está relacionada con alteraciones anatómicas. El riesgo de infección secundaria a septoplastia se ha estimado de 0,48 a 2,5%. Las complicaciones como meningitis, endocarditis o ...

  12. Síndrome mielodisplásica secundária à quimio ou radioterapia: SMD relacionada a tratamento Myelodysplastic syndrome secondary to chemo: and radiotherapy MDS related to the treatment

    Directory of Open Access Journals (Sweden)

    Ronald F. Pinheiro

    2006-09-01

    Full Text Available O efeito leucemogênico dos agentes quimioterápicos após o tratamento para neoplasias é bem conhecido. Síndrome mielodisplásica secundária a quimio ou radioterapia, também denominada relacionada à terapia (SMD-t, geralmente ocorre quatro a sete anos após a exposição inicial ao agente quimio ou radioterápico, acomete habitualmente pacientes jovens, apresenta alta incidência de transformação para leucemia mielóide aguda (LMA, está associada a citopenias severas, displasia das três linhagens, celularidade medular reduzida e fibrose, e anormalidades citogenéticas em até 80% dos casos. As anormalidades mais freqüentes envolvem os cromossomos 5 e 7. No tocante à quimioterapia, os agentes alquilantes são as drogas mais comumente associadas com SMD-t. Quimioterápicos em altas doses usados como parte de regimes de condicionamento para transplantes de medula óssea e radioterapia, além dos esquemas COPP/ABV e BEACOPP, estão associados com SMD-t. Recentemente, drogas como azatioprina, cladribina e rituximab também foram relacionadas à SMD-t. Devido ao aumento da sobrevida de pacientes acometidos por neoplasias malignas, a SMD-t surge como efeito mutagênico desses tratamentos e confere prognóstico desfavorável.The leukaemogenic effect of chemotherapeutic agents after treatment for other malignancies have been well described. Myelodysplastic syndrome secondary to chemo- and radiotherapy (MDS-t usually develops four to seven years after the initial exposure to chemotherapy frequently involving young patients, shows a high incidence of transformation to AML, is associated with severe cytopenias, trilineage dysplasia, reduced marrow cellularity and fibrosis, and presents an incidence of chromosomal abnormalities of up to 80% of the cases. The most common abnormalities are related to chromosomes 5 and 7. Alkylating agents have been considered the most common drugs associated with MDS-t. High dose chemotherapy used as part of the

  13. Doenças da pele relacionadas à poluição do ar: uma revisão sistemática

    Directory of Open Access Journals (Sweden)

    José Otávio Batista Leite

    2017-04-01

    Full Text Available Introdução: A poluição atmosférica compreende uma mistura complexa de diversos contaminantes particulados (fumaça de cigarro, gases de combustão veicular e compostos orgânicos voláteis, entre outros. Recentemente, algumas investigações revelaram a existência de associação direta entre a poluição atmosférica e as doenças de pele. Objetivos: Investigar e discutir aspectos relevantes no cenário da pesquisa epidemiológica que trata da relação entre a poluição atmosférica e as doenças de pele em humanos. Métodos: Foi realizada uma revisão sistemática da literatura científica nacional e internacional, que avaliou os artigos publicados na última década, que trataram de doenças de pele em humanos relacionadas à poluição atmosférica. Resultados: A presente revisão identificou 288 estudos que abordaram a temática, dos quais 34 atenderam aos critérios de inclusão previamente estabelecidos. Os resultados revelam que a exposição à fumaça de cigarro e às emissões veiculares está altamente associada com o desenvolvimento de várias doenças de pele, sendo o estresse oxidativo, com a participação de citocinas, a principal via inflamatória. Conclusão: Conclui-se que o controle da exposição ambiental é a principal forma de prevenção; e o tratamento das doenças de pele associadas à poluição atmosférica pode ser realizado por meio da utilização de drogas anti-inflamatórias e antioxidantes.

  14. Qualidade de vida relacionada à saúde de pacientes com câncer em quimioterapia

    Directory of Open Access Journals (Sweden)

    Adriana Cristina Nicolussi

    2014-01-01

    Full Text Available Estudio transversal,cuyo objetivo fue evaluar la Calidad de Vida relacionada con la Salud en pacientes con cáncer en quimioterapia, identificar dominios afectados y asociarlos con datos sociodemográficos, clínicos y terapéuticos de la amuestra. Llevado a cado con 152 pacientes entre 2009-2011 en dos centros de quimioterapia, en Ribeirão Preto, SP, Brasil. Se utilizó el instrumento Quality of Life Questionnaire Core-30 . La Calidad de Vida general fue considerada buena, los dominios afectados fueran: función emocional, desarrollo de papel, dolor, fatiga, insomnio y pérdida de apetito. Pacientes del sexo femenino, entre 40-60 años, económicamente activos, con cáncer gástrico, pulmón, neurológico y piel, con metástasis y los pacientes que se sometieron a cirugía y/o radioterapia concomitante presentaran déficit en varias áreas y presencia de más síntomas. El cáncer y su tratamiento afectaran de alguna manera los pacientes, causando déficits en las funciones desarrolladas e más síntomas, perjudicando la Calidad de Vida Relacionada con la Salud.

  15. Degeneração macular relacionada à idade: novas perspectivas Age-related macular degeneration: new perspectives

    Directory of Open Access Journals (Sweden)

    Marcio Bittar Nehemy

    2006-12-01

    Full Text Available A degeneração macular relacionada à idade (DMRI é a principal causa de cegueira legal em indivíduos acima de 50 anos de idade. Embora estudos recentes tenham mostrado que o fator genético é significativo, a patogênese da degeneração macular relacionada à idade permanece obscura, e os fatores de risco não estão ainda completamente estabelecidos. Estudos multicêntricos randomizados, publicados nos últimos anos, demonstraram que uma combinação de vitaminas e minerais é eficaz na redução do risco de desenvolvimento de neovascularização e de progressão para os estágios mais avançados da degeneração macular relacionada à idade. De maneira análoga, a terapia fotodinâmica (PDT e a terapia antiangiogênica também tiveram sua eficácia comprovada no tratamento de membrana neovascular coroideana subfoveal associada à degeneração macular relacionada à idade. Ambas reduzem o risco de perda de visão e, eventualmente, permitem melhora temporária da acuidade visual. Outras modalidades de tratamento, tais como fotocoagulação a laser, remoção cirúrgica da membrana e termoterapia transpupilar (TTT, podem beneficiar apenas um pequeno subgrupo de pacientes. Uma melhor compreensão dos mecanismos fisiopatológicos e dos eventos moleculares nas diversas fases da doença deverão propiciar, em futuro próximo, melhores estratégias para o controle e tratamento da degeneração macular relacionada à idade.Age-related macular degeneration (ARMD is a major source of legal blindness in individuals older than 50 years. Even though recent reports suggest that genetics plays an important role, its pathogenesis remains puzzling and the risk factors for its occurrence are not completely established. Vitamin and mineral supplementation reduced the risk of development of choroidal neovascularization (CNV or progression to the most advanced stages of age-related macular degeneration. Photodynamic therapy (PDT and antiangiogenic therapy

  16. Sensibilidade da rosa 'Osiana' ao etileno

    OpenAIRE

    Delaine Cristina Cordeiro; Fernando Luiz Finger; Joice Simone dos Santos; Juliane Karsten; José Geraldo Barbosa

    2011-01-01

    Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida) à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando expos...

  17. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  18. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    Directory of Open Access Journals (Sweden)

    Jesús Ballesteros

    2008-04-01

    Full Text Available O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  19. As deficiências auditivas relacionadas às alterações do DNA mitocondrial.

    Directory of Open Access Journals (Sweden)

    Carvalho Maria F. P. de

    2002-01-01

    Full Text Available A deficiência auditiva é sintoma comum que pode apresentar várias etiologias, entre elas as causadas por alterações genéticas. As mutações genéticas podem ocorrer em genes nucleares e mitocondriais. A mitocôndria, uma organela intracelular, tem o seu próprio genoma (DNA, que é uma molécula circular e é transmitido exclusivamente pela mãe. As mutações do DNA mitocondrial são transmitidas pela linhagem materna, mas podem ocorrer mutações espontâneas. O fenótipo, ou expressão clínica, da mutação mitocondrial vai depender da quantidade de DNA mitocondrial mutante existente na célula, situação conhecida como heteroplasmia. A mitocôndria tem a função de disponibilizar energia para as células sob a forma de ATP (trifosfato de adenosina. Os órgãos que requerem grande quantidade de energia são mais comumente acometidos em casos de mutações do DNA mitocondrial, como células nervosas, musculares, endócrinas, ópticas e auditivas. Como a cóclea é grande consumidora de energia, uma mutação no DNA mitocondrial de células ciliadas causa deficiência auditiva do tipo neurossensorial, bilateral, simétrica e progressiva. As deficiências auditivas causadas por mutações no DNA mitocondrial correspondem a 0,5% a 1% de todas as deficiências auditivas de origem genética. Foi realizada uma extensa revisão bibliográfica, a fim de estudar as deficiências auditivas causadas por alterações no DNA mitocondrial. A deficiência auditiva pode se apresentar na forma isolada (forma não sindrômica, como nos casos de hiper-sensibilidade aos antibióticos aminoglicosídeos e presbiacusia, ou associada a outras doenças (forma sindrômica, como na síndrome de Kearns-Sayre e diabete e surdez de herança materna.

  20. Determinantes de la calidad de vida relacionada con la salud de pacientes en diálisis de Uruguay.

    Directory of Open Access Journals (Sweden)

    Ana I Galain

    2014-12-01

    Full Text Available Existen pocos estudios sobre la percepción subjetiva de la calidad de vida relacionada con la salud en pacientes renales cursando su etapa terminal, que vivan en países no industrializados. El propósito de este estudio fue comprender las relaciones subyacentes entre los diferentes determinantes de la calidad de vida relacionada con la salud, en los pacientes en tratamiento sustitutivo renal en Uruguay. Se realizó un estudio transversal en una muestra de 243 pacientes de cinco centros de hemodiálisis y diálisis peritoneal de la ciudad de Montevideo (edad media de 56,6 años, SD 16,2; 58% hombres. Se realizó un análisis de regresión lineal univariado para cada variable independiente. Se incluyó un total de 61 variables independientes biológicas/clínicas, sociodemográficas y psicosociales. La CVRS fue evaluada utilizando el cuestionario SF-36, que consta de ocho subescalas, más el Componente de Resumen Físico (PCS y el Componente de Resumen Mental (MCS. Aquellas variables que mostraron una asociación significativa en el análisis univariado (p< 0,10 fueron incluidas en un análisis de regresión multivariado. Fueron estudiados diez modelos de regresión, para las 8 subescalas del SF-36, el PCS y MCS. Quince variables fueron significativas en los modelos multivariados: tiempo en tratamiento sustitutivo renal, urea, creatinina, hemoglobina, hierro hospitalizaciones, enfermedades agudas, ceguera, edad, género, vivir con alguien, situación laboral, administración de antidepresivos o de antipsicóticos y mantenimiento de la vida sexual; explicando el 43% de la varianza de PCS y el 35% de MCS. El tipo y relevancia de las variables explicativas difieren a lo largo de las diversas dimensiones de la CVRS. Destacamos como conclusión el entrelazamiento de factores biológicos, sociodemográficos y psicosociales como determinantes de la calidad de vida relacionada con la salud en los pacientes renales cursando su etapa terminal, lo que

  1. O estigma atribuído pelos psiquiatras aos indivíduos com esquizofrenia

    Directory of Open Access Journals (Sweden)

    Alexandre Andrade Loch

    2011-01-01

    Full Text Available CONTEXTO: A literatura acerca da maneira como a população geral estigmatiza indivíduos com distúrbios mentais aumentou consideravelmente nas últimas décadas. Mas a dúvida sobre se os psiquiatras também estigmatizam seus pacientes ainda permanece. OBJETIVO: O presente estudo visou avaliar as atitudes de psiquiatras brasileiros em relação aos indivíduos com esquizofrenia. MÉTODOS: Dos cerca de 6.000 participantes do Congresso Brasileiro de Psiquiatria em 2009, 1.414 psiquiatras concordaram em participar do estudo. Entrevistas face a face foram realizadas utilizando um questionário que avaliava o estigma em três dimensões: estereótipos, distância social e preconceito, todas relacionadas a alguém com esquizofrenia. Opinião sobre medicações psicotrópicas e tolerância aos efeitos colaterais também foram avaliadas. Dados sociodemográficos e profissionais foram coletados. RESULTADOS: Psiquiatras brasileiros tenderam a estereotipar negativamente pessoas com esquizofrenia. Estereótipos negativos correlacionaram-se com uma melhor opinião sobre medicações psicotrópicas e com maior tolerância a efeitos colaterais. Idade maior correlacionou-se com estereótipos positivos e com menor preconceito. CONCLUSÃO: Os psiquiatras estigmatizam indivíduos com esquizofrenia e possivelmente têm certa dificuldade em admitir esse fato. Campanhas antiestigma para profissionais de saúde mental devem ser promovidas.

  2. ROBO-AO M DWARF MULTIPLICITY SURVEY

    Science.gov (United States)

    Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica

    2018-01-01

    We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.

  3. Deformable mirror designs for extreme AO (XAO)

    Science.gov (United States)

    Cavaco, Jeffrey; Wirth, Allan

    2014-08-01

    One of the science missions for the next generation of extremely large ground based telescopes (30-42m apertures) is the imaging and spectroscopy of exoplanets. To achieve that goal an Adaptive Optics (AO) subsystem with a very large number of corrected modes is required. To provide contrast ratios in the range of 10-9 or better for a 42m telescope an AO system with 25,000 to 60,000 channels will be needed. This is approximately an order of magnitude beyond the current state of the art. Adaptive Optics Associates Xinetics has developed the Photonex Module Deformable Mirror (DM) technology specifically to address the needs of extreme AO for high contrast applications. A Photonex Module is a monolithic block of electrostrictive ceramic in which a high density of individually addressable actuators are formed by screen printing of electrodes and partial wire saw cutting of the ceramic. The printed electrode structures also allow all electrical connections to be made at the back surface of the module via flex circuits. Actuator spacings of 1mm or less have been achieved using this approach. The individual modules can be edge butted and bonded to achieve high actuator count. The largest DMs fabricated to date have 4096 actuators in a 64X64mm array. In this paper the engineering challenges in extending this technology by a factor of ten or more in actuator count will be discussed. A conceptual design for a DM suitable for XAO will be presented. Approaches for a support structure that will maintain the low spatial frequency surface figure of this large (~0.6m) DM and for the electrical interface to the tens of thousands of actuators will be discussed. Finally, performance estimates will be presented.

  4. Urinary incontinence in the puerperium and its impact on the health-related quality of life La incontinencia urinaria en periodo de posparto y su impacto en la calidad de vida relacionada a salud A incontinência urinária no puerpério e o impacto na qualidade de vida relacionada à saúde

    Directory of Open Access Journals (Sweden)

    Lígia da Silva Leroy

    2012-04-01

    Salud, Vitalidad, Aspectos Sociales y Salud Mental del SF-36. Se concluyó que la incontinencia urinaria afecta de manera significativa la salud física y mental de las madres.Trata-se de estudo caso-controle que avaliou se a incontinência urinária (IU no puerpério compromete a qualidade de vida relacionada à saúde (QVRS e em quais aspectos. Incluíram-se 344 puérperas (77 casos e 267 controles com até 90 dias pós-parto, que compareceram ao ambulatório de obstetrícia de um hospital público e de ensino, para revisão pós-parto. Aplicou-se questionário formulado e validado para o estudo, o International Consultation on Incontinence Questionnaire - Short -Form (ICIQ-SF, o King´s Health Questionnaire (KHQ e o Medical Outcomes Study 36 - Item Short Form Health Survey (SF-36. O escore médio do ICIQ-SF foi 13,9 (dp=3,7. Casos apresentaram pontuação média elevada nos domínios impacto da incontinência, emoções, limitações de atividades diárias e limitações físicas do KHQ. Os grupos diferiram significativamente nos domínios aspectos físicos, dor, estado geral de saúde, vitalidade, aspectos sociais e saúde mental do SF-36. Conclui-se que a IU afeta significativamente a saúde física e mental de puérperas.

  5. Epidemiologia da tricomoniose e sensibilidade ao metronidazol

    OpenAIRE

    Alves, Maria José Gonçalves

    2006-01-01

    A Trichomonas vaginalis é o agente etiológico da tricomoniose, a doença sexualmente transmissível (DST) não viral mais comum no mundo. Actualmente é sabido que promove a transmissão do vírus do HIV, é causa de baixo peso em bebés, bem como de nascimentos prematuros, predispõe mulheres a doença inflamatória pélvica atípica, neoplasia cervical e infertilidade. Acresce ao problema o facto de serem usadas metodologias de diagnóstico com baixa sensibilidade e ainda o aumento de c...

  6. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  7. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    OpenAIRE

    Mónica Brinquinho; Ana Andresa Sousa; Janine Resende; João Valente

    2017-01-01

    O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores ...

  8. Lições Aprendidas: Agregando Valor ao Gerenciamento de Projetos

    Directory of Open Access Journals (Sweden)

    Helio Aisenberg Ferenhof

    2014-02-01

    Full Text Available O presente estudo visa abordar questões relacionadas ao processo de lições aprendidas em projetos, tendo como foco de análise a gestão do conhecimento. O ponto de partida constituiu da seguinte questão: Sob a ótica da gestão do conhecimento, o processo de gerar lições aprendidas pode agregar valor à gestão de projetos? A partir disso, iniciou-se a busca científica para responder esta indagação, por intermédio da busca sistemática de literatura. Assim, este estudo considerou 102 artigos publicados em revistas e journals científicos, que apresentam estudos empíricos em gestão de projetos, gestão do conhecimento e lições aprendidas, encontrados nas bases de dados Scopus. Este estudo aponta: o porque, o quando e o como o processo de lições aprendidas pode ajudar a mitigar os riscos associados a projetos; obter uma melhor compreensão das atividades envolvidas; melhorar os processos de gestão do conhecimento; ter o aumento sistemático das competências dos envolvidos e; identificar a causa raiz de sucessos e fracassos, ajudando a melhoria do processo.DOI:10.5585/gep.v4i3.172

  9. Redes Colaborativas e Cadeia de Abastecimento: Uma Análise Regional Aplicada ao Setor Vitivinicula

    Directory of Open Access Journals (Sweden)

    Luísa Margarida Cagica Carvalho

    2014-11-01

    Full Text Available O aumento da complexidade e da competitividade dos mercados, assim como a imprevisibilidade gerada no actual contexto económico passaram a constituir factores envolventes de acrescida exigência para as empresas. Neste cenário, a colaboração entre empresas formando redes colaborativas assumiu-se como um tema dominante na gestão da cadeia de abastecimento e tem vindo a ser reconhecida como um factor determinante para melhorar a sua força competitiva. Este artigo tem por objectivo apresentar uma visão geral da evolução da investigação relacionada com a colaboração na cadeia de abastecimento, com particular aplicação ao setor vinícola, numa perspetiva de desenvolvimento regional. Este artigo pode dar contributos que permitem servir de referencial para o desenvolvimento de metodologias e de instrumentos que permitam monitorizar o desempenho da colaboração, bem como avaliar boas práticas que resultem da sinergia da colaboração inter-empresas e que sejam passíveis de disseminação e adopção, quer em termos de políticas públicas regionais, quer em termos empresariais.

  10. O TEMA DA JUSTIFICAÇÃO NAS CARTAS AOS ROMANOS E AOS GÂLATAS

    Directory of Open Access Journals (Sweden)

    James N. F. Alisson

    1990-01-01

    Full Text Available Uma das dificuldades para entender a doutrina de Paulo sobre a justificação é o fato de esse tema constar em escritos que retomam a exposição anteriormente apresentada em forma oral à comunidade cristã da Galácia e de Roma. Ele escreve aos destinatários com a finalidade de esclarecer assunto anteriormente explicado. É o que se vê nas referências ao quérigma que recordam o primeiro anúncio da salvação em Cristo, já comunicado aos destinatários em outra ocasião. O uso freqüente da fórmula "acaso não sabeis?" é indício do conhecimento que os destinatários têm sobre o assunto.

  11. Fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes

    OpenAIRE

    Morais, Caroline Neves de

    2015-01-01

    O excesso de peso e o ganho ponderal estão associados a um conjunto complexo de fatores que atuam desde a vida fetal. O presente estudo teve como objetivo verificar os fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes. Trata-se de um estudo realizado com dados secundários de uma pesquisa de corte transversal que envolveu 967 mães e lactentes do estado de Pernambuco. Na caracterização do estado nutricional utilizou-se o índice de massa corporal para ...

  12. Alimentação e qualidade de vida relacionada à saúde de pessoas com hipertensão arterial sistêmica

    OpenAIRE

    Patrícia Costa dos Santos da Silva; Silvana Maria Coelho Leite Fava; Juliana Pereira Machado; Simone Maria Muniz da Silva Bezerra; Michelle Pita Tavares Gonçalves; Eugenia Velludo Veiga

    2014-01-01

    El objetivo fue analizar la asociación entre nutrición y calidad de vida relacionada con la salud de personas con hipertensión arterial sistémica. Estudio descriptivo, analítico, con 397 personas hipertensas inscritas en una unidad de la Estrategia de Salud Familiar del sur de Minas Gerais, MG, Brasil, realizado entre abril y julio de 2013. Se utilizó el instrumento Minichal para evaluar la calidad de vida relacionada con la salud y otro para nutrición. Se encontró el valor promedio de 4,2 en...

  13. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  14. Nefrocalcinose associada ao uso de esteroide anabolizante

    Directory of Open Access Journals (Sweden)

    Weverton Machado Luchi

    2015-03-01

    Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.

  15. Escala de valores relativos ao trabalho : EVT

    Directory of Open Access Journals (Sweden)

    Porto Juliana Barreiros

    2003-01-01

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  16. Escala de valores relativos ao trabalho: EVT

    Directory of Open Access Journals (Sweden)

    Juliana Barreiros Porto

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  17. Tutoria em escola médica: avaliação por discentes após seu término e ao final do curso

    Directory of Open Access Journals (Sweden)

    Maria Mônica Freitas Ribeiro

    Full Text Available Na Faculdade de Medicina da UFMG, a tutoria, no formato mentoring, vincula-se ao Núcleo de Apoio Psicopedagógico ao Estudante e é atividade obrigatória. Como em outras escolas médicas, propõe ser um espaço de acolhimento ao estudante no início do ciclo profissional. O objetivo deste trabalho é avaliar, na visão do estudante, a relevância da tutoria em sua formação e as características comuns aos vários grupos. Foram aplicados questionários com perguntas fechadas e abertas aos estudantes do 6º, 11º e 12º períodos do curso médico, com análise descritiva dos resultados quantitativos e análise de conteúdo das questões abertas. Participaram da pesquisa 81% dos estudantes do sexto período e 51% do sexto ano. Houve controvérsia sobre a relevância da atividade, muitas vezes relacionada com obrigatoriedade e inadequação dos tutores, imediatamente após a mesma e ao final do curso. A necessidade de espaço para discutir temas não relacionados com a formação médica puramente técnica também foi salientada. Numa perspectiva geral, a tutoria é atividade importante no quadro curricular, mas é urgente aprimorar o programa, a seleção e a formação dos tutores.

  18. Impacto de treinamento baseado na Iniciativa Hospital Amigo da Criança sobre práticas relacionadas à amamentação no interior do Nordeste The impact of training based on the Baby-Friendly Hospital Initiative on breastfeeding practices in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    Sonia B. Coutinho

    2005-12-01

    Full Text Available OBJETIVO: Avaliar o impacto de treinamento baseado na Iniciativa Hospital Amigo da Criança sobre práticas relacionadas à amamentação na maternidade e freqüências de aleitamento materno nos primeiros 6 meses de vida. MÉTODOS: Foram treinadas 90% das auxiliares de enfermagem e parteiras de duas maternidades (A e B de Palmares (PE. Foram entrevistadas 334 mães nas primeiras 48 horas e 10 dias após o parto, para avaliar práticas que estimulam a amamentação nas maternidades e o cumprimento do quarto ao 10º passo da Iniciativa Hospital Amigo da Criança. Uma subamostra de 166 mães recebeu sete visitas domiciliares, para avaliar as freqüências do aleitamento materno nos 6 primeiros meses de vida. Os resultados foram comparados com os de estudo de coorte realizado na área em 1998. RESULTADOS: O desempenho da maternidade B foi melhor que o da maternidade A quanto às práticas que promovem o aleitamento materno relacionadas aos passos avaliados e quanto às freqüências de amamentação exclusiva. Comparação com coorte histórica evidenciou melhora nas práticas relacionadas à amamentação nas maternidades e aumento nas freqüências do aleitamento materno exclusivo (de 21,2 para 70%, nas primeiras 48 horas após o parto e durante os 6 primeiros meses de vida. CONCLUSÕES: O treinamento promoveu mudanças parciais em algumas práticas relacionadas à amamentação, repercutindo de forma positiva sobre as freqüências de aleitamento materno e aleitamento materno exclusivo nas maternidades. Contudo, não houve mudanças expressivas nessas freqüências ao longo dos 6 meses de vida, sugerindo a necessidade de intervenções efetivas no apoio ao aleitamento exclusivo nos serviços de saúde e na comunidade.OBJECTIVE: To evaluate the impact of training based on the Baby Friendly Hospital Initiative on breastfeeding practices in maternity wards and during the first 6 months of life. METHODS: Ninety percent of nursing auxiliaries and

  19. Trabalho rural e fatores de risco associados ao regime de uso de agrotóxicos em Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Soares Wagner

    2003-01-01

    Full Text Available O objetivo deste artigo foi caracterizar o processo do trabalho rural em nove municípios de Minas Gerais, considerando indicadores sócio-demográficos, a estrutura agrária dos estabelecimentos rurais, práticas de trabalho relacionadas ao uso de agrotóxicos e, a intoxicação associada a seu uso. Os dados foram obtidos de uma pesquisa realizada pela Fundação Jorge Duprat Figueiredo, de Segurança e Medicina do Trabalho, que aplicou um questionário a 1.064 trabalhadores rurais, entre os anos de 1991 a 2000. Por meio de uma regressão logística, foram obtidos os fatores de risco associados à intoxicação por agrotóxicos dos grupos organofosforados e carbamatos. Cerca de 50% dos entrevistados se encontravam ao menos moderadamente intoxicados. Os fatores de risco encontrados foram: ter o último contato a menos de duas semanas com agrotóxicos; não usar proteção; ser orientado pelo vendedor; citar organofosforado ou carbamato como agrotóxico principal e trabalhar nos municípios de Teófoli Otoni, Guidoval ou Piraúba. Os resultados apontam para o alto grau de risco de agravos à saúde a que estão sujeitos trabalhadores rurais em contato com agrotóxicos.

  20. Estudo eletrofisiológico e ablação por cateter: o que a Enfermagem precisa saber Estudio electrofisiológico y ablación por catéter: qué la enfermería precisa saber Electrophysiologic study and catheter ablation: what the nursing should know

    Directory of Open Access Journals (Sweden)

    Lutgarde Magda Suzanne Vanheusden

    2007-03-01

    Full Text Available A ablação por cateter é um procedimento invasivo eletrofisiológico que visa eliminar ou obstruir um circuito arritmogênico. Atualmente o Brasil conta com mais de 30 centros eletrofisiológicos nas regiões diversas que desenvolvem rotineiramente a técnica da ablação por radiofreqüência. Neste cenário específico, a presença da enfermeira vem se destacando desde a preparação do paciente até sua orientação para a alta. O objetivo deste artigo é revisar as indicações do estudo eletrofisiológico e da ablação por cateter para o diagnóstico e tratamento das arritmias cardíacas. O detalhamento técnico, as complicações e os cuidados de enfermagem são apresentados.La ablación por catéter es un procedimiento invasivo eletrofisiológico que tiene como objetivo eliminar o bloquear un circuito arritmogénico. Actualmente el Brasil cuenta con más de 30 centros eletrofisiológicos en las diversas regiones que desarrollan rutinariamente la técnica de ablación por radiofreqüência. En esta escena específica, la presencia de la enfermera viene destacándose desde la preparación del paciente hasta su orientación para el alta. El objetivo de este artículo es revisar las indicaciones del estudio eletrofisiológico y de la ablación por catéter para el diagnóstico y tratamiento de las arritmias cardiacas. El detallismo técnico, las complicaciones y los cuidados de de enfermería son presentados.The catheter ablation is an electro physiologic invasive procedure that aims at to eliminate or to block an arritmogenic circuit. Currently, Brazil has more than 30 electro physiologic centers in diverse regions that routinely develop the ablation technique by radiofrequency. In this specific scene, the presence of the nurse has been detaching since the preparation of the patient until the orientation for discharge. The objective of this article is to review the indications of the electro physiologic study and of the catheter ablation

  1. Colitis following fecal diversion: still a challenge Diagnóstico diferencial entre colite relacionada à derivação fecal e as doenças inflamatórias intestinais: o desafio persiste

    Directory of Open Access Journals (Sweden)

    Leonaldson dos Santos Castro

    2000-12-01

    Full Text Available After fecal diversion, nonspecific colitis may be seen in the defunctionalized colon. The purpose of this prospective study is to identify specific findings that could help in the differential diagnosis between diversion colitis and other inflammatory bowel diseases in order to avoid inappropriate diagnosis and therapy. It was studied, prospectively, thirteen consecutive patients from two public hospitals of Rio de Janeiro who had undergone temporary colostomy for indications other than inflammatory bowel disease. They were submitted to endoscopy with biopsy of both proximal and distal colorectal segments, and prospectively evaluated before and after restoration of intestinal continuity. Endoscopy with biopsy of both proximal and distal excluded colorectal segments showed a nonspecific mucosal and submucosal inflammation, resembling ulcerative colitis ( p Uma forma de colite relacionada à derivação fecal pode ser identificada nos segmentos colônicos excluídos do trânsito fecal. Esta condição inflamatória, ao mimetizar a doença de Crohn e a colite ulcerativa, pode resultar em diagnóstico e tratamento inapropriados. Este estudo prospectivo objetivou rever os efeitos da derivação fecal e caracterizar a evolução após a restauração do trânsito intestinal. Foram avaliados treze pacientes sem doença inflamatória intestinal e submetidos previamente à uma colostomia. Os achados da endoscopia com biópsia colo-retal, dos segmentos proximal e distal desfuncionalizados, evidenciaram uma inflamação inespecífica da mucosa e da submucosa, muito semelhante aquela da colite ulcerativa (p<0.01. Depois do fechamento da colostomia observou-se a regressão das alterações endoscópicas e histopatológicas. Em conclusão, enfatiza-se que na presença de uma colostomia, a colite relacionada à derivação fecal deve ser aventada no diagnóstico diferencial das doenças inflamatórias inespecíficas intestinais. O restabelecimento da

  2. Variáveis relacionadas à estabilidade de complexos organo-minerais em solos tropicais e subtropicais brasileiros Selected soil-variables related to the stability of organo-minerals complexes in tropical and subtropical brazilian soils

    Directory of Open Access Journals (Sweden)

    Alberto Vasconcellos Inda Junior

    2007-10-01

    Full Text Available A estabilidade de complexos organo-minerais é uma característica importante quanto à química e física de solos tropicais e subtropicais. O objetivo deste estudo foi identificar variáveis relacionadas à estabilidade de complexos organo-minerais, avaliada pela energia de ultra-som necessária para a dispersão total do solo em partículas primárias, em seis solos das regiões Sul e Centro-Oeste do Brasil com textura e mineralogia distintas. A energia de ultra-som necessária para dispersão total dos solos variou de 239 a 2.389J mL-1, sendo diretamente relacionada aos teores de carbono orgânico (R²=0,799, PThe stability of organo-mineral complexes is an important characteristic related to the soil chemistry and physics of tropical and subtropical soils. This study was aimed at identifing the variables related to the stability of organo-mineral complexes, evaluated by ultrasonic energy necessary to complete soil dispersion, of six soils from South and West-Center regions of Brazil with distint texture and mineralogy. The ultrasonic energy to complete soil dispersion varied from 239 a 2389J mL-1, and was positively related to the soil organic carbon concentrations (R²=0.799, P<0.05. The clay mineralogy had an important role to the stability of organo-mineral complexes, which were related to the content of low cristalinity iron oxides (R²=0.586, P<0.10, but did not had relationship with the total pedogenic iron oxides. The qualitative analysis of the clay mineralogy, by X-ray diffraction, evidenced that gibbsite and goethite are the main clay minerals related to the stability of organo-mineral complexes, reinforcing the importance of these minerals on the physical protection and coloidal stability of the soil organic matter in the tropical and subtropical soils.

  3. Diferentes Metodologias Aplicadas ao Ensino de Astronomia

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2007-08-01

    Espera-se que o educando ao final da educação básica, adquira uma compreensão atualizada das hipóteses, modelos e formas de investigação sobre a origem e evolução do Universo em que vive. O presente trabalho tem como principal objetivo compreender dentre três práticas pedagógicas adotadas no Ensino de Astronomia, na terceira série do Ensino Médio, da Escola Estadual Colônia dos Pescadores, qual melhor cumpre o papel de formação e aprendizagem para vida. A pesquisa preliminar foi através de um questionário onde o intuito foi diagnosticar o conhecimento já existente acerca do tema em questão. O questionário é composto de vinte questões dissertativas e objetivas, onde os educandos das três turmas envolvidas o responderam. Este trabalho utiliza as seguintes metodologias: a tradicional, onde o professor é um repassador de informações, fazendo uso exclusivo de lousa e giz; a segunda também de forma tradicional, porém com auxílio de multimídia para desenvolvimento das aulas e aterceira sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervenções necessárias. Ao final do trabalho os alunos responderão novamente o questionário inicial para diagnosticar dentre as três metodologias utilizadas qual apresentou melhor resultado. Os resultados preliminares obtidos, já podem ser observados e, dos 119 alunos entrevistados, as respostas obtidas são as mais diversas e evidenciam que a grande maioria nunca teve em sua vida escolar o tema Astronomia. Ao serem questionados se já haviam estudado Astronomia as respostas foram: turma A: sim 43%; turma B: sim: 21%; turma C: sim: 24%. Porém quando questionados a respeito do significado de Astronomia observou-se que: turma A: 100% de acertos; turma B: 64% acertos; turma C: 84% de acertos, demonstrando claramente a aprendizagem em diferentes esferas, não dependendo unicamente da escola. Até o presente momento, verificou-se que há interesse em

  4. ESTUDO COMPARATIVO DE HEMOCULTURAS E CATETERES POSITIVOS PARA LEVEDURAS DO GÊNERO CANDIDA DE ORIGEM HOSPITALAR

    Directory of Open Access Journals (Sweden)

    Anelise Cristina Osorio Cesar Doria

    2016-03-01

    Full Text Available Cerca de 80% das infecções fúngicas hospitalares são causadas por espécies do gênero Candida, Aproximadamente, 65% das infecções resultam da migração de micro-organismos da microbiota da pele, a partir do sítio de inserção do cateter e ocorrem devido à formação de biofilme. O objetivo do estudo foi realizar a caracterização de leveduras do gênero Candida isoladas de cateter venoso central (CVC e de hemoculturas de pacientes hospitalizados. A metodologia empregada foi a de identificação de amostras de CVC e hemocultura, utilizando CHROMagar®, CANDIFAST® e o método automatizado VITEK® 2 Compact. Para avaliação da formação de biofilme, utilizou-se a Microscopia Eletrônica de Varredura (MEV. Foram investigadas 18 amostras de pacientes hospitalizados, sendo encontradas 11 cepas de Candida albicans (50%, 02 cepas de C. parapsilosis (9%, 02 cepas de C. tropicalis (9%, 01 cepa de C. glabrata (4,5%, 01 cepa de C. pelliculosa 4,5%, 01 cepa de C. guilliermondii (4,5% e 04 cepas de leveduras não identificadas (18%. Na técnica de MEV, todas as amostras de cateter foram positivas para a formação de biofilme, concluindo-se que sua presença pode influenciar na candidemia hospitalar relacionada ao cateter.

  5. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    Directory of Open Access Journals (Sweden)

    Mónica Brinquinho

    2017-06-01

    Full Text Available O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores pretendem chamar a atenção para o consumo destes fármacos, particularmente frequente em indivíduos jovens, praticantes de desporto amador.

  6. Acesso ao aborto e liberdades laicas

    Directory of Open Access Journals (Sweden)

    Roberto Arriada Lorea

    2006-12-01

    Full Text Available Enfrentar o tema do aborto no Brasil requer uma perspectiva laica, na medida em que a liberdade de consciência assegurada na Constituição Federal impõe ao Estado contemplar não apenas as diferentes visões oriundas de distintas religiões, mas, principalmente, assegurar o direito à diversidade existente no seio de uma mesma religião, garantindo o direito de divergir da hierarquia de sua própria igreja. Assim, não havendo obstáculo jurídico à descriminalização do aborto no país, resta aos legisladores reformar a lei vigente, para descriminalizar o aborto, atendendo os compromissos assumidos pelo Brasil perante organismos internacionais de proteção dos direitos humanos e assegurando a eficácia das liberdades laicas.In Brazil, face an issue like abortion requires a lay perspective considering that the freedom of conscience assured by the Federal Constitution lays upon the State the need to look not only at different views from different religions but specially assure the right to the existing diversity within the same religion, as well as, the right to diverge from the hierarchy of his/her own religion. Therefore there is no legal barrier for the decriminalization of abortion in the country. It is up to the legislators to reform the present law to decriminalize abortion, assuming the commitments made by Brazil upon international organizations for the protection of the human rights assuring the efficacy of lay liberties.

  7. Correlação entre instrumentos de qualidade de vida relacionada à saúde e independência funcional em idosos com insuficiência cardíaca Correlation between instruments for measuring health-related quality of life and functional independence in elderly with heart failure

    Directory of Open Access Journals (Sweden)

    Fátima Ayres de Araújo Scattolin

    2007-11-01

    Full Text Available Este estudo teve como objetivo identificar a correlação entre as medidas de qualidade de vida relacionada à saúde e independência funcional em idosos com insuficiência cardíaca. Fizeram parte do estudo 146 idosos com insuficiência cardíaca em tratamento ambulatorial, que responderam ao Minnesota Living With Heart Failure Questionnaire (LHFQ e à Medida de Independência Funcional (MIF. Foi utilizado o coeficiente de correlação de Spearman para verificar a correlação entre as medidas de qualidade de vida relacionada à saúde e MIF, e entre estas e a Classificação Funcional da New York Heart Association (CF-NYHA. Foram constatadas correlações significantes de moderada magnitude entre as dimensões física e emocional do LHFQ e as subescalas total e motora da MIF. Os resultados evidenciaram que a qualidade de vida relacionada à saúde e independência funcional são conceitos correlacionados e influenciados pela CF-NYHA. Os resultados sugerem que ações voltadas à promoção da independência funcional podem otimizar a qualidade de vida relacionada à saúde de idosos com insuficiência cardíaca, especialmente na dimensão física. São necessários novos estudos com ampliação da amostra, inclusão de pacientes de faixa etária mais elevada e com maior gravidade da doença, para verificar a reprodutibilidade destes achados.The main purpose of this study was to identify the correlation between health-related quality of life and the Functional Independence Measure (FIM in elderly patients with heart failure. 146 elderly outpatients completed the Minnesota Living with Heart Failure Questionnaire (LHFQ and the FIM. Spearman correlation coefficient was used to identify correlations between health-related quality of life and FIM, and between them and New York Heart Association (NYHA class. Statistically significant moderate correlations were found between physical and emotional LHFQ and total FIM and motor subscale. The results

  8. Calidad de vida relacionada con la salud de las personas afectadas por quemaduras después de la cicatrización, Medellín, Colombia

    Directory of Open Access Journals (Sweden)

    Dolly Marcela Zapata

    2010-12-01

    Conclusión. A pesar de existir alguna concordancia en cuanto a que los componentes más afectados eran el desempeño físico y emocional, la población estudiada presentó una baja calidad de vida relacionada con la salud.

  9. Doença óssea relacionada com a fibrose quística: uma complicação recente

    Directory of Open Access Journals (Sweden)

    Kátia Cardoso

    2016-09-01

    Conclusões: A etiologia multifatorial e a interdependência e complexidade dos mecanismos patológicos subjacentes salientam a importância do acompanhamento dos doentes com doença óssea relacionada a fibrose quística em centros especializados que possibilitem um seguimento pluri e interdisciplinar integrado e diferenciado.

  10. Energia estática sobre o norte e nordeste do Brasil relacionada com a temperatura da superfície do mar

    National Research Council Canada - National Science Library

    Ana Cleide Nascimento Bezerra; Enilson Palmeira Cavalcanti

    2008-01-01

    ... atmosférica de grande escala, nas regiões Norte e Nordeste do Brasil (NEB), relacionadas com a variabilidade da temperatura da superfície do mar (TSM) nos oceanos Atlântico e Pacífico Tropicais...

  11. Bacteriemia relacionada a catéter por Ochrobactrum anthropi Catheter-associated bacteremia caused by Ochrobactrum anthropi

    Directory of Open Access Journals (Sweden)

    Rolando Soloaga

    2009-12-01

    Full Text Available Ochrobactrum anthtropi es un bacilo gram negativo aeróbico, no fermentador de la glucosa, anteriormente conocido como Achromobacter sp o CDC grupo Vd. Ha sido aislado del medio ambiente y de infecciones en seres humanos que generalmente presentaban algún tipo de inmunocompromiso. Las infecciones por este microorganismo fueron bacteriemias relacionadas a catéteres y en ocasiones endoftalmitis, infecciones urinarias, meningitis, endocarditis, absceso hepático, osteocondritis, absceso pelviano y absceso pancreático. Se presenta el caso de un paciente de sexo masculino, de 69 años de edad, que consultó a la guardia por hipotensión sostenida y síndrome febril de cuatro días de evolución, escalofrío, sudoración profusa y deterioro del sensorio. El paciente tenía diabetes de tipo 2 y antecedente de accidente cerebrovascular. Debido a insuficiencia renal crónica presentaba un catéter de doble lumen para la diálisis. Se documentó una bacteriemia relacionada a catéter por cultivo de sangre a través de catéter y de vena periférica, utilizando el sistema automatizado de hemocultivos Bact-Alert y la metodología de tiempo diferencial (>120min. La confirmación se realizó, una vez removido el catéter, por la técnica semicuantitativa de Maki (> 15 UFC. El microorganismo fue identificado por API 20NE y Vitek 1 como Ochrobactrum anthropi.Ochrobactrum anthropi is a non-glucose fermentative, aerobic gram-negative bacillus, formerly known as Achromobacter sp or CDC group Vd. It has been isolated from the environment and from infections in usually immunocompromised human beings. The documented infections frequently involved catheter related bacteremia whereas endophthalmitis, urinary infections, meningitis, endocarditis, hepatic abscess, osteochondritis, pelvic abscess and pancreatic abscess were rarely involved. Here it is presented the case of a male patient aged 69 years with sustained hypotension, four day febrile syndrome, chill, lavish

  12. Satisfação do paciente com degeneração macular relacionada à idade após terapia térmica transpupilar Satisfaction of the patient with age-related macular degeneration after transpupillary thermotherapy

    Directory of Open Access Journals (Sweden)

    Jhony de Polo

    2004-04-01

    Full Text Available OBJETIVO: Comparar resultados subjetivos (satisfação dos pacientes aos dados objetivos (melhora da acuidade visual - AV após o tratamento de degeneração macular relacionada à idade e/ou membrana neovascular sub-retiniana por terapia térmica transpupilar. MÉTODOS: Foram avaliados retrospectivamente 23 prontuários de pacientes com diagnóstico angiofluresceinográfico de degeneração macular relacionada à idade submetidos a uma única aplicação de terapia térmica transpupilar. Observou-se a acuidade visual antes e um mês após a aplicação, e a satisfação dos pacientes obtida com o tratamento. RESULTADOS: Avaliamos 23 pacientes, com idades variando entre 53 e 88 anos (média 74,08, dos quais 15 eram do sexo feminino, e 8 do sexo masculino. Foram encontrados 12 olhos com melhora da acuidade visual, 6 olhos sem alteração da acuidade visual, 6 olhos com acuidade visual piorada. Em relação à satisfação, os resultados obtidos foram: muito satisfeitos (4 olhos, satisfeitos (13 olhos, insatisfeitos (7 olhos e ainda cruzando-se os dados obteve-se muito satisfeitos com melhora da AV (3 olhos e muito satisfeitos sem melhora da AV (1 olho; satisfeitos com melhora da AV (7 olhos, satisfeitos sem melhora da AV (3 olhos, e satisfeitos com piora da AV (3 olhos; insatisfeitos com melhora da AV (2 olhos, insatisfeito sem melhora da AV (2 olhos, e insatisfeitos com piora da AV (3 olhos. CONCLUSÃO: Em relação à acuidade visual, esta foi melhorada em 12 olhos, dos 24 estudados; a quantidade de pacientes muito satisfeitos ou satisfeitos atingiu a quantidade de 17 olhos, no intervalo de um mês. Observando-se os resultados acima, pode-se considerar a terapia térmica transpupilar como terapia alternativa ou adjuvante para o tratamento de degeneração macular relacionada à idade.PURPOSE: Comparison of subjective outcome (patient's satisfaction with objective data (improvement of visual acuity-VA after treatment of age-related macular

  13. Bioquímica da esquistossomose mansônica. VI - alterações do compartimento lisossômlco hepático relacionadas ao tempo de infecção

    Directory of Open Access Journals (Sweden)

    Luiz Erlon Rodrigues

    1987-09-01

    Full Text Available O Schistosoma mansoni e/ou seus ovos causam uma hepatopatia muito importante e com aspectos anátomo-clínicos bem característicos. Uma vez carregados pela corrente circulatória, os vermes podem ocluir ramos dicotômicos de maior calibre do sistema portal e, quando mortos produzem lesões às vezes extensas, primeiro necróticas, depois inflamatórias e, posteriormente cicatriciais, sempre circunscritas e não sistematizadas. Os ovos, além de penetrarem no's ramúsculos não dicotômicos da rede periductal, alcançam os ramos de distribuição ou até mesmo as vênulas aferentes, ocluin- do muitas delas e, como conseqüência, formam os granulomas intravasculares que podem levar a uma interrupção da corrente sangüínea portal a esse nível e alterações da circulação intralobular. A diminuição da taxa de oxigênio disponível e conseqüentemente o decréscimo do pH intra e extracelular são potentes labilizadores das membranas dos diversos componentes do compartimento lisossômico. A saída de hidrolases ácidas, proteínas catiônicas e hidrolases neutras, a partir desses orgãnulos, acarreta agressões tissulares muito importantes, com o desencadeamento e/ou manutenção dos processos inflamatórios típicos desta parasitose. Neste trabalho estudou-se as atividades lisossômicas ligadas às diversas fases da esquistossomose mansônica hepática. Os resultados indicaram que a integridade funcional dos complexos membranosos do compartimento lisossômico foi significativamente alterada, já a partir do segundo mês da infecção e que parece haver um estreito relacionamento entre o agravamento das lesões inflamatórias hepáticas com uma maior labilidade lisossômica.Schistosoma mansoni and/or its eggs cause important hepatic pathology distinguished by very characteristic anatomo-clinicalfeatures. If carried by the blood stream, the worms are able to occlude dichotomic branches of larger diameter of the portal system. These worms, when dead, produce lesions that are sometimes extensive, initially necrotic, then inflammatory and finally cicatricial. These lesions are always circumscribed and not systematized. Besides penetrating into the tiny non-dichotomic branches of the periductal net, the eggs reach the branches of distribution or even the afferent venulae, occluding some of them. Consequently intravascular granulomas are formed which can lead to an interruption of the portal blood stream at this level and to changes in the intralobular circulation. The decrease of the rate of available oxygen and consequent decrease in the intra and extracellular pH are potent labilisers of membranes of several components of the lysosomal compartment. The exit of acid hydrolases, cationic proteins and neutral hydrolases from these organelles brings about major tissular aggression, represented by the formation and maintenance of the typical inflammatory processes of this parasitism. In this work lysosomal activity related to hepatic schisto-somiasis mansoni has been studied. The results indicated that the functional integrity of the lysosomal membrane complexe had been significantly changed. These changes have been observed from the second month of infection and there seems to be a close relationship between the severity of the liver inflammatory lesions and a greater lysosomal lability.

  14. Características relacionadas ao primeiro e último parto por cesárea Characteristics related to the first and last cesarean delivery among women from a Campinas University Hospital

    Directory of Open Access Journals (Sweden)

    Arlete Maria dos Santos Fernandes

    2007-02-01

    Full Text Available OBJETIVO: Estudar a associação entre a primeira e a última cesáreas e laqueadura tubária; determinar tempo de vida reprodutivo após o primeiro parto. MÉTODOS: Foram entrevistadas 653 mulheres com pelo menos duas gestações, de fevereiro a outubro de 2001 em hospital universitário, 172 com primeira e 294 com última cesárea. As variáveis foram sociodemográficas, obstétricas e características do primeiro e último partos e da laqueadura. Utilizou-se análise bivariada, posteriormente regressão múltipla com cálculo do odds ratio ajustado. Mulheres laqueadas foram separadas em grupos de 25 a 44 e > 45 anos, distribuídas em percentis e aplicou-se o teste de Wilcoxon para análise da idade na laqueadura e tempo de vida reprodutivo após o último parto. O estudo teve aprovação do Comitê de Ética. RESULTADOS: Do total de mulheres, 89% tinham escolaridade 5 salários (OR=2,41, IC 95% 1,42 a 4,08 e idade no primeiro parto > 25 anos (OR=1,80, IC 95% 1,01 a 3,22. A idade média na laqueadura foi de 29 e 33,2 anos nas mulheres com 25 a 44 anos e > 45 anos, respectivamente (pOBJECTIVE: To study the association between first and last caesarian sections with tubal sterilization; to determine length of reproductive life after the first delivery. METHODS: From February to October 2001 in a university hospital, interviews were carried out with 653 women having had at least two pregnancies. Of these women, 172 had a first caesarian section; 294 had a last caesarian section. Variables were social demographic characteristics, obstetric history and characteristics of the first and last deliveries and tubal sterilization. Bivariate analysis was performed, followed by multiple regression analysis calculating the adjusted odds ratio. Women who had undergone tubal sterilization were divided into age groups of 25 to 44 and >45 years in a percentile distribution. The Wilcoxon test was used to analyze age at tubal sterilization and length of reproductive life after the last delivery. The study was approved by the Ethics Committee. RESULTS: Of these women, 89% completed 5 minimum wages (OR=2.41, 95%CI 1.42 to 4.08 and age at first delivery >25 years (OR=1.80, 95%CI 1.01 to 3.22. Mean age at sterilization was 29.0 and 33.2 years in women aged 25 to 44 years and >45 years, respectively (p<0.001. The duration of the reproductive period after the first delivery was 9.0 and 11.4 years for the same groups (p<0.001. CONCLUSION: The first caesarian section was associated with the last caesarian section. The last caesarian section was associated with intrapartum tubal sterilization. Age at sterilization was lower and the reproductive period was shorter among younger women.

  15. ComplicaÃÃes relacionadas a progressÃo da doenÃa de Parkinson e ao uso de levodopa: um estudo sobre flutuaÃÃes motoras e funÃÃo orofaringea

    OpenAIRE

    Francisca Sueli Monte

    2003-01-01

    Pacientes com doenÃa de Parkinson (DP) desenvolvem freqÃentemente flutuaÃÃes motoras com perda de beneficio terapÃutico. A levodopa permanece como agente dopaminÃrgico mais efetivo, entretanto, apÃs alguns anos de tratamento observa-se geralmente flutuaÃÃes motoras e discinesias. A ocorrÃncia destas complicaÃÃes à responsÃvel por incapacidade e constituem desafio terapÃutico. PublicaÃÃes recentes tÃm sugerido que a amantadina, inicialmente prescrita como uma substÃncia com atividade antiv...

  16. Alpha radioactivity monitoring related to Radon-222 in water from wells in metropolitan area of Curitiba (PR), Brazil; Monitoramento da radioatividade alfa relacionada ao radonio-222 em aguas de pocos da regiao metropolitana de Curitiba (PR)

    Energy Technology Data Exchange (ETDEWEB)

    Correa, Janine Nicolosi; Paschuk, Sergei Anatolyevich; Kappke, Jaqueline; Claro, Flavia Del; Perna, Allan Felipe Nunes; Reque, Marilson, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy; Schelin, Hugo Reuters [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita Oliveira [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-04-15

    This research objective was to assess the level of randon-222 concentration in well water of the metropolitan region of Curitiba, Parana. Current work presents the results of indoor {sup 222}Rn activity ground water samples from artesian wells from aquifers of the region. The studies of radon activity in water were performed using the radon detector AlphaGUARD. The calculations of initial radon activity in water were done considering the {sup 222}Rn decay correction as well as equilibrium level of {sup 222}Rn and {sup 226}Ra observed after 30 days of measurements. Obtained results show that about 70% of measured activity levels of {sup 222}Rn are higher than the recommended value of 11.1 Bq.L{sup -1}, which represent the risk for the human health associated with this radionuclide. The case study showed that previous measurements of radon are recommended for a construction project is implemented. In this case, it is observed that the radon concentrations decrease about 56% in the first water tank and 83% in the second water tank over the well. This fact shows that the actions for mitigation of radon are viable and do not require major modifications to the usual systems of construction. (author)

  17. Comprovação empírica de uma medida relacionada ao excessivo consumo de álcool em brasileiros / Empirical Verification of a Measurement Related to the Excessive Alcohol Consumption in Brazilians

    Directory of Open Access Journals (Sweden)

    Nilton S. Formiga

    2015-06-01

    Full Text Available RESUMO: O consumo de álcool entre universitários tem sido um problema determinante para as relações interpessoais e desenvolvimento acadêmico, mas também um problema que traz um prejuízo social, econômico e de saúde. Medidas tem surgido e sugerida a reavaliação de outras para identificar o fenômeno do consumo de álcool. Porém, o Alcohol Use Disorders Identification Test (AUDIT ainda tem sido o instrumento mais utilizado em estudos no mundo, o qual tem se revelado consistente. O presente estudo tem como objetivo avaliar a consistência interna e fatorial do AUDIT em universitários em diferentes estados brasileiros. O AUDIT e dados sociodemográficos foram respondidos por 639 universitários dos dois sexos, acima de 18 anos, distribuídos em diferentes cursos superiores de instituições particulares e públicas em quatro estados no Brasil. Realizando distintos cálculos estatísticos, observaram-se indicadores psicométricos que revelaram confiabilidade na medida do AUDIT na amostra pesquisada. Este procedimento tanto garantiu a medida sobre a identificação do problema do consumo de álcool quanto observou-se que, independente do contexto educacional dos universitários, nos referidos estados brasileiros, todos os respondentes revelaram problemas com o consumo alcoólico. ABSTRACT: The consumption of alcohol in college students has been a crucial problem for interpersonal relationships and academic development; but it is also a problem that means a social, economic and health damage. It has been emerged and suggested measures to be ratified to identify the phenomenon of alcohol consumption. However, the Alcohol Use Disorders Identification Test (AUDIT is still the most used instrument in world studies, the same one that has remained constant. The present research aims to assess the internal and factorial consistency of the AUDIT in college students from different Brazilian States. A total of 639 college students of both sexes over 18 years old, distributed in different advanced courses of public and private institutions in four Brazilian States, responded the AUDIT and socio-demographic data. Performing different statistical calculations, psychometric indicators were observed which gave confidence to the AUDIT measurement in the investigated sample. This procedure guaranteed the measure regarding the identification of the alcohol consumption problem, as it also observed that independent of the educational context of college students in the concerned Brazilian States, all respondents revealed problems with alcohol consumption.

  18. Aphid parasitoids (Hymenoptera, Braconidae, Aphidiinae and their associations related to biological control in Brazil Parasitóides (Hymenoptera, Braconidae, Aphidiinae de pulgões e suas interações relacionadas ao controle biológico no Brasil

    Directory of Open Access Journals (Sweden)

    Petr Starý

    2007-03-01

    Full Text Available This study evaluated the parasitoid-aphid-plant associations in Brazil with the objective of developing a useful research database for further studies of aphid parasitoid ecology and aphid management. The original material was obtained from collections made in Paraná, Rio Grande do Sul, Minas Gerais, and São Paulo states. The published information on the Aphidiinae in Brazil is revised. The general features of the target parasitoid fauna of Central and South America is summarized and promising biological control programs of some aphid species in Brazil is discussed.Este trabalho avaliou as interações parasitóides-pulgão-planta no Brasil, com o objetivo de desenvolver um banco útil de dados para estudos subseqüentes em ecologia de parasitóides de afídeos e manejo de pulgões. O material original foi obtido de coletas nos estados do Paraná, Rio Grande do Sul, Minas Gerais e São Paulo, sendo revisadas as informações sobre Aphidiinae publicadas no Brasil. Foram também sumarizadas as caracteristicas gerais da fauna de parasitóides das Américas Central e do Sul e discutidos os programas potenciais de controle biológico de algumas espécies de pulgões no Brasil.

  19. El Registro de Gemelos de Murcia. Un recurso para la investigación sobre conductas relacionadas con la salud

    Directory of Open Access Journals (Sweden)

    Juan R. Ordoñana

    2018-01-01

    Full Text Available Los diseños genéticamente informativos, y en particular los estudios de gemelos, constituyen la metodología más utilizada para analizar la contribución relativa de los factores genéticos y ambientales a la variabilidad interindividual. Básicamente, consisten en comparar el grado de similitud, con respecto a una característica o rasgo determinado, entre gemelos monocigóticos y dicigóticos. Además de la clásica estimación de heredabilidad, este tipo de registros permite una amplia variedad de análisis únicos por las características de la muestra. El Registro de Gemelos de Murcia es un registro de base poblacional centrado en el análisis de conductas relacionadas con la salud. Las prevalencias de problemas de salud observadas son comparables a las de otras muestras de referencia de ámbito regional y estatal, lo que avala su representatividad. En conjunto, sus características facilitan el desarrollo de diversas modalidades de investigación, además de diseños genéticamente informativos y la colaboración con distintas iniciativas y consorcios.

  20. Conciencia ambiental y conducta sustentable relacionada con el uso de energía para iluminación

    Directory of Open Access Journals (Sweden)

    Graciela Lucía Tonello

    2015-06-01

    Full Text Available La conciencia ambiental es definida como un concepto multidimensional que constituye la dimensión actitudinal del comportamiento pro ambiental. En un contexto global y local de crisis energética, el presente trabajo tuvo como objetivos investigar las interrelaciones entre las diferentes dimensiones de la conciencia ambiental y la posible sustentabilidad detrás de conductas relacionadas con el uso de la iluminación, en una muestra de estudiantes universitarios. La metodología incluyó el desarrollo y administración de una encuesta con diferentes secciones para estimar la conciencia ambiental mediante escalas clasificatorias y preguntas sobre percepción de problemas ambientales, la atribución de responsabilidades, escalas estandarizadas de preocupación ambiental, conocimientos ambientales y la propensión al futuro como un rasgo de la personalidad sustentable. Los resultados en general muestran que la temática energética, al menos la referida a la iluminación tomada en este estudio, no es percibida como problemática ambiental sino como una problemática que afecta a nivel individual, y la perspectiva temporal de futuro evidenciada por la muestra está referida al tiempo futuro en sí mismo, más que como rasgo de personalidad sustentable.

  1. DESCRIPCIÓN DE UN FRAMEWORK METODOLOGICO PARA EL DESARROLLO DE APLICACIONES RELACIONADAS CON EL PATRIMONIO CULTURAL

    Directory of Open Access Journals (Sweden)

    Edwin Mauricio Hincapié-Montoya

    2014-01-01

    Full Text Available Preservar los espacios y difundirlos es una función social que debe mantener unidos a los pueblos y que no puede dejarse a un lado por el clamor y la voz del desarrollo. Para ello la tecnología juega un papel de facilitador mediático a través de la cual se puede llegar a diferentes espacios y lugares históricamente importantes pero físicamente inaccesibles por su desaparición. En los últimos años se han desarrollado aplicaciones que buscan reactivar el patrimonio cultural y hacen uso de tecnologías como realidad virtual, realidad aumentada o juegos serios. Sin embargo, la mayoría son casos de estudio en un tema particular y el área carece de un framework metodológico, que guie y facilite el desarrollo de este tipo de aplicaciones. En este articulo proponemos un framework metodológico conceptual, el cual busca guiar el desarrollo de aplicaciones relacionadas con la reactivación del patrimonio cultural al tiempo que maximiza el aprendizaje de los usuarios en este tema.

  2. Review of AO calibrations, or how to best educate your AO system

    Science.gov (United States)

    Kolb, Johann

    2016-07-01

    If the Real-Time Computer is the heart of an AO system, the Wavefront Sensor (WFS) its eyes, the Deformable Mirror (DM) its hands and the control strategy its nervous system, the sum of all those parts is made into a harmonious entity thanks to calibrations. This paper does not have the ambition to provide an overview of all the currently existing calibration strategies, but rather to focus on a few challenging problems and their recent evolution in the era of adaptive telescopes, mostly based on the experience of ESO's Adaptive Optics Instruments in general and the AO Facility in particular. Single most important calibration in post-focal AO system, the recording of the Interaction Matrix (IM) between WFS and DM has since long evolved to use fast modulation techniques, has shown to be feasible on-sky and is now almost free from measurements thanks to its pseudo-synthetic generation, quasi-mandatory solution in an adaptive telescope. Pseudo- because it requires an unprecedented knowledge of the components' characteristics, especially the WFS, DM and the optical registration between the two. Bigger telescopes and the use of Laser Guide Stars (LGS) also mean that the properties of the system will change in time and thus need to be constantly updated thanks to online diagnosis tools for spot size measurement, atmosphere monitoring, Wavefront Sensing and control optimization. New loops come into play like the one to minimize LGS Jitter and the one taking over the telescope active optics by means of offloading the DM low orders, and they all require calibration. More calibration means more time and one has to carefully balance the calibrations that require precious telescope night time, day time or for the best, no telescope time at all. Their importance sometimes underestimated, calibrations have repeatedly shown to be a vital part in the optimum functioning of present and future AO systems.

  3. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  4. O processo do cateterismo venoso central em Unidade de Terapia Intensiva Neonatal e Pediátrica

    Directory of Open Access Journals (Sweden)

    Aline Veronica de Oliveira Gomes

    2013-08-01

    Full Text Available Estudo descritivo, longitudinal e abordagem quantitativa, que objetivou analisar e discutir o processo do cateterismo venoso central nas Unidades de Terapia Intensiva neonatal e pediátrica; descrever as variáveis relacionadas à caracterização da população do estudo (unidade de internação, faixa etária e sexo e descrever as variáveis relacionadas ao processo do cateterismo venoso central (tipo de cateter, motivo de indicação, número de lumens, sítio de inserção, profissional que realizou o procedimento, terapêutica medicamentosa infundida via cateter, motivo de retirada, tempo de permanência e as complicações mecânicas e infecciosas. A coleta de dados foi realizada em unidade de terapia intensiva neonatal e pediátrica, em 82 prontuários. As indicações dos cateteres foram, em sua maioria, para infusão medicamentosa prolongada e Nutrição Parenteral Total. A remoção foi indicada predominantemente por complicações mecânicas e infecciosas. Esse estudo viabilizou rever a prática assistencial para estabelecer o aprimoramento da assistência prestada à clientela neonatal e pediátrica.

  5. Directly Imaging Planets with SCExAO: First Results

    Science.gov (United States)

    Currie, Thayne M.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kudo, Tomoyuki; Uyama, Taichi; Garcia, Eugenio

    2017-01-01

    We present the first science results from the newly commissioned Subaru Coronagraphic Extreme Adaptive Optics project, an experimental system dedicated to image faint jovian planets around nearby stars. SCExAO is now achieving true extreme AO capability. We describe the typical performance of SCExAO, the first images of benchmark exoplanets and planet-forming disks, and SCExAO’s first science results. Finally, we briefly chart the path forward for SCExAO to achieve its full scientific capability, including imaging mature planets in reflected light.

  6. Photon counting arrays for AO wavefront sensors

    CERN Document Server

    Vallerga, J; McPhate, J; Mikulec, Bettina; Clark, Allan G; Siegmund, O; CERN. Geneva

    2005-01-01

    Future wavefront sensors for AO on large telescopes will require a large number of pixels and must operate at high frame rates. Unfortunately for CCDs, there is a readout noise penalty for operating faster, and this noise can add up rather quickly when considering the number of pixels required for the extended shape of a sodium laser guide star observed with a large telescope. Imaging photon counting detectors have zero readout noise and many pixels, but have suffered in the past with low QE at the longer wavelengths (>500 nm). Recent developments in GaAs photocathode technology, CMOS ASIC readouts and FPGA processing electronics have resulted in noiseless WFS detector designs that are competitive with silicon array detectors, though at ~40% the QE of CCDs. We review noiseless array detectors and compare their centroiding performance with CCDs using the best available characteristics of each. We show that for sub-aperture binning of 6x6 and greater that noiseless detectors have a smaller centroid error at flu...

  7. A VIA DEMOCRÁTICA AO AUTORITARISMO

    Directory of Open Access Journals (Sweden)

    Paulo César Nascimento

    2013-09-01

    Full Text Available Este artigo analisa as teorias de Aristóteles, Tocqueville e Hannah Arendt a respeito de como alguns aspectos da democracia como a busca do igualitarismo e o voto majoritário podem conduzir ao despotismo. Examinando os casos da democratização da Rússia pós-comunista e o sistema político da Venezuela durante a presidencia de Hugo Chavez, o texto procura demonstrar a importância das idéias daqueles pensadores para a compreensão de regimes autoritários legitimados pelo voto popular. --- The democratic route of autoritarism This article reviews the theories of Aristotle, Tocqueville and Hannah Arendt with respect to some elements of democracy such as the pursue of egalitarianism and the reliance on the will of the majority that can lead to despotism. On the basis of post-communist Russia’s transition to democracy and Venezuela’s political system under the presidency of Hugo Chavez, the article shows the importance of those thinker’s insights to understand current authoritarian regimes which rely on popular vote. keywords: democracy, autoritarian regimes, voting.

  8. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  9. Associação entre polimorfismo SLC6A3 3’UTR VNTR e a resposta ao tratamento da dependência de nicotina

    Directory of Open Access Journals (Sweden)

    Guilherme Rubino de Azevedo Focchi

    2011-01-01

    Full Text Available Objetivo: Avaliar a associação entre a resposta ao tratamento da dependência de nicotina com bupropiona e a presença do polimorfismo SLC6A3 3’UTR VNTR, localizado no gene que codifica o transportador dopaminérgico. Método: Foram acompanhados no Ambulatório de Tabagismo do Instituto de Psiquiatria da Faculdade de Medicina da USP 100 pacientes do sexo masculino com diagnóstico de dependência de nicotina, sem outras patologias. Todos receberam bupropiona até 300 mg ao dia por 12 semanas, associada à terapia cognitivo-comportamental em grupo. A Escala de Fagerström foi aplicada no início e no final do tratamento, e avaliou-se a parada do uso de cigarros na última semana de tratamento e um mês após. Os pacientes tiveram 10 ml de sangue colhidos e genotipados para a existência do polimorfismo SLC6A3 3’UTR VNTR. Resultados: Não foi encontrada associação entre cessação do uso de cigarro e presença do polimorfismo. Conclusão: São necessários mais estudos para avaliar se a presença do polimorfismo SLC6A3 3’UTR VNTR estaria relacionada à melhor resposta ao tratamento da dependência de nicotina.

  10. Percepção de mães sobre o cuidado domiciliar prestado ao bebê nascido com baixo peso

    Directory of Open Access Journals (Sweden)

    Elieth Lessa Fonseca

    2011-02-01

    Full Text Available O objetivo do estudo foi identificar as dificuldades percebidas pelas mães no cuidado aos bebês de baixo peso e conhecer os recursos utilizados diante das intercorrências na saúde. Estudo de natureza qualitativa, desenvolvido junto a seis mães residentes em Maringá, PR, Brasil. Os dados foram coletados no período de fevereiro a setembro de 2008, em quatro visitas domiciliares, por meio de entrevista semi-estruturada. As mães vivenciaram dificuldades relacionadas aos profissionais e serviços de saúde, características do bebê, condições financeiras, alterações na rotina familiar e retorno ao trabalho. No enfrentamento das intercorrências, utilizaram recursos próprios ou atendimento médico. Concluiu-se que a mãe e a família necessitam de acompanhamento e apoio profissional para melhor cuidar do bebê de baixo peso no domicílio

  11. Avaliação da qualidade de vida relacionada à saúde de cortadores de cana-de-açúcar nos períodos de entressafra e safra Evaluación de la calidad de vida relacionada con la salud de cortadores de caña de azúcar en los períodos de entre-cosecha y cosecha Assessment of health-related quality of life of sugarcane cutters in the pre-harvest and harvest periods

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Soares de Carvalho Junior

    2012-12-01

    Full Text Available OBJETIVO: Avaliar a qualidade de vida relacionada à saúde de cortadores de cana-de-açúcar. MÉTODOS: Estudo longitudinal em uma usina sucroalcooleira no Oeste do estado de São Paulo de abril (final da entressafra a outubro (final da safra de 2010. Foram avaliados 44 cortadores de cana-de-açúcar tabagistas e não tabagistas em três períodos: ao final da entressafra, no fim do terceiro mês de safra e no final da safra. A qualidade de vida relacionada à saúde foi avaliada pelo questionário Medical Outcomes Study 36-Item Short-Form Health Survey (SF-36. Foram realizados análise de variância para medidas repetidas e teste de Friedman para comparar a qualidade de vida entre os períodos. Utilizou-se o teste de Goodman para identificar a frequência dos trabalhadores cujo escore aumentou nos períodos de safra em comparação com a entressafra (respondedores positivos, considerando-se as variáveis qualitativas dos domínios do SF-36. RESULTADOS: Ao final da entressafra, 23% dos trabalhadores desistiram do trabalho; 27% eram tabagistas. Houve decréscimo significativo no domínio vitalidade no final da safra em comparação com a entressafra. Os desistentes apresentaram maior escore no domínio aspecto social em relação ao grupo que permaneceu no trabalho. Não houve diferença na qualidade de vida relacionada à saúde entre tabagistas e não tabagistas. No entanto, observou-se maior percentual de respondedores positivos entre não tabagistas nos domínios aspecto físico, social e emocional nos três meses de safra e nos domínios estado geral de saúde e aspecto social nos seis meses de safra, quando comparados aos tabagistas. CONCLUSÕES: A qualidade de vida relacionada à saúde em cortadores de cana-de-açúcar mostrou-se diminuída após o período de safra no domínio vitalidade. Os trabalhadores que permaneceram na safra são os que apresentaram piores aspectos sociais, o que mostra a necessidade de promoção de pol

  12. Sesgo de respuesta en una encuesta postal poblacional sobre calidad de vida relacionada con la salud (SF-12v2

    Directory of Open Access Journals (Sweden)

    Bienvenida Carpe Carpe

    2014-01-01

    Full Text Available Fundamentos: en las investigaciones que utilizan un cuestionario como fuente de información el sesgo asociado a la baja tasa de respuesta puede limitar la ventaja económica de las encuestas poblacionales por correo postal. El objetivo fue estimar los factores asociados a la no respuesta con énfasis en la Calidad de Vida Relacionada con la Salud (CVRS. Métodos: a las personas que respondieron a la Encuesta de Salud de Murcia-2007 (> 18 años, realizada vía telefónica, se les remitió cuatro meses después un segundo cuestionario por vía postal. Ambas evaluaciones incluían información sobre CVRS: SF-12v2 (telefónica y EQ-5D (postal. Se realizó una regresión logística para identificar los factores basales (sociodemográficos, conductas relacionadas con la salud y CVRS -sumario físico (CSF y sumario mental (CSM del SF-12v2 asociados a la no respuesta postal. Resultados: 2.078 (61,5% individuos no respondieron. Análisis multivariante: la no respuesta se asoció con el estado civil, mayor probabilidad de no responder si no estaba casado (viudo OR: 2,24; IC95% 0,61/0,88; separado/divorciado1,69;1,10/2,59; soltero 1,53;1,23/1,90 y de manera inversa con la edad (25-34 años OR:0,95;IC95% 0,69/1,29; 35-44 años 0,60; 0,43/0,85; 45-54 años 0,42; 0,29/0,60; 55-64 años-0,29; 0,20/0,43; 65-74 años 0,17; 0,11/0,26; >75 años 0,15; 0,09/0,23 y el nivel de estudios (primarios OR: 0,65; IC95% 0,48/0,86; secundarios 0,41; 0,30/0,57; superiores 0,22; 0,16/0,30. También se asoció con la CVRS pero de manera diferenciada para el CSF: las personas con puntuaciones intermedias presentaron menor probabilidad de no responder (OR: 0,73; IC95% 0,61/0,88 que para el CSM: las personas del tercil superior presentaron mayor probabilidad de no responder (OR: 1,47; 1,22/1,78. Conclusiones: la CVRS influye en la no respuesta de las encuestas postales, dando lugar a una sobrerrepresentación de los individuos con salud física media y con salud mental baja, lo

  13. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  14. WIYN active optics: a platform for AO

    Science.gov (United States)

    Code, Arthur D.; Claver, Charles F.; Goble, Larry W.; Jacoby, George H.; Sawyer, David G.

    1998-09-01

    The WIYN 3.5 meter telescope is situated on the southwest ridge of Kitt Peak yielding excellent atmosphere seeing conditions. As such, the telescope and enclosure design was directed towards exploiting this feature. The primary mirror was spun cast and figured by the Steward Observatory Mirror Laboratory and the secondary mirror by Contraves. In both cases the performance exceeded the design specifications. The borosilicate primary is actively temperature controlled to within 0.2 C of the desired temperature, typically 0.5 degrees C below the ambient air. The telescope structure is also temperature controlled and the enclosure is opened to the outside ion all sides, which all heat sources are vented to ducts carrying air downwind of the facility. The primary mirror is actively controlled for low order aberrations by 66 axial actuators which are adjusted open loop via force matrix look-up tables and closed loop via real-time wavefront curvature sensing measurements. The active optics also included real-time collimation and focus control. The telescope drive and guider are capable of providing tracking to a few hundredths of a second of arc. By employing active telescope control at this level, it is possible to maintain telescope and local wavefront distortion to a level where atmospheric effects dominate the image quality. Since a significant fraction of the power in the atmospheric disturbances is contained in image motion the first step in adaptive optics control will be simple tip tilt. Studies of higher order AO system are being carried out, as well as additional test characterizing the telescope and site. It is intended to continue such studies in an attempt to establish long term variances.

  15. Fatores associados com a qualidade de vida relacionada à saúde de idosos em hemodiálise

    Directory of Open Access Journals (Sweden)

    Sonia Faria Mendes Braga

    2011-12-01

    Full Text Available OBJETIVO: Identificar fatores associados à qualidade de vida relacionada à saúde de pacientes idosos em hemodiálise. MÉTODOS: Estudo transversal com 223 pacientes com idade > 60 anos em hemodiálise nas unidades de diálise do município de Belo Horizonte, MG, em 2008. A qualidade de vida foi avaliada utilizando o Kidney Disease and Quality of Life - Short Form (KDQOL-SF e o Medical Outcome Survey - Short Form 36 (SF-36. Os três escores do KDQOL-SF medidos foram: componente da doença renal sumarizado (11 subescalas, componente físico sumarizado (quatro subescalas e componente mental sumarizado (quatro subescalas. RESULTADOS: Foram observadas associações negativas significativas e independentes do componente da doença renal e mental com número de doenças crônicas e tempo de tratamento (ambas. O componente físico foi menor entre os mais velhos, as mulheres, aqueles com maior número de internações e com três ou mais doenças crônicas. CONCLUSÕES: A associação consistente com presença de doenças crônicas mostra a importância do perfil de morbidade para a qualidade de vida dessa população. A identificação dos fatores associados, como aumento da idade, sexo feminino, número de internações e tempo de tratamento, pode favorecer o planejamento adequado das ações de saúde para melhor atender a esse grupo.

  16. Sobre a Produção Acadêmica Reichiana Relacionada à Área Educacional

    Directory of Open Access Journals (Sweden)

    Sara Quenzer Matthiesen

    Full Text Available Resumo A produção acadêmica em Universidades brasileiras que vincula Wilhelm Reich a diferentes áreas, produzindo novos conhecimentos em torno e a partir de suas ideias, tem crescido nos últimos anos, demonstrando que, para além da prática clínica, é possível identificarmos outras possibilidades de conhecimento de suas ideias articulando-as à Educação. Objetivando identificar as dissertações de mestrado e teses de doutorado que têm explorado suas ideias articulando-as à área educacional, essa pesquisa teórico-bibliográfica constatou que, dentre uma centena de produções acadêmicas produzidas entre 1979 e 2012 sobre o tema, 39 estão relacionadas à área educacional, sendo 29 dissertações de mestrado e 10 teses de doutorado. Analisados pelas categorias: “Ideias reichianas para a educação”, “Ideias reichianas e a educação de educadores”, “Ideias reichianas no cotidiano escolar”, “Ideias reichianas e a educação sexual” e “Aplicação das ideias reichianas em diferentes áreas da Educação”, os resultados desta pesquisa revelaram que este autor é um dos referenciais utilizados para se pensar temas educacionais contemporâneos no campo acadêmico brasileiro, demonstrando o quanto suas ideias podem contribuir para a formação e atuação de educadores.

  17. Identificación molecular de mutaciones puntuales relacionadas con resistencia a drogas en VIH-1 de pacientes peruanos

    Directory of Open Access Journals (Sweden)

    Carlos Yabar V

    2006-07-01

    Full Text Available Objetivo: Identificar mutaciones puntuales relacionadas con resistencia a drogas en VIH-1 de pacientes peruanos. Materiales y metodos: Se seleccionaron 11 muestras de VIH provenientes de sangre total de sujetos con tratamiento antirretroviral (ARV. Posteriormente se realizo la optimizacion de la amplificacion de 337 pb del gen de la transcriptasa reversa (tr y 377 pb de todo el gen de la proteasa (prt. Los productos de PCR fueron secuenciados directamente para el analisis de mutaciones de resistencia. Las secuencias finales fueron analizadas en programas de analisis de mutaciones de la HIV Drug Resistance Database de la Universidad de Stanford. mutaciones de la HIV Drug Resistance Database de la Universidad de Stanford. Resultados: La optimizacion de la concentracion de ADN (2,5 ng / µL asi como la concentracion de magnesio (4 mM fueron factores criticos para la amplificacion de la tr y la prt respectivamente. De otro lado, el analisis de secuencia revelo la presencia de las mutaciones T215Y y la M184V en tr, implicadas en conferir resistencia a zidovudina (AZT y estavudina (D4T asi como a lamivudina (3TC y emtricitabina (FTC respectivamente. En prt se observaron las mutaciones D30N y N88D implicadas en conferir resistencia a nelfinavir (NFV. Es importante senalar que solo tres muestras de VIH-1 presentaron mutaciones de resistencia, las demas mostraron mutaciones compensatorias. Conclusiones: Se demuestra la existencia de mutaciones de resistencia a ARV a nivel de tr y prt de VIH-1 en sujetos peruanos que reciben terapia TARGA. Se requieren de mayores estudios para establecer un perfil de resistencia a ARV en la poblacion peruana.

  18. INDICADORES DE CONDICIÓN FÍSICA RELACIONADA CON LA SALUD EN UNIVERSITARIOS QUE INICIAN Y TERMINAN SUS CARRERAS

    Directory of Open Access Journals (Sweden)

    Santiago Adolfo Arboleda Franco

    2015-08-01

    Full Text Available El presente estudio busca determinar y comparar algunos parámetros de la condición física relacionada a la salud (cfrs en universitarios que inician (ic y finalizan sus carreras (fc. Se hizo un estudio descriptivo de corte transversal con 280 jóvenes de ambos sexos. Se registró información sociodemográfica, estado de salud, talla, peso, índice de masa corporal (imc, adiposidad, flexibilidad isquiosural, potencia de miembros inferiores y aptitud cardiorrespiratoria (vo2 máx.. Se realizó estadística descriptiva, Prueba T para muestras independientes y prueba de Levene con una significancia p<0,05. La edad fue mayor para ambos sexos en el grupo fc. El 90,8% de la muestra total se autorreportó sana y el 38,3% refirió antecedentes familiares de ecnt en el primer grado de consanguinidad, principalmente hipertensión. Al comparar los grupos ic y fc divididos por sexo, hubo diferencias (p<0,05 para el peso, el imc, la adiposidad, el salto Abalakov y la vo máx. El cmj solo difirió en los varones. En todos los casos las diferencias fueron desfavorables para el grupo fc. No obstante, en toda la muestra el vo2 máx. comparado con estudios de referencia fue aceptable. Se concluye que el grupo fc tuvo menores valores de cfrs, quizás atribuibles al mayor promedio de edad. El vo2 máx. estimado contradice la tendencia general sobre cfrs en universitarios.

  19. Adaptaciones musculares relacionadas a áreas corporales que participan activamente en el vuelo de Anhima cornuta (Aves: Anseriformes, Anhimidae

    Directory of Open Access Journals (Sweden)

    Marcos Antonio Manzanares

    2013-04-01

    Full Text Available La forma y correspondencia entre la anatomía muscular y ósea revela en gran medida el hábito locomotor de cualquier ave. Las especies pertenecientes a la Familia Anhimidae son relevantes dentro de las Aves, debido a las adaptaciones óseas (y por lo tanto, musculares que presentan, como la pérdida de procesos uncinados, el desarrollo de espolones metarcapales, la extrema neumatización y el notable desarrollo de forámenes. Se analizaron anatómicamente y numéricamente (superficie de origen e inserción, longitud en reposo y masa los componentes musculares relacionados a las zonas de la columna vertebral, tronco, miembros y cinturas de tres ejemplares de Anhima cornutade distintos sexos y se compararon con lo estudiado en 4 ejemplares de especies relacionadas (Dendrocygna bicolory Dendrocygna viduata, Anatidae. El estudio reveló que en Anhima existe un gran desarrollo de los músculos intercostales e intervertebrales (torácicos y lumbares, evidenciando una adaptación a la ausencia de procesos uncinados. En Anhimaexisten fascículos proporcionalmente menos pesados y de menor tamaño que en Dendrocygna, indicando morfológicamente la ocurrencia de un vuelo menos desarrollado en el primero. Algunos tendones y fibras musculares metacarpales cuya inserción ocurre en el primer dígito en Dendrocygna, en Anhimase insertan en la base de los espolones proximal y distal, demostrando el poco control del vuelo en Anhima. La musculatura de los miembros posteriores en Anhimaes mucho más desarrollada, tanto en tamaño, como en masa proporcional, evidenciando una gran actividad en esta zona en la propulsión del vuelo y en hábitos terrestres

  20. Calidad de vida relacionada con la salud y obesidad en un centro de atención primaria

    Directory of Open Access Journals (Sweden)

    Barajas Gutiérrez Miguel Angel

    1998-01-01

    Full Text Available FUNDAMENTO. Evaluar la asociación entre la obesidad y dos aspectos de la calidad de vida relacionada con la salud: autopercepción de salud y bienestar psicológico en pacientes adscritos a un centro de salud. MÉTODOS. Estudio transversal descriptivo sobre 167 pacientes entre 20 y 70 años, con índice de masa corporal ³ 30. Se realizó entrevista clínica para la obtención de las variables sociodemográficas y clínicas de cada paciente y la administración de 2 cuestionarios: 1 Perfil de Salud de Nottingham (PSN y 2 Psychological General Well-Being (PGWB índex. RESULTADOS. Las puntuaciones medias del PSN indicaron un deterioro global moderado de la salud percibida en las pacientes obesas siendo las áreas afectadas "dolor", "movilidad física" y "reacciones emocionales". Las variables asociadas a una peor puntuación fueron el sexo femenino, la edad superior a 50 años, el bajo nivel de estudios y la presencia de patología psiquiátrica o artrosis. La puntuación total media del PGWB indica un deterioro pequeño del bienestar psicológico. El sexo femenino, la ansiedad y el bajo nivel de estudios se asociaron, asimismo, a peores puntuaciones. CONCLUSIONES. En nuestra población, se identifica un perfil de pacientes obesos con mala calidad de vida (mujeres de edad superior a 50 años con bajo nivel de estudios y presencia de patología psiquiátrica o artrosis sobre los que se plantea la conveniencia de realizar una actuación prioritaria.

  1. Qualidade de vida relacionada à saúde de filhos de profissionais da área de saúde

    Directory of Open Access Journals (Sweden)

    Silvia Maria Moussi Gamallo

    2012-12-01

    Full Text Available Neste estudo mensuramos a qualidade de vida relacionada à saúde (QVRS e a fadiga de filhos de profissionais da área da saúde, com idades entre 2 e 11 anos, e avaliamos os hábitos diários e o sono dessas crianças e dos respectivos pais. Foram incluídas no estudo crianças de uma escola pública. Dados demográficos e dados de hábitos diários foram colhidos. A QVRS, o sono e a fadiga foram mensurados por questionários. Participaram 249 pais - 63,5% referiram sono adequado e 47,4% acordavam cansados. A média da idade das crianças foi 5,6 anos - 62,2% assistiam televisão no quarto, 50% usavam computador (> 4 horas/dia e 27,8% faziam atividades físicas extracurriculares. O escore do sono foi de 45,8 ± 12,2. Os escores de QVRS foram mais elevados no aspecto físico e mais baixos no emocional. Detectamos que o sono de pior qualidade dos filhos e dos pais pode estar relacionado à pior QVRS dos filhos. Concluímos que os hábitos inadequados dos pais, bem como das crianças, estão relacionados a uma diminuição da QVRS dos filhos, especialmente no aspecto emocional.

  2. Complicações da cateterização arterial em crianças

    Directory of Open Access Journals (Sweden)

    Souza N. de

    2000-01-01

    Full Text Available A cateterização da artéria radial para fins de monitorização em crianças graves, vem sendo utilizado cada vez com maior freqüência em unidades de cuidados intensivos pediátricos e, muitas vezes, a sua presença é imprescindível, como nos casos de choque e pós-operatório de cirurgia cardíaca, entretanto há poucas publicações em nosso meio a respeito do assunto. OBJETIVO: Analisar as complicações da cateterização da artéria radial para fins de monitorização no pós-operatório de cirurgia cardíaca em crianças. MÉTODOS: Estudamos as complicações deste procedimento em 120 crianças em pós-operatório de cirurgia cardíaca, com idades entre um mês e dois anos. As crianças foram cateterizadas por punção percutânea (n = 67 e por dissecação (n = 63. Foram analisadas as seguintes complicações, em relação à técnica utilizada e ao tempo de permanência do cateter: infecção local, hemorragia, isquemia, obstrução do cateter e perda acidental do cateter. RESULTADOS: A presença de infecção, isquemia e hemorragia foram maiores e estatísticamente significantes nos pacientes submetidos à dissecção, enquanto que a obstrução e a perda acidental do cateter foram semelhantes em ambos os grupos. Todos os casos de infecção ocorreram após 72 horas da cateterização e a freqüência de hemorragia e isquemia foi maior nas primeiras 72 horas. CONCLUSÃO: As principais complicações deste procedimento estão relacionadas à técnica utilizada, ao tempo de permanência do cateter e às características do paciente.

  3. Neurobiologia da Cannabis: do sistema endocanabinoide aos transtornos por uso de Cannabis

    Directory of Open Access Journals (Sweden)

    José Luis G. Pinho Costa

    2011-01-01

    Full Text Available OBJETIVOS: Diante das lacunas na efetividade das terapêuticas para transtornos por uso de Cannabis, a droga ilícita mais consumida no mundo, este trabalho propõe-se a rever os conhecimentos sobre o substrato neuroanatômico, biomolecular e celular do sistema endocanabinoide, descrever os mecanismos de neuroplasticidade dependente dos canabinoides e relacioná-los com a neurobiologia dos transtornos por uso de Cannabis (abuso e dependência. MÉTODOS: Recorreu-se às bases de dados Medline, Scopus e ISI Web of Knowledge; as palavras-chave pesquisadas foram "Cannabis", "neurobiology", "endocannabinoid system", "endocannabinoids", "receptors, cannabinoid", "neuronal plasticity", "long-term synaptic depression", "long-term potentiation", "marijuana abuse" e "tetrahydrocannabinol". Foram incluídos 80 trabalhos nesta revisão. DISCUSSÃO: A distribuição neuroanatômica, celular e biomolecular do sistema endocanabinoide adequa-se perfeitamente às suas funções de neuromodulação (via neuroplasticidade e metaplasticidade, nomeadamente em vias relacionadas aos transtornos por uso de substâncias. Os canabinoides exógenos perturbam essas funções. CONCLUSÃO: O sistema endocanabinoide contribui para a definição de setpoints em diversas vias neuronais, incluindo vias cruciais na instalação de transtornos por uso de substâncias; com o uso de Cannabis, esses setpoints tornar-se-ão mais permissivos, facilitando os transtornos por uso de Cannabis. Os avanços no entendimento da neurobiologia da Cannabis abrem uma janela de oportunidades para novas estratégias terapêuticas nos transtornos por uso de Cannabis.

  4. Toxicologia do tolueno: aspectos relacionados ao abuso Toluene toxicology: abuse aspects

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônicoToluene, present in many industrial and domestic products, is the main solvent involved in solvent abuse and occupational exposure. The main problem in studying toluene-related pathologies is the fact that it is frequently combined with other substances. This review focuses on its potential toxicity. The following subjects are discussed: pharmacologic parameters; physico-chemical features; exposure; clinical trials; experimental research; diagnosis; tolerance and dependence; acute and chronic effects; neurotoxicity; teratogenicity; psychiatric disorders; carcinogenicity; and treatment. It is concluded that is important more research on larger population samples with a view to better definition of the consequences.of chronic use should be undertaken.

  5. Análisis de las hospitalizaciones por bacteriemia relacionada con el catéter de hemodiálisis

    Directory of Open Access Journals (Sweden)

    Cristina Carrasco Salinas

    Full Text Available El uso de catéteres venosos centrales para hemodiálisis se ha incrementado de tal forma, que actualmente en nuestro país, el 30%, de los pacientes son portadores de este acceso vascular. No obstante su duración es limitada y presentan con frecuencia complicaciones, como por ejemplo bacteriemias relacionadas con el catéter de hemodiálisis. Esta, es una complicación con elevada morbimortalidad en los pacientes en tratamiento renal sustitutivo crónico. El objetivo de este análisis fue conocer la incidencia de hospitalizaciones, identificar los gérmenes más frecuentemente relacionados en nuestra población y analizar los factores demográficos y clínicos asociados. Se realizó un estudio observacional prospectivo en el que se analizaron todos los ingresos por bacteriemia relacionada con el catéter de hemodiálisis durante el año 2011. Se recogieron los datos clínicos de los pacientes, demográficos y comorbilidad. El número total de ingresos por bacteriemias relacionadas con el catéter fue de 45 en 35 pacientes, con una edad media de 69.9 años. Los gérmenes más frecuentemente aislados fueron cocos gram positivos (Staphilococcus aureus mecitilin resistente y Staphilococcus aureus meticilin sensible. La mortalidad fue de 14% (5 pacientes. A la vista de nuestros resultados, podemos concluir que la bacteriemia relacionada con el catéter es una complicación grave en los pacientes en hemodiálisis. Representa casi el 50% de los ingresos durante 2011 de los pacientes en hemodiálisis. Está asociada con una elevada morbilidad y consumo de recursos.

  6. Acolhimento ao familiar da pessoa em sofrimento psíquico nos estudos de enfermagem

    Directory of Open Access Journals (Sweden)

    Cristiene Barbosa Lima

    2013-12-01

    Full Text Available Objetivo: Evidenciar o conhecimento publicado no campo da enfermagem sobre acolhimento aos familiares de pessoas em sofrimento psíquico nos serviços de saúde.Métodos: Revisão integrativa, realizada nos meses de junho e julho de 2012, nas bases de dados LILACS, BDENF, IBECS, MEDLINE e SciELO, com os descritores “saúde mental”, “acolhimento” e “família”. Atenderam à inclusão 14 textos, escritos por profissionais e acadêmicos de enfermagem, em idioma português, publicados entre 2007 e 2011. Os dados foram apresentados de forma sintética em quatro tabelas e uma figura, sendo analisados sob o referencial de acolhimento pela Política Nacional de Humanização. Resultados: Não se pode afirmar uma tendência relacionada a estudos sobre acolhimento. A maioria das publicações analisadas adota abordagem qualitativa e análise de conteúdo, sendo de evidência tipo III. Há predominância de pesquisas tendo como sujeitos profissionais de saúde, no entanto, a família e outros atores começam a ser envolvidos. Cuidar de modo análogo da família e da pessoa que sofre é destaque em todos os estudos analisados. Evidenciou-se necessidade de interação entre os serviços de saúde e a rede especializada em saúde mental, e de preparo da equipe para minimizar as dificuldades enfrentadas pela família. Conclusão: O acolhimento à família foi apontado com frequência como dispositivo facilitador da reabilitação. Há muito por fazer rumo ao seu acolhimento nos serviços de saúde, a fim de permitir que a família perceba que sua vida não é necessariamente a continuidade da dificuldade que o outro enfrenta.

  7. Prevalência de dor associada ao transporte de material escolar

    Directory of Open Access Journals (Sweden)

    Windsor Ramos da Silva Júnior

    2014-10-01

    Full Text Available http://dx.doi.org/10.5007/1980-0037.2014v16n6p680 O objetivo do trabalho foi verificar a prevalência de dor associada ao transporte de material escolar por estudantes universitários. Realizou-se pesquisa transversal, quantitativa, descritiva-analítica, na qual foram avaliados 373 estudantes universitários da Universidade Estadual da Paraíba, entre fevereiro e setembro de 2012. As informações foram coletadas através de questionário sobre dados sociodemográficos, acadêmicos, transporte do material escolar e presença de dor, sendo ainda realizada a medição de dados antropométricos e pesagem de todos os volumes transportados pelo indivíduo. Os dados foram analisados de forma descritiva e inferencial através do software SPSSÒ 17.0. Utilizou-se modelo de Regressão Logística Hierárquica Binária, pelo método Backward LR, no qual o poder de influência das variáveis preditoras – divididas em blocos – foi testado na presença de dor musculoesquelética. Constatou-se uma prevalência de dor de 82,84%, com média geral de 5,21 pontos na Escala Visual Analógica (EVA para avaliação de dor. Nas mulheres, a influência exercida pela massa relativa dos volumes sobre a presença de dor foi 45,1% maior que entre os homens (OR = 0,689; IC95% = 0,503 – 0,942 para cada 1% de incremento. O tempo de carga, por sua vez, aumentou em 22,9% a probabilidade da presença de dor, a cada 15 minutos decorridos (OR = 1,229; IC95% = 1,090 – 1,386. Verificou-se alta prevalência de dor relacionada ao transporte de material escolar e a influência preditora de variáveis como peso relativo da carga transportada e tempo de transporte desse material, especialmente nos indivíduos do sexo feminino.

  8. A percepção do usuário de habitação unifamiliar em relação ao sistema construtivo industrializado avaliação do grau de satisfação

    OpenAIRE

    Silva, Larissa Soriani Zanini Ribeiro Soares

    2013-01-01

    A avaliação do grau de satisfação dos usuários de edificações residenciais após a sua entrega aos moradores é de suma importância para o mercado imobiliário. Esta informação possibilita criar um banco de dados para nortear a tomada de decisão dos projetistas no desenvolvimento do projeto de um novo produto e/ou aprimoramento do mesmo. No caso da introdução de inovações tecnológicas aos processos construtivos - elemento chave para o aumento de produtividade - as informações relacionadas ao o ...

  9. Lesão de nervo cutâneo antebraquial lateral relacionada à venipuntura: o que saber?

    Directory of Open Access Journals (Sweden)

    Juan A. Ramos

    2014-04-01

    Full Text Available Justificativa e objetivos: a venipuntura é um dos procedimentos mais comuns na prática anestésica cotidiana. Embora geralmente inócuas, lesões de nervos periféricos com sequelas graves foram descritas após venipuntura. Apresentamos um caso de lesão de nervo cutâneo antebraquial lateral relacionada à venipuntura, juntamente com as informações de diagnóstico e prognóstico essenciais para a prática cotidiana. Relato de caso: paciente do sexo masculino, 27 anos, submetido à venipuntura de fossa antecubital direita, com uma agulha de calibre 20, para avaliação metabólica de rotina. O paciente sofreu uma dor aguda, tipo choque elétrico, que percorreu a face lateral do antebraço desde a fossa antecubital proximal até o pulso lateral direito e a base do polegar direito. Após 24 horas, o paciente ainda sentia a dor semelhante a choque elétrico que foi classificada como 8/10 no braço distal lateral direito, no pulso lateral direito e na base do polegar, acompanhada de parestesia. Fizemos uma revisão da literatura e o paciente recebeu orientação sobre os resultados publicados a respeito desse tipo de lesão. Durante o acompanhamento, o paciente relatou que a disestesia diminuiu cerca de 3-4 semanas após a lesão inicial e que não restou déficit neurológico. Conclusões: lesões de nervos periféricos foram descritas pós-venipuntura, mas a literatura é limitada. Os nervos da fossa antecubital estão classicamente localizados em um plano logo abaixo - e muito próximos - das veias, o que os torna susceptíveis a lesões durante a flebotomia; além disso, sabe-se que existe uma extensa variação anatômica, o que sugere que mesmo uma venipuntura satisfatória não traumática pode danificar diretamente esses nervos. O anestesiologista deve estar ciente dessa possível complicação e também do diagnóstico e prognóstico para orientar os pacientes de forma adequada, caso essa complicação ocorra.

  10. Factores asociados a calidad de vida relacionada con la salud de pacientes trasplantados de riñón

    Directory of Open Access Journals (Sweden)

    Carolina Pérez Blancas

    2015-09-01

    que los pacientes en HD y DP, pero peor que la de la población general. Estos resultados se muestran independientes del instrumento usado para medir la calidad de vida relacionada con la salud.

  11. Associação entre resiliência e qualidade de vida relacionada à saúde bucal em idosos

    Directory of Open Access Journals (Sweden)

    Maurício Fernando Nunes Teixeira

    2015-03-01

    Full Text Available OBJETIVO: Avaliar a associação entre resiliência e qualidade de vida relacionada à saúde bucal, por meio de uma abordagem hierárquica baseada em um modelo teórico conceitual em uma coorte de idosos do Rio Grande do Sul. MÉTODOS: Foi conduzido um estudo transversal aninhado a um estudo de coorte, em 2008. Foram avaliados 498 idosos de Carlos Barbosa, Rio Grande do Sul. As medidas avaliadas foram sociodemográficas, comportamentos de saúde, qualidade de vida relacionada à saúde bucal, medida pelo Oral Health Impact Profile (OHIP-14, Escala de Resiliência e CPOD. A associação entre o potencial de resiliência e os impactos na percepção de saúde bucal relacionados à qualidade de vida foi verificada por meio de regressão binomial negativa. Razões das médias (RM são apresentadas com seus intervalos de confiança de 95% (IC95%. RESULTADOS: Maiores médias do OHIP foram encontradas entre mulheres (6,7 ± 6,3; p = 0,011, moradores da zona rural (7,3 ± 6,7; p = 0,004 e solteiros (8,0 ± 6,3; p = 0,032. O modelo final da análise multivariada mostrou que ser morador da zona rural (RM = 1,32; IC95% 1,06 - 1,65 e casado (RM = 1,36; IC95% 1,07 - 1,72 foram variáveis independentemente associadas à qualidade de vida relacionada à saúde bucal. Não houve associação entre resiliência e qualidade de vida relacionada à saúde bucal. CONCLUSÃO: Os resultados sugerem que variáveis sociodemográficas estão associados à qualidade de vida relacionada à saúde bucal. A hipótese de que a resiliência pudesse exercer um papel importante no desfecho não foi confirmada.

  12. Substituição da agulha isolada para eletroneuroestimulação pela agulha metálica de cateter intravenoso, na verificação da punção epidural, em cães

    Directory of Open Access Journals (Sweden)

    E.A. Tudury

    2013-02-01

    Full Text Available Utilizou-se o eletroneuroestimulador como um meio adequado para confirmação do posicionamento da ponta de agulhas isoladas no espaço epidural lombossal, por meio de pequenas estimulações elétricas que provocam contrações dos músculos inervados, empregando-se agulha de cateter intravenoso em vez de agulha isolada para a eletroneuroestimulação. Foram utilizados 40 cães para procedimentos cirúrgicos ortopédicos, abdominais ou retroumbilicais que necessitassem de bloqueio epidural. Durante a introdução gradativa da agulha no canal vertebral lombossacral, estímulos elétricos de 1,5 a 0,5mA foram aplicados. Diante de contrações musculares em membros pélvicos, cauda e/ou ânus, as quais foram consideradas respostas condizentes com o correto posicionamento da agulha no espaço epidural, estimulando raízes da cauda equina, procedeu-se à administração da associação de lidocaína, bupivacaína e tramadol. Constatou-se a adequada anestesia epidural mediante relaxamento do esfíncter anal, ausência dos reflexos patelares e flexor e a analgesia na área cirúrgica abdominal. Conclui-se que o método foi eficaz para a confirmação do correto posicionamento da agulha no espaço epidural durante a realização dessa anestesia regional em cães.

  13. Síndrome da Má-adaptação ao trabalho em turnos: uma abordagem ergonômica

    Directory of Open Access Journals (Sweden)

    Gilsée Ivan Régis Filho

    2001-12-01

    Full Text Available O sistema de trabalho em turnos e noturno por ir contra a natureza humana, eminentemente diurna, traz prejuízos para a saúde do trabalhador tanto nos aspectos físicos e psíquicos, como emocionais e sociais. As manifestações agudas como insónia, excessiva sonolência durante o trabalho, distúrbios de humor, aumento de acidentes e problemas familiares e as manifestações crônicas como desordens do sono, doenças cardiovasculares e gastrointestinais, separação e divórcio, compõem os sinais e sintomas da Síndrome da Má-adaptação ao Trabalho em Turnos. O presente trabalho teve por objetivos analisar a Síndrome da Má-adaptação ao Trabalho em Turnos e o Trabalho Noturno e apresentar um estudo de caso onde através de questionários foram pesquisados aspectos de cronobiologia, variáveis biológicas e psicossociais relacionadas com o trabalho em turnos e noturno em uma empresa do setor cerâmico de Santa Catarina que utiliza o sistema de trabalho em turnos não rodiziantes. O estudo de caso revelou que em média 1 em cada 5 trabalhadores apresentaram pelo menos um dos sintomas de inadaptação ao trabalho em turnos e noturno e que pelo menos 10% dos trabalhadores manifestaram sintomatologia característica da Síndrome da Má-adaptação ao Trabalho em Turnos.The shiftwork and nightwork system, for going against human nature, wich is eminently a day one, harms a worker's health from a physical, psychic, emotional and social point of view. Acute manifestations such as isomnia, excessive s/eepness during work hours, changes of humor, increased rates of accidents and family problems, as well as chronic manifestations assleep disorders, cardiovascular and gastrointestinal diseases, separation and divorce, make up signs and symptoms of Shiftwork Maladaptation Syndrome. This work sought to investigate Shiftwork Maladaptation Syndrome, and to analyze Night Work. By means of questionnaires, chronobiology aspects, biological and

  14. Utilidade do Ultrassom intracardíaco no isolamento de veias pulmonares usando cateter-balão a laser Utilidad del ultrasonido intracardíaco en el aislamiento de venas pulmonares usando catéter-balón láser Utility of intracardiac ultrasound imaging to guide pulmonary vein ablation using laser balloon catheter

    Directory of Open Access Journals (Sweden)

    Luiz Leite

    2009-12-01

    Full Text Available FUNDAMENTO: O isolamento das veias pulmonares (IVP tem sido usado como endpoint para a ablação da fibrilação atrial (FA com cateter balão. OBJETIVO: Determinar a utilidade do ultrassom intracardíaco (USIC para guiar o IVP, usando cateter balão a laser. MÉTODOS: 59 VP foram ablacionadas em 27 cães. Imagens de Doppler foram usadas para identificar os vazamentos do fluxo sanguíneo entre a VP e o balão. Após cada liberação de energia, o cateter de mapeamento circular foi reposicionado para verificar se o isolamento tinha sido obtido. A posição de vazamento foi então correlacionada com a posição do gap no estudo patológico. A análise de regressão logística multivariada foi realizada. RESULTADOS: Cinquenta e nove VP foram submetidas à ablação. O tempo médio de energia liberada foi de 279±177 seg., o diâmetro médio do balão era de 23±3 mm, e o comprimento médio do balão era 25±4 mm. O isolamento completo foi obtido em 38/59 (64%, e foi significantemente mais comum sem vazamento: [30/38 (79% versus 8/23 (35%, pFUNDAMENTO: Se usó el aislamiento de las venas pulmonares (AVP como endpoint para la ablación de la fibrilación atrial (FA con catéter-balón. OBJETIVO: Determinar la utilidad del ultrasonido intracardíaco (USIC para guiar el AVP, usando catéter-balón láser. MÉTODOS: Se ablacionaron 59 VP en 27 perros. Se usaron imágenes de Doppler para identificar los derrames del flujo sanguíneo entre la VP y el balón. Tras cada liberación de energía, se reposicionó el catéter de mapeamiento circular para verificar si se obtuvo el aislamiento. Se correlaccionó, entonces, la posición del derrame con la posición del gap en el estudio patológico. Se realizó el análisis de regresión logística multivariada. RESULTADOS: Se sometieron 59 VP a la ablación. El tiempo promedio de energía liberada fue de 279±177 seg., el diámetro promedio del balón era de 23±3 mm, y la largura promedio del balón era 25±4 mm

  15. SCExAO: First Results and On-Sky Performance

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki

    2013-01-01

    We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.

  16. Calidad de vida relacionada con la salud en trabajadores sanitarios Health related quality of life in health workers

    Directory of Open Access Journals (Sweden)

    Paloma Burgos Díez

    2012-03-01

    Full Text Available El estado de bienestar en que vivimos en los países desarrollados hace que surja la necesidad de buscar herramientas que sean una imagen fiel del estado de salud de la población como es la medición de la calidad de vida relacionada con la salud. El objetivo de nuestro estudio es conocer la calidad de vida relacionada con la salud (CVRS de los trabajadores sanitarios como medida de su estado de salud. Para ello hemos realizado un estudio transversal, prospectivo y descriptivo de una muestra de 542 trabajadores seleccionada por muestreo sistemático. Como variable dependiente se evaluó la CVRS a través del cuestionario SF-36. Este cuestionario evalúa el estado de salud a través de 7 escalas (Función física, rol físico, salud general, vitalidad, función social, rol emocional y salud mental valoradas de 0 a 100 (siendo 100 el mejor valor y de dos dominios globales estandarizados para población general siendo su valor 50, (índice general de salud física e índice general de salud mental. Se tiene en cuenta la edad y el sexo para el análisis de los resultados. Los resultados más relevantes obtenidos son: Edad media 46 años (DE 10,4, 82% mujeres. Función física: 88.7 (Población general-PG-: 84.7; Rol físico: 86.5 (PG: 83.2; Dolor: 71.9 (PG: 79; Salud general: 70 (PG: 68.3; Vitalidad: 66.1 (PG: 66.9; Función social: 86.4 (PG: 90.1; Rol emocional: 87.8 (PG: 88.6; Salud mental: 72.6 (PG: 73. Índice global de salud física: 51.9; Índice global de salud mental: 49.8. Los valores encontrados tanto para las escalas de salud física como mental son ligeramente mejores que los establecidos para la población general para el mismo rango de edad y sexo, salvo en la escala de dolor.The welfare state in whom we live in the developed countries does that there arises the need to look for tools that are a faithful image of the health of the population such as it is the measurement of the quality of life related to the health. The aim of our

  17. Divergências em relação aos cuidados com o recém-nascido no centro obstétrico

    Directory of Open Access Journals (Sweden)

    Elizete Besen Müller

    2014-04-01

    Full Text Available O objetivo deste estudo foi conhecer as divergências relacionadas aos cuidados prestados ao recém-nascido no Centro Obstétrico de um hospital público, na ótica de enfermeiras. Métodos: Pesquisa qualitativa desenvolvida com enfermeiras no Centro Obstétrico de um hospital público. A coleta de dados ocorreu entre setembro/2011 e abril/2012, englobou depoimentos de entrevistas e oficinas. A análise seguiu as etapas de apreensão, síntese, teorização e transferência. Resultados: Originaram-se quatro categorias: compreensão dos cuidados com o recém-nascido; cuidado centrado no ser humano ou na técnica; ausência de rotina única para cuidar; estratégias para adequar o cuidado ao recém-nascido. As principais divergências referem-se à priorização dos cuidados, ora centrando-se na pessoa ora na técnica, e discordâncias relativas aos horários, materiais e técnicas adotadas na prática e na literatura, situações que podem interferir no cuidado e vínculo pais/recém-nascido. Para superar essas divergências sugeriu-se: capacitação/integração dos profissionais e construção coletiva de proposta de cuidados fundamentada nas boas práticas. Conclusão: O estudo ampliou conhecimento e gerou mudanças no cotidiano do cuidado.

  18. Acesso ao tratamento da diabetes na Bahia: por que se recorre ao judiciário?

    OpenAIRE

    Lisboa, Erick Soares

    2015-01-01

    A judicialização da saúde é um fenômeno importante, que tem motivado a realização de inúmeros estudos no país. A Constituição do país estabelece o direito de todos e o dever do Estado em prover acesso universal as ações e serviços de saúde. Ao longo dos 25 anos do SUS houve uma ampliação do acesso a medicamentos, e a cada ano, novos fármacos vem sendo lançados no Brasil pelas indústrias farmacêuticas. A judicialização do acesso a medicamentos tem causado impactos na estruturação, no financiam...

  19. Cateteres venosos centrais totalmente implantáveis para quimioterapia: experiência com 793 pacientes

    Directory of Open Access Journals (Sweden)

    Esmálio Barroso de Oliveira

    Full Text Available OBJETIVO: estudar retrospectivamente os resultados obtidos com a implantação de cateteres totalmente implantáveis em pacientes submetidos à quimioterapia. MÉTODOS: foram colocados 815 cateteres totalmente implantáveis em 793 pacientes submetidos ao regime de quimioterapia preferencialmente utilizando-se a veia cefálica direita. Foram avaliadas as complicações precoces e tardias. RESULTADOS: a análise retrospectiva mostrou duração média dos cateteres de 339 dias. Em 733 (90% cateteres não se observou nenhuma complicação. Entre as complicações precoces observamos um pneumotórax, um mau posicionamento de cateter, uma punção arterial, um sangramento, um hemotórax e hemomediastino e seis hematomas na loja de implantação. Entre as complicações tardias, ocorreram 35 infecções relacionadas ao cateter, dez infecções no sítio cirúrgico, seis obstruções e 20 tromboses. Foram retirados 236 cateteres, 35 devido às complicações e 201 por final de tratamento. CONCLUSÃO: os cateteres totalmente implantáveis para quimioterapia são meios seguros para a administração de substâncias, em vista do baixo número de complicações observadas neste estudo.

  20. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Law, Nicholas Michael; Baranec, Christoph; Morton, Timothy; Ziegler, Carl; Atkinson, Dani; Riddle, Reed

    2015-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets.We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys.Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss several KOIs of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are ``coincident multiple'' systems, with several transiting planets shared between the two stars. Finally, we will discuss and update the 98%-confidence evidence from our survey that third bodies in star/planet systems produce an excess of close-in giant planets.

  1. O acesso aos serviços de saúde por emigrantes brasileiros nos Estados Unidos

    Directory of Open Access Journals (Sweden)

    Norberto de Almeida Duarte

    2013-06-01

    Full Text Available A análise do atual contexto político e econômico existente nos EUA, que envolve o acesso e utilização de serviços de saúde pelos imigrantes, diz respeito aos mais de 20 milhões de indivíduos estrangeiros que residem naquele país e não possuem seguro de saúde. Essa população corresponde a 43,8% de 46 milhões de pessoas que não possuem cobertura de provedores privados de saúde nos EUA, sendo 10,5 milhões residentes sem a documentação exigida para viver no País. Para explorar as necessidades, o acesso e a utilização dos serviços de saúde americanos pelos emigrantes de Governador Valadares, MG, Brasil, o presente estudo entrevistou uma amostra de 14 emigrantes valadarenses selecionada por meio da técnica bola de neve. Foram elaboradas questões relacionadas à documentação, local de residência, profissões exercidas, necessidade, acesso e utilização de serviços de saúde. As informações recolhidas junto aos emigrantes residentes nos Estados de Massachusetts e Connecticut permitem afirmar a viabilidade do acesso e da utilização dos serviços de saúde subsidiados pelos governos federal e estaduais e de organizações não governamentais.

  2. Passagem ao ato e acting-out: duas respostas subjetivas

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2010-08-01

    Full Text Available O presente artigo delimita o conceito de passagem ao ato em relação ao acting-out e distingue as respostas subjetivas que envolvem. A partir das distinções propostas por Lacan entre eles com base no conceito de objeto a, busca-se situar o sujeito em ambas as modalidades de ato, com os objetivos de submeter à discussão clínica as passagens ao ato discretas e de interrogar o papel de suplência que supostamente desempenham. Para tal, são retomados dois fragmentos de casos de anorexia discutidos na literatura psicanalítica; no primeiro, o objeto ao qual o sujeito se identifica é circunscrito, enquanto no segundo, trata-se do objeto posto em cena pelo sujeito.

  3. Produtividade e qualidade de figos Roxo de Valinhos submetidos à fertirrigação e ao armazenamento refrigerado

    Directory of Open Access Journals (Sweden)

    Diniz Fronza

    2010-08-01

    Full Text Available A baixa produtividade de figos no Brasil geralmente está relacionada com as deficiências hídrica e nutricional. Este trabalho teve como objetivo avaliar o efeito da fertirrigação com doses de nitrogênio e potássio sobre a produtividade e qualidade dos figos do cultivar Roxo de Valinhos durante o armazenamento refrigerado. O experimento de campo foi realizado durante dois anos, e que no último ano os frutos foram armazenados na temperatura de 0,5 °C por 15 dias. Os tratamentos consistiram da combinação das doses de 150, 250, 350 e 450 kg ha-1 de nitrogênio (N e 150, 250 e 350 kg ha¹ de potássio (K fornecidas via fertirrigação. Segundo os resultados, doses de até 250 kg ha-1 de N e K na fertirrigação elevam a produtividade de figos Roxo de Valinhos, e estas doses conduzem a maior produtividade entre os tratamentos avaliados. A fertirrigação aumentou em 96,7% a produtividade de figos verdes e 49% a de figos maduros em comparação ao tratamento padrão. Os níveis de N, K e a forma de aplicação não influenciam a qualidade dos frutos durante o armazenamento refrigerado.

  4. A falta conceituada por Lacan: da coisa ao objeto a Lack conceived by Lacan: from the thing to object a

    Directory of Open Access Journals (Sweden)

    Vinicius Darriba

    2005-01-01

    Full Text Available Discute-se o modo como a falta é conceituada por Lacan em dois momentos: com a retomada da Coisa freudiana e com a introdução do objeto a. Tal esforço em conceituar a falta é associado à tentativa de Lacan de resgatar aquilo que se revelou central na experiência de Freud. À Coisa e ao objeto a são relacionadas duas formas distintas de se pensar a relação entre o conceito e a falta na psicanálise, determinantes do tipo de aproximação que se pode ter do que constitui a experiência analítica.This study describes the way lack is conceived by Lacan at two different levels: with the retrieval of the Freudian Thing and the introduction of Object a. Such effort to conceptualize lack is associated to Lacan's attempt of rescuing that which has revealed itself as central in Freud's experience. Two distinct ways of thinking the relationship between concept and lack in psychoanalysis are related to the Thing and Object a. Such forms of thinking are determining in the type of proximity one may have of what is at stake in the analytical experience.

  5. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF)

    OpenAIRE

    Audigé, L.; Slongo, T; Lutz, N.; Blumenthal, A.; Joeris, A

    2016-01-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more ...

  6. Calidad de vida relacionada con heridas crónicas Quality of life related with chronic wounds

    Directory of Open Access Journals (Sweden)

    Renata Virginia González-Consuegra

    2010-09-01

    Full Text Available El presente artículo hace una revisión bibliográfica que se inicia con un recorrido de la evolución del concepto de calidad de vida (CV y su aplicación en salud, el cual debe su importancia a la forma más amplia en que es concebido el estado de salud personal, al contener implícito el bienestar social, lo que ha generado el desarrollo de medidas que permiten captar la salud en sus dimensiones múltiples y también positivas, como las de salud percibida o de calidad de vida relacionada con la salud (CVRS. La medición de la CVRS ha mostrado su utilidad en la investigación, en la práctica clínica, en la evaluación de los servicios sanitarios y en salud pública, lo que permite -en gran medida- contribuir a mejorar la gestión del cuidado. Con el paso del tiempo y la evolución tecnológica, la esperanza de vida ha ido en aumento, con el consiguiente envejecimiento de la población, siendo frecuente la presencia de enfermedades crónicas y metabólicas que, en muchos casos, traen consigo la presencia de heridas crónicas (HC de difícil manejo, que afectan negativa y considerablemente la CVRS de la población mayor de 65 años, especialmente femenina. La literatura reciente, es profusa respecto a los diferentes instrumentos para la medición de CVRS, por lo que se hace necesario conocer de qué disponemos para poder hacer uso de las herramientas adecuadas, según la condición de salud de la persona, a fin de aproximarse a las necesidades reales de las personas a nuestro cuidado. La mayoría de las herramientas de medición de CVRS se han desarrollado en Europa y Estados Unidos, lo que exige que para ser utilizadas en poblaciones distintas a las de su origen se cumpla con la adaptación y validación respectiva, a fin de que sus resultados reflejen la percepción real de la población.This review begins with a background on the evolution of quality of life (QOL concept and its application in health care, which owes its importance, as

  7. Errores innatos del metabolismo de las purinas y otras enfermedades relacionadas Inborn purine metabolism errors and other related diseases

    Directory of Open Access Journals (Sweden)

    Jiovanna Contreras Roura

    2012-06-01

    Full Text Available Los errores innatos en el metabolismo de las purinas son trastornos hereditarios complejos de gran impacto clínico, que presentan síntomas variables de acuerdo con el tipo de enfermedad. Pueden presentarse problemas renales de origen desconocido, retardo mental con manifestaciones neurológicas, retardo del crecimiento, infecciones recurrentes, automutilación, inmunodeficiencias, anemia hemolítica inexplicable, artritis gotosa, historia familiar, consanguinidad y reacciones adversas a fármacos que son análogos de las purinas. Las investigaciones de estas enfermedades comienzan generalmente con la cuantificación del ácido úrico en suero y en orina, por ser el producto final del metabolismo de las purinas en humanos. La dieta y el consumo de medicamentos, entre otras condiciones patológicas, fisiológicas y clínicas, también pueden modificar los niveles de este compuesto. Esta revisión pretende divulgar información de los errores innatos en el metabolismo de las purinas, y facilitar la interpretación de los niveles del ácido úrico y otros marcadores bioquímicos útiles en el diagnóstico de estas enfermedades. Se incluyen tablas que relacionan estas enfermedades con los niveles de excreción de ácido úrico y otros marcadores bioquímicos, las enzimas alteradas, los síntomas clínicos, el modo de herencia y, en algunos casos, el tratamiento propuesto. Este trabajo nos permite afirmar que las variaciones en los niveles del ácido úrico y la presencia de otros marcadores bioquímicos en orina, constituyen una herramienta importante en la pesquisa de algunos errores innatos en el metabolismo de las purinas, así como de otras condiciones patológicas relacionadas.Inborn purine metabolism errors are complex inherited disorders of great clinical impact that present with variable symptoms according to the type of disease. It might occur renal problems of unknown origin, metal retardation with neurological manifestations, retarded

  8. Use of individual protection equipment by nursing professionals in endotracheal aspiration/O uso de equipamento de protecao individual por profissionais de enfermagem na aspiracao endotraqueal/El uso de equipamiento de proteccion individual por profe sionales de enfermeria en la aspiracion endotraqueal

    National Research Council Canada - National Science Library

    Frota, Oleci Pereira; MenisFerreira, Adriano; RolanLoureiro, Marisa Dias; Cheade, Maria de Fatima Meinberg; dos Reis, Maria Gorette

    2012-01-01

    ... do circuito respiratorio por meio da desconexao do ventilador mecanico da protese ventilatoria, e subsequente, a aspiracao com cateter de uso unico. No segundo, nao e necessario desconectar o paciente do ventilador, e o cateter de succao e de uso multiplo, podendo permanecer acoplado ao sistema por ate 24 horas, conforme o preco...

  9. Psychosocial and clinical predictors of retention in outpatient alcoholism treatment Preditores psicossociais e clínicos de retenção ao tratamento para alcoolismo

    Directory of Open Access Journals (Sweden)

    João Maria Corrêa Filho

    2012-12-01

    Full Text Available OBJECTIVE: One of the factors associated with low rates of compliance in the treatment for alcoholism seems to be the intensity of craving for alcohol. This study aimed to evaluate the associations between alcohol craving and biopsychosocial addiction model-related variables and to verify whether these variables could predict treatment retention. METHODS: The sample consisted of 257 male alcoholics who were enrolled in two different pharmacological trials conducted at the Universidade de São Paulo in Brazil. Based on four factors measured at baseline - biological (age, race, and family alcoholism, psychiatric (depression symptoms, social (financial and marital status, and addiction (craving intensity, severity of alcohol dependence, smoking status, drinking history, preferential beverage, daily intake of alcohol before treatment - direct logistic regression was performed to analyze these factors' influence on treatment retention after controlling for medication groups and AA attendance. RESULTS: Increasing age, participation in Alcoholics Anonymous groups, and beer preference among drinkers were independently associated with higher treatment retention. Conversely, higher scores for depression increased dropout rates. CONCLUSION: Health services should identify the treatment practices and therapists that improve retention. Information about patients' characteristics linked to dropouts should be studied to render treatment programs more responsive and attractive, combining pharmacological agents with more intensive and diversified psychosocial interventions.OBJETIVO: Um dos fatores associados com baixas taxas de adesão ao tratamento para alcoolismo parece ser a intensidade da fissura pelo álcool. Este estudo objetiva avaliar a associação entre a fissura pelo álcool e variáveis relacionadas ao modelo biopsicossocial de dependência, bem como verificar se estas variáveis prevêem retenção ao tratamento. MÉTODO: A amostra foi composta por

  10. Chuvas intensas relacionadas à erosão hídrica Intense rainfalls related to water erosion

    Directory of Open Access Journals (Sweden)

    Glenio G. Santos

    2010-02-01

    Full Text Available As características das precipitações que mais interferem no processo de erosão do solo são a intensidade, a duração e a frequência da precipitação e a sua erosividade. Sendo o solo um recurso de renovação lenta e podendo ser rapidamente degradado pela ação da erosão, torna-se fundamental o conhecimento da forma como a precipitação atua no ambiente no qual esteja inserido. Desta forma se facilitam o desenvolvimento de técnicas e tecnologias e o estabelecimento de ações para diagnosticar, avaliar e apresentar soluções aos problemas, tanto econômica como ambientalmente. Diversos trabalhos, incluindo resultados de pesquisas e desenvolvimento de modelos, têm correlacionado as características das precipitações no sentido de entender, prever e apresentar soluções ao problema erosivo. Neste sentido se buscou compilar alguns desses trabalhos, de modo a apresentar o "estado da arte" no que se refere a chuvas intensas, manejo do solo e erosão hídrica.The most important rainfall characteristics on erosion process are the relationship between intensity, duration and frequency of precipitation and its erosivity. As the soil is a slow renewal resource and can be quickly degraded by erosion, the knowledge about how the precipitation acts in the environment is fundamental. In this way, the development of techniques, technologies and the establishment of actions to diagnose, to evaluate and to present solutions to erosion problems is important both economically and environmentally. Many studies, including research results and development of models have correlated precipitations characteristics in order to understand, to predict and to present solutions for the erosion problem. In this sense, some of these studies were compiled with the purpose of presenting the "state of the art" with respect to precipitations, soil management and water erosion.

  11. Fatores associados à adesão ao tratamento de crianças e adolescentes com doenças reumáticas crônicas

    Directory of Open Access Journals (Sweden)

    Vanessa M. Bugni

    2012-12-01

    Full Text Available OBJETIVO: São vários os fatores que contribuem para a má adesão ao tratamento de crianças e adolescentes com doenças reumáticas crônicas, gerando piora da qualidade de vida e do prognóstico. Nosso objetivo foi avaliar as taxas de adesão ao tratamento e identificar os fatores socioeconômicos e clínicos associados. MÉTODOS: Foram incluídos 99 pacientes com artrite idiopática juvenil, lúpus eritematoso sistêmico, dermatomiosite ou esclerodermia juvenil. Todos os pacientes eram acompanhados no ambulatório de reumatologia pediátrica por um período mínimo de 6 meses. Para avaliação da adesão, foi aplicado aos cuidadores um questionário composto por três blocos: 1 dados demográficos, clínicos e laboratoriais; 2 adesão ao tratamento medicamentoso; e 3 comparecimento às consultas, realização de exames e utilização de órteses. Foi considerada má adesão, quando realizado valor menor ou igual a 80% do prescrito. RESULTADOS: Um total de 53% dos pacientes apresentou boa adesão ao tratamento global, observada quando o cuidador possuía união estável (p = 0,006; 20 pacientes (20,2% apresentaram má adesão ao tratamento medicamentoso, relacionada à utilização de mais que três medicamentos diários (p = 0,047. As causas de má adesão ao tratamento foram esquecimento, recusa, dose incorreta ou falta de medicamento, problemas pessoais e dificuldades financeiras. CONCLUSÕES: Observamos boa adesão ao tratamento global nos pacientes cujos cuidadores possuíam união estável e má adesão ao tratamento medicamentoso nos pacientes que utilizavam mais que três tipos de medicamentos diariamente. Não houve associação entre as taxas de adesão ao tratamento e sexo, idade, tempo de diagnóstico e atividade da doença.

  12. Calidad de vida en pacientes hipertensos relacionada con la salud y con variables clínicas y sociodemográficas.

    OpenAIRE

    Moreno Cano, Carlos

    2010-01-01

    Con este trabajo se pretende estudiar la relación entre la calidad de vida en pacientes con hipertensión arterial relacionada con la salud (CVRS) y con otras variables sociodemográficas y clínicas. Para ello, se realiza un estudio observacional descriptivo transversal en 434 pacientets hipertensos del Centro de Salud de Madrigueras núcleo (Albacete). Los instrumentos utilizados han sido, el cuestionario validado de CVRS, MINICHAL (formado por 16 ítems, 10 correspondientes a la dimensión...

  13. Cefalea tusígena, de esfuerzo y relacionada con la actividad sexual : descripción de una serie de 50 casos

    OpenAIRE

    Pérez Pérez, Jesús; Roig Arnall, Carles

    2012-01-01

    Las cefaleas tusígena, de esfuerzo y sexual son entidades infrecuentes y poco descritas. Hemos realizado un estudio retrospectivo de pacientes que consultaron durante 5 años por dicha patología en nuestro centro. De una muestra de 50 pacientes, 25 consultaron por cefalea tusigena, 15 por esfuerzo y 10 relacionadas con actividad sexual (74%, 80% y 80% de formas respectivamente). Las tres entidades podrían tratarse del espectro de una misma patología. Los principales elementos diferenciadores r...

  14. Variabilidad genética de la colección colombiana de lulo (solanum quitoense lam.) y especies relacionadas de la sección lasiocarpa.

    OpenAIRE

    Fory Sánchez, Paola Andrea; Sánchez Mosquera, Inés; Bohórquez Cháux, Adriana; Ramírez, Hernando; Medina Cano, Clara Inés; Lobo Arias, Mario

    2011-01-01

    Se realizó un estudio de la variabilidad genética de la colección colombiana de lulo Solanum quitoense Lam y especies relacionadas de la sección Lasiocarpa, por medio de marcadores AFLP, con el fin de conocer el polimorfismo y las afinidades entre materiales y taxa. Para tal fin se emplearon marcadores moleculares AFLP, y se hicieron análisis de conglomerados, con los cuales se construyeron dendrogramas a través del algoritmo UPGMA. Los marcadores empleados mostraron valor sistemático ya que ...

  15. El Cuestionario de Experiencias Relacionadas con los Videojuegos (CERV) : un instrumento para detectar el uso problemático de videojuegos en adolescentes españoles

    OpenAIRE

    Chamarro Lusar, Andrés

    2014-01-01

    El objetivo del presente estudio es validar el Cuestionario de Experiencias Relacionadas con los Videojuegos (CERV). El cuestionario consta de 17 ítems, desarrollados a partir del CERI de Beranuy y cols., y valora el uso problemático de los videojuegos no masivos. Se ha validado para adolescentes que cursan estudios de secundaria obligatoria. Para la validación se ha realizado un análisis factorial confirmatorio (AFC) y un análisis de consistencia interna. La estructura factorial muestra dos ...

  16. Fatores modificáveis da degeneração macular relacionada à idade Modifiable risk factors for age-related macular degeneration

    Directory of Open Access Journals (Sweden)

    Rogil José de Almeida Torres

    2009-06-01

    Full Text Available Os autores apresentam os principais fatores modificáveis considerados de risco para o desencadeamento e/ou agravamento da degeneração macular relacionada com a idade. São abordados os mecanismos de ação destes fatores, assim como medidas preventivas e eficácia de eventuais intervenções.The authors present the main modifiable risk factors that may trigger and/or worsen age-related macular degeneration. Mechanisms of action related to these factors as well as preventive measures and intervention effectiveness are discussed.

  17. Descripción de diferencias relacionadas con el razonamiento indutivo identificadas en la resolución de dos problemas

    OpenAIRE

    Cañadas, María C.; Castro, Encarnación; Castro, Enrique

    2009-01-01

    Presentamos algunos resultados de una investigación más amplia cuyo objetivo general es describir y caracterizar el razonamiento inductivo que utilizan estudiantes de 3¼ y 4¼ de ESO al resolver tareas relacionadas con sucesiones lineales y cuadráticas (Cañadas, 2007). Identificamos diferencias en el empleo de algunos de los pasos considerados para la descripción del razonamiento inductivo en la resolución de dos de los seis problemas planteados a los estudiantes. Describimos estas diferencias...

  18. Propuesta didáctica para potenciar el desarrollo de habilidades relacionadas con la comprensión lectora en adolescentes con síndrome de Down

    OpenAIRE

    Ramírez Salazar, Doris Adriana

    2004-01-01

    El propósito de este artículo es presentar una propuesta didáctica para desarrollar habilidades relacionadas con la comprensión lectora de textos expositivos en adolescentes con síndrome de Down, basada en los enfoques de Enseñanza Experimental y Modificabilidad Cognitiva, con y sin la incorporación de recursos hipermediales, derivada de un estudio investigativo. Los resultado obtenidos en esta investigación evidencian como la aplicación sistemática y secuencial de la propuesta didáctica dise...

  19. Prevalência de transtornos psiquiátricos e ansiedade relacionada à saúde em coronariopatas participantes de um programa de exercício supervisionado

    OpenAIRE

    Sardinha,Aline; Araújo,Claudio Gil Soares de; Adriana Cardoso de Oliveira e Silva; Nardi, Antonio Egidio

    2011-01-01

    CONTEXTO: Aspectos psicológicos como estresse e depressão já são reconhecidos como fatores de risco cardiovascular. Mais recentemente, o impacto da ansiedade passou a ser objeto de estudo. OBJETIVO: Identificar a prevalência de transtornos psiquiátricos e a presença de ansiedade relacionada à saúde e de ansiedade cardíaca em coronariopatas participantes de um programa de exercício supervisionado. MÉTODOS: Quarenta e dois homens coronariopatas foram entrevistados com o Mini International Neuro...

  20. Calidad de vida relacionada con la salud de los niños con parálisis cerebral infantil: grado de acuerdo entre hijos y padres

    OpenAIRE

    Gilabert Escorsa, Anna

    2016-01-01

    La qualitat de vida relacionada amb la salut (QVRS) en els nens amb paràlisi cerebral infantil (PCI) es pot veure afectada i les percepcions entre els nens i els seus pares poden variar. Els objectius generals d'aquest estudi han estat dos. El primer, mesurar la QVRS dels nens amb PCI i comparar-la amb la d'un grup control format per nens sense cap discapacitat. El segon, determinar el grau d'acord entre fills i pares. Com a objectius específics, es pretenen observar les diferències entre les...

  1. Cirugía de Rastelli: impacto adverso de la comunicación interventricular no relacionada con los grandes vasos en los resultados quirúrgicos

    Directory of Open Access Journals (Sweden)

    Horacio Capelli

    2010-01-01

    Full Text Available IntroducciónLa evolución de los pacientes operados con técnica de Rastelli revela que se trata de unprocedimiento quirúrgico complejo no exento de morbilidad y mortalidad a mediano y alargo plazos. Las complicaciones serían, aparentemente, más frecuentes cuando la comunicacióninterventricular (CIV es anatómicamente remota o no relacionada con la aorta.ObjetivoEvaluar el impacto de la localización anatómica de la CIV en la cirugía de Rastelli.Material y métodosSe incluyeron 47 pacientes con una media (X de seguimiento posquirúrgico de 6 años (15meses-14 años. Los pacientes se subdividieron en: grupo I, CIV relacionada con la aorta (n= 29 y grupo II, CIV remota o no relacionada (n = 18.ResultadosEn el posquirúrgico inmediato, las reoperaciones (p = 0,05 fueron más frecuentes en el grupoII, en el cual se observó también una tendencia a mayor frecuencia de arritmias (p = 0,06.Luego de una X = 3 años (1 día-13 años posquirúrgicos se realizaron 27 reoperaciones en22 pacientes.Se cerró CIV residual en 11 pacientes a una X = 1 mes. En 8 de ellos, la CIV era remota (p =0,007.Desarrollaron estenosis subaórtica que requirieron cirugía 6 pacientes a una X = 5 años.Se reemplazó el conducto ventrículo derecho-arteria pulmonar en 12 pacientes a una X = 5años.La mortalidad en el período posquirúrgico inmediato fue del 6% (3 pacientes.La mortalidad global fue del 17,2% (n = 8; 7 pacientes tenían CIV no relacionada (p = 0,003.ConclusionesLa CIV remota en la cirugía de Rastelli se asocia con: 1 mayor mortalidad, 2 mayor frecuenciade reoperaciones en el posquirúrgico inmediato y 3 tendencia a mayor frecuenciade arritmias en el posquirúrgico inmediato.

  2. Representaciones sociales relacionadas con la alimentación escolar: el caso de las escuelas públicas de la Ciudad de México

    OpenAIRE

    Florence L Théodore; Anabelle Bonvecchio Arenas; Ilian Blanco García; Yohani Carreto Rivera

    2011-01-01

    México está confrontando una epidemia de sobrepeso/obesidad sin precedentes, en particular entre los niños. El objetivo de este trabajo fue identificar las principales representaciones sociales relacionadas con la alimentación en la escuela, presentes en los discursos de los diferentes actores escolares. Se realizaron 20 entrevistas con actores escolares y 10 grupos de discusión con niños y niñas de 12 escuelas. Se identificaron tres principales concepciones, representaciones en las que estru...

  3. Nuevas metodologías con un enfoque interdisciplinar en la docencia de asignaturas relacionadas con la Tecnología de Alimentos

    OpenAIRE

    Callejo González, Maria Jesús; Gonzalez Chamorro, M. Carmen; Chaya Romero, Carolina; Rodríguez Badiola, Guillermo; Diaz Barcos, Virginia; Correa Hernando, Eva Cristina

    2009-01-01

    El objeto de este proyecto es compartir metodologías docentes y técnicas de evaluación desde un enfoque pluridisciplinar en la Universidad Politécnica de Madrid (U.P.M.), implicando a 6 asignaturas con un nexo común. Todas ellas están relacionadas con el procesado de alimentos en la Industria Agroalimentaria, desde la materia prima hasta el producto final. Para ello se recurre al empleo de metologías de distinta naturaleza, tanto presenciales como no presenciales. El aspecto más noved...

  4. A legislação brasileira e as recomendações internacionais sobre a exposição ocupacional aos agentes

    Directory of Open Access Journals (Sweden)

    Tanyse Galon

    Full Text Available Revisão bibliográfica cujo objetivo foi identificar a legislação brasileira relacionada à exposição ocupacional a material biológico entre os trabalhadores de saúde e compará-la com as principais recomendações da Organização Internacional do Trabalho (OIT e do Centers for Disease Control and Prevention (CDC. A busca de informações se deu por acesso aos sites do Ministério da Saúde, Ministério do Trabalho e Emprego, OIT e CDC. Os dados coletados foram categorizados em cinco temas para melhor compreensão e análise. Identifica-se que a legislação brasileira contempla grande parte das recomendações internacionais, porém a obrigatoriedade do fornecimento de dispositivos de segurança foi tardiamente incluída na legislação. Conclui-se que os trabalhadores precisam obter informações sobre seus direitos e deveres frente à exposição ao risco biológico

  5. A família e a prática de amamentação em bebês de baixo peso ao nascer

    Directory of Open Access Journals (Sweden)

    Laise Conceição Caetano

    2011-09-01

    Full Text Available Estudo prospectivo relativo ao acompanhamento de famílias em ambiente hospitalar e ambulatorial cujos bebês nasceram com baixo peso. Teve como objetivo de identificar fontes de apoio e conflito que influenciam o cuidado e a prática da amamentação, com base na estrutura das famílias e suas relações. Participaram do estudo 33 famílias com base no estudo do genograma, do ecomapa e das informações de protocolo estruturado. Utilizou-se como referencial teórico o Interacionismo Simbólico. Das famílias, 24,2% tinham conflito intrafamiliar e ausência de apoio para o cuidado e amamentação. Tal condição se relacionou com dificuldades maternas cujo motivo predominante foi a condição emocional. Com o apoio das famílias, 40% das nutrizes tiveram dificuldades relacionadas ao manejo da amamentação. A amamentação exclusiva foi possível pelo diagnóstico das condições familiares, bem como da condição de suporte encontrada. A identificação dos pontos vulneráveis e o atendimento das necessidades dos familiares devem fazer parte dos cuidados.

  6. Ventriculo-auriculostomia nos bloqueios ao trânsito do líquido cefalorraqueano na cisticercose encefálica

    Directory of Open Access Journals (Sweden)

    Gilberto M. Almeida

    1966-09-01

    Full Text Available São apresentados 16 casos de cisticercose encefálica com bloqueio ao trânsito do líquido cefalorraqueano, nos quais foi feita ventrículo-auriculostomia com válvula de Holter. Dos 16 pacientes, 5 faleceram, 10 estão vivos e sem sinais de hipertensão intracraniana e um não foi seguido. Considerando-se o prognóstico reservado da doença, principalmente quando existe hipertensão intracraniana, os resultados podem ser considerados bons. A derivação ventriculovenosa constitui, portanto, valioso método no tratamento da neurocisticercose com dilatação ventricular, causada por bloqueio ao trânsito do LCR. Algumas vêzes a má evolução do caso está relacionada à progressão da própria doença e não à falha no contrôle da hipertensão intracraniana.

  7. Intervenções de enfermagem aos pacientes com acidente vascular encefálico: uma revisão integrativa de literatura

    Directory of Open Access Journals (Sweden)

    Tahissa Frota Cavalcante

    2011-12-01

    Full Text Available O objetivo do estudo foi analisar o conhecimento sobre as intervenções de enfermagem aos pacientes hospitalizados por acidente vascular encefálico. Realizou-se uma revisão integrativa da literatura a partir de acesso on-line a cinco bases de dados, no mês de setembro de 2009. Utilizou-se os descritores Cuidados de Enfermagem e Acidente Cerebral Vascular nas línguas portuguesa, inglesa e espanhola. Foram encontrados 223 artigos e selecionados 12. Identificou-se nos artigos um maior número de intervenções de enfermagem assistenciais, seguidas das educacionais, gerenciais e de pesquisa. As do domínio assistencial estão mais relacionadas aos aspectos biológicos dos pacientes. Em relação às educativas, os artigos apontam o papel fundamental do enfermeiro, bem como dos familiares e dos cuidadores. A principal intervenção gerencial foi a coordenação dos cuidados. Quanto às intervenções de pesquisa foi identificada apenas uma descrita como o desenvolvimento e aprimoramento da prática de cuidados por meio de evidências clínicas.

  8. A legislação brasileira e as recomendações internacionais sobre a exposição ocupacional aos agentes

    Directory of Open Access Journals (Sweden)

    Tanyse Galon

    2011-02-01

    Full Text Available Revisão bibliográfica cujo objetivo foi identificar a legislação brasileira relacionada à exposição ocupacional a material biológico entre os trabalhadores de saúde e compará-la com as principais recomendações da Organização Internacional do Trabalho (OIT e do Centers for Disease Control and Prevention (CDC. A busca de informações se deu por acesso aos sites do Ministério da Saúde, Ministério do Trabalho e Emprego, OIT e CDC. Os dados coletados foram categorizados em cinco temas para melhor compreensão e análise. Identifica-se que a legislação brasileira contempla grande parte das recomendações internacionais, porém a obrigatoriedade do fornecimento de dispositivos de segurança foi tardiamente incluída na legislação. Conclui-se que os trabalhadores precisam obter informações sobre seus direitos e deveres frente à exposição ao risco biológico

  9. Sex inequalities in HIV-related practices in the Brazilian population aged 15 to 64 years old, 2008 Desigualdades por sexo nas práticas relacionadas à infecção pelo HIV na população brasileira de 15 a 64 anos, 2008

    Directory of Open Access Journals (Sweden)

    Ana Roberta Pati Pascom

    2011-01-01

    Full Text Available The objective of this study is to analyze gender differences in HIV-related practices in the Brazilian population. A national survey was carried out in 2008 with a sample size of 8,000 individuals aged 15-64 years old. The sampling was stratified by macro geographical region and urban/rural areas. Logistic regression models were used to investigate the main predictors of consistent condom use. The results showed that women have less sexy, start sexual life later than men, have fewer casual sexual partners, but use condom less frequently than men. On the other hand, the coverage of HIV testing is significantly greater among women. Significant differences by gender were seen in all HIV-related risky practices. The greater vulnerability was always associated with women, with exception of HIV testing. The low proportion of condom use in infidelity situations was a problem for box sexes and deserves special consideration when developing prevention strategies.O objetivo do trabalho foi analisar as diferenças por sexo nas práticas relacionadas à infecção pelo HIV na população brasileira. Inquérito de âmbito nacional foi realizado em 2008, com amostra de 8 mil indivíduos de 15-64 anos. A amostragem foi estratificada por macrorregião geográfica e situação urbano/rural. Utilizou-se modelo de regressão logística para investigar os principais fatores associados às práticas de sexo protegido. Os resultados indicaram que as mulheres têm menor taxa de atividade sexual, iniciam a vida sexual mais tardiamente, têm menos parceiros casuais do que os homens, mas usam menos o preservativo. Por outro lado, a cobertura de teste de HIV é significativamente maior entre as mulheres quando comparadas aos homens. Foram evidenciadas grandes diferenças por sexo nas práticas relacionadas à infecção pelo HIV, sempre com maior vulnerabilidade associada às mulheres, exceto no que diz respeito ao teste de HIV. O baixo uso de preservativo nas situa

  10. Fatores associados ao desperdício de recursos da saúde repassados pela união aos municípios auditados pela Controladoria Geral da União

    Directory of Open Access Journals (Sweden)

    Lidiane Nazaré da Silva Dias

    2013-12-01

    Full Text Available Este estudo trata dos fatores associados aos desperdícios ativo (corrupção e passivo (ineficiência que ocorrem no processo de gestão pública, aqui focado nos gastos com saúde pública. Buscando chamar a atenção para a ocorrência do desperdício passivo, a pesquisa investigou a seguinte questão: quais fatores de desperdício ativo e passivo estão associados com as irregularidades na gestão dos recursos repassados pela União aos municípios brasileiros para a área de saúde no ano de 2010? As evidências empíricas foram obtidas nos relatórios de auditoria da Controladoria Geral da União (CGU elaborados no ano de 2010 referentes a 102 municípios fiscalizados. Para a identificação do desperdício ativo foram observadas 3 variáveis e para o desperdício passivo 17 variáveis. Os dados relativos às variáveis foram submetidos a uma análise fatorial para agrupá-los em fatores associados estatisticamente com as irregularidades na gestão dos recursos destinados à saúde pública dos municípios auditados. Os resultados da pesquisa não mostraram nível adequado de significância para o desperdício ativo, enquanto que, para o desperdício passivo, evidenciaram três fatores denominados: Fator 1 Inadequabilidade Administrativa (o qual agrupou as variáveis: não pagamento de tributos, não ocorrência de contrapartida e má administração; Fator 2 Fraca Fiscalização (o qual agrupou as variáveis: inexistência ou fraca atuação do conselho e licitação fracionamento; e Fator 3 Baixo nível de Compliance (o qual agrupou as variáveis: licitação irregular e irregularidade não relacionada ao Prefeito. A principal conclusão da pesquisa relaciona-se à identificação da necessidade da implantação de mecanismos de governança no setor público, os quais poderiam reduzir o desperdício ativo e passivo.

  11. Characterizing and mitigating vibrations for SCExAO

    Science.gov (United States)

    Lozi, Julien; Guyon, Olivier; Jovanovic, Nemanja; Singh, Garima; Goebel, Sean; Norris, Barnaby; Okita, Hirofumi

    2016-07-01

    The Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) instrument, under development for the Subaru Telescope, has currently the fastest on-sky wavefront control loop, with a pyramid wavefront sensor running at 3.5 kHz. But even at that speed, we are still limited by low-frequency vibrations. The current main limitation was found to be vibrations attributed mainly to the rotation of the telescope. Using the fast wavefront sensors, cameras and accelerometers, we managed to identify the origin of most of the vibrations degrading our performance. Low-frequency vibrations are coming from the telescope drive in azimuth and elevation, as well as the elevation encoders when the target is at transit. Other vibrations were found at higher frequency coming from the image rotator inside Subaru's adaptive optics facility AO188. Different approaches are being implemented to take care of these issues. The PID control of the image rotator has been tuned to reduce their high-frequency contribution. We are working with the telescope team to tune the motor drives and reduce the impact of the elevation encoder. A Linear Quadratic Gaussian controller (LQG, or Kalman filter) is also being implemented inside SCExAO to control these vibrations. These solutions will not only improve significantly SCExAOs performance, but will also help all the other instruments on the Subaru Telescope, especially the ones behind AO188. Ultimately, this study will also help the development of the TMT, as these two telescopes share very similar drives.

  12. Alternativas terapêuticas para o tratamento da degeneração macular relacionada à idade: um desafio para a saúde pública

    Directory of Open Access Journals (Sweden)

    Humberto Cenci Guimarães

    2013-12-01

    Full Text Available A degeneração macular relacionada à idade (DMRI é uma das maiores causas de redução da capacidade laborativa, devida à perda da visão central e evolução para cegueira legal, impossibilitando inclusive atividades básicas como ler, escrever, cozinhar, dirigir e reconhecer a fisionomia de pessoas. A incidência desta doença vem aumentando significativamente nos últimos anos e são muitas as dúvidas sobre a escolha do tratamento mais adequado. O objetivo desta revisão é apresentar a fisiopatologia da DMRI e discutir as dificuldades do tratamento desta doença, relacionadas principalmente às vias de administração de fármacos e à escolha do procedimento clínico. Neste contexto, o uso da terapia antiangiogênica na DMRI parece ser, atualmente, o tratamento mais eficaz, devido a sua alta especificidade, pois atua de forma direta no desequilíbrio entre os fatores pró e antiangiogênicos. Entretanto, com base nas evidências atuais, o grande desafio para a saúde pública ainda está na prevenção desta doença e em seu diagnostico precoce.

  13. QUALIDADE DE VIDA RELACIONADA À SAÚDE E EXPECTATIVAS COM O TRATAMENTO CIRÚRGICO DE PACIENTES COM ESTENOSE ESPINHAL

    Directory of Open Access Journals (Sweden)

    Eliane Nepomuceno

    2016-01-01

    Full Text Available Estudio analítico, trasversal para comparar la calidad de vida relacionada a la salud, presencia de síntomas de ansiedad y depresión y limitación funcional según el local de la estenosis espinal; y describir las expectativas de los pacientes ante el tratamiento quirúrgico. Participaron 32 pacientes con estenosis lumbar y 22 con estenosis cervical. En la comparación de la calidad de vida relacionada a la salud, constatamos diferencias estadísticamente significantes en los dominios Dolor y Capacidad funcional. No fueron encontradas diferencias estadísticamente significantes en los síntomas de ansiedad y depresión. El promedio de la limitación funcional fue 53,2% (DE=11,9% para el grupo con estenosis lumbar y 40,2% (DE=17,5% para estenosis cervical. La mayoría esperaba gran mejora de los síntomas después del tratamiento quirúrgico. En el preoperatorio, las expectativas de mejora son altas y deben ser discutidas con el equipo de salud, ya que esa mejora ni siempre es alcanzada en la clínica con el tratamiento quirúrgico.

  14. Qualidade de vida relacionada à saúde de pacientes com câncer em tratamento radioterápico

    Directory of Open Access Journals (Sweden)

    Juliana Maria de Paula

    2015-01-01

    Full Text Available estudio prospectivo, con objetivo de evaluar la calidad de vida relacionada con la salud de pacientes con cáncer de cabeza y cuello durante el tratamiento de radioterapia. Método: se realizó con 41 pacientes entre 2009-2011 en dos centros de radioterapia. Se utilizó el instrumento Functional Assessment Cancer Therapy Head and Neck. El predominio de los casos fue del sexo masculino, con edad media de 62 años. Resultados: de los 5 dominios evaluados, lo más afectado fue “bienestar físico”, directamente relacionado con los efectos secundarios del tratamiento. Conclusión: los síntomas ocasionados por el tratamiento interfieren negativamente en la Calidad de Vida relacionada con la salud, por lo tanto, es importante que el equipo de atención de la salud evalúe e identifique las necesidades del paciente, lo que permite tener seguimiento que responda a sus necesidades y reduzca al mínimo los síntomas.

  15. A exposição ao risco das familias

    OpenAIRE

    dos Santos Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  16. Mortalidade relacionada à asma no Município do Rio de Janeiro, Brasil, no período de 2000-2009: análise de causas múltiplas Mortalidad relacionada con el asma en el Municipio de Río de Janeiro, Brasil, durante el período de 2000-2009: análisis de causas múltiples Asthma-related mortality in the city of Rio de Janeiro, Brazil, 2000-2009: a multicausal analysis

    Directory of Open Access Journals (Sweden)

    Gulnar Azevedo e Silva

    2013-04-01

    Full Text Available O estudo das causas múltiplas de óbitos permite conhecer a extensão real das estatísticas de mortalidade. O objetivo desta pesquisa foi avaliar a tendência das taxas de mortalidade relacionada à asma, no Município do Rio de Janeiro, Brasil, no período de 2000-2009, com dados obtidos no Sistema de Informações de Mortalidade (SIM, de indivíduos com um ano ou mais de idade, em que a asma foi mencionada em qualquer linha ou parte do atestado médico da declaração de óbito. Para análise de dados foi utilizada a técnica de regressão linear. A série histórica mostrou tendência ao declínio nas taxas de mortalidade padronizadas relacionada à asma como causa básica e múltipla, com redução entre os homens e estabilidade entre as mulheres. Quando a asma foi a causa básica, as causas associadas mais frequentes foram doenças do aparelho respiratório. A mortalidade relacionada à asma foi subestimada quando considerada apenas como causa básica, o que poderia ser evitado com a utilização da metodologia de causas múltiplas nas estatísticas de mortalidade por asma.El estudio de las causas múltiples de óbitos permite conocer la extensión real de las estadísticas de mortalidad. El objetivo de esta investigación fue evaluar la tendencia de las tasas de mortalidad, relacionada con el asma, en el municipio de Río de Janeiro, Brasil, en el período de 2000-2009, con los datos obtenidos en el Sistema de Información de Mortalidad (SIM, de individuos con un año o más de edad, en quienes el asma fue mencionada en cualquier línea o parte del certificado médico de defunción. Para el análisis de datos fue utilizada la técnica de regresión lineal. La serie histórica mostró una tendencia al declive en las tasas de mortalidad estandarizadas, relacionada con el asma como causa básica y múltiple, con reducción entre los hombres y estabilidad entre las mujeres. Cuando el asma fue la causa básica, las razones asociadas m

  17. Resistência ao clopidogrel: prevalência e variáveis associadas Resistance to clopidogrel: prevalence and associate variables

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    2012-01-01

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.BACKGROUND: The dual antiplatelet therapy with acetylsalicylic acid (ASA and clopidogrel is the cornerstone of

  18. Resistência ao clopidogrel: prevalência e variáveis associadas Resistance to clopidogrel: prevalence and associate variables

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    2012-12-01

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.BACKGROUND: The dual antiplatelet therapy with acetylsalicylic acid (ASA and clopidogrel is the cornerstone of

  19. Adesão ao tratamento da ambliopia

    OpenAIRE

    Arakaki Mara Regina; Schellini Silvana Artioli; Heimbeck Felipe Jorge; Furuya Margareth Tiemi; Padovani Carlos Roberto

    2004-01-01

    OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...

  20. High-Performance CCSDS AOS Protocol Implementation in FPGA

    Science.gov (United States)

    Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson

    2010-01-01

    The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.

  1. Do teatro grego ao teatro romano de Lisboa

    OpenAIRE

    Maciel, Manuel Justino

    2006-01-01

    A tipologia do teatro nasceu na Grécia e foi apropriada por Roma, com alterações significativas que constituem instrumento importante da investigação em História da Arte. Assim acontece com o teatro romano de Lisboa que, foi construído “ao modo grego”. Parece evidente que o Teatro foi adaptado para “espectáculos aquáticos”, embora o aprofundamento da reflexão exija a continuação de trabalhos arqueológicos, sob a Rua de São Mamede ao Caldas.

  2. Abuso sexual: um trajeto da fantasia ao real

    OpenAIRE

    Malgarim, Bibiana Godoi

    2015-01-01

    O presente trabalho visou apresentar a Dissertação de Mestrado realizada junto ao Programa de Pós-Graduação de Psicologia da Universidade do Vale do Rio dos Sinos, cujo título é Abuso Sexual: Um trajeto da fantasia ao real. O objetivo desta pesquisa foi compreender e interpretar a dinâmica das representações das relações objetais de duas pré-adolescentes encaminhadas por suspeita de abuso sexual, através de métodos projetivos, como o Rorschach e o HTP.

  3. Fatores associados ao consumo de álcool e drogas entre estudantes universitários

    Directory of Open Access Journals (Sweden)

    Silva Leonardo V E Rueda

    2006-01-01

    Full Text Available OBJETIVO: Estudos recentes mostram o uso preocupante de álcool e drogas entre universitários. O objetivo do trabalho foi verificar o grau de associação entre o estilo de vida e situação socioeconômica e o uso de álcool, tabaco, medicamentos e "drogas ilícitas" nos últimos 12 meses entre universitários. MÉTODOS: A amostra compreendeu 926 alunos da área de Ciências Biológicas de uma universidade do Município de São Paulo, os quais responderam a questionário anônimo e de auto-preenchimento em 2000 e 2001. Foram utilizados os testes de análise de variância e qui-quadrado para verificar a correlação entre o uso de substâncias e as variáveis estudadas. RESULTADOS: Entre os alunos com alguma religião, o consumo de álcool foi de 83,1%, o de tabaco, 20,7% e o de "drogas ilícitas", 24,6%, nesse período. Entre os alunos que não possuíam religião, o consumo nas três categorias foi superior nos últimos 12 meses: álcool (89,3%, tabaco (27,7% e "drogas ilícitas" (37,7%. A renda familiar mensal mostrou-se relacionada ao uso de álcool e "drogas ilícitas" (p<0,001 para ambos. Os alunos que utilizaram tabaco e "drogas ilícitas" apresentavam mais horas livres nos dias úteis do que os alunos que não fumavam no período analisado (p=0,033 e p=0,008, respectivamente. CONCLUSÕES: O consumo de substâncias psicoativas entre os alunos estudados foi comum, indicando a necessidade de implementação de medidas para reduzir tal consumo. Alunos com renda familiar alta e sem religião podem ser considerados com maior risco de consumo de drogas nessa população.

  4. Fatores associados ao consumo de álcool e drogas entre estudantes universitários

    Directory of Open Access Journals (Sweden)

    Leonardo V E Rueda Silva

    2006-04-01

    Full Text Available OBJETIVO: Estudos recentes mostram o uso preocupante de álcool e drogas entre universitários. O objetivo do trabalho foi verificar o grau de associação entre o estilo de vida e situação socioeconômica e o uso de álcool, tabaco, medicamentos e "drogas ilícitas" nos últimos 12 meses entre universitários. MÉTODOS: A amostra compreendeu 926 alunos da área de Ciências Biológicas de uma universidade do Município de São Paulo, os quais responderam a questionário anônimo e de auto-preenchimento em 2000 e 2001. Foram utilizados os testes de análise de variância e qui-quadrado para verificar a correlação entre o uso de substâncias e as variáveis estudadas. RESULTADOS: Entre os alunos com alguma religião, o consumo de álcool foi de 83,1%, o de tabaco, 20,7% e o de "drogas ilícitas", 24,6%, nesse período. Entre os alunos que não possuíam religião, o consumo nas três categorias foi superior nos últimos 12 meses: álcool (89,3%, tabaco (27,7% e "drogas ilícitas" (37,7%. A renda familiar mensal mostrou-se relacionada ao uso de álcool e "drogas ilícitas" (p<0,001 para ambos. Os alunos que utilizaram tabaco e "drogas ilícitas" apresentavam mais horas livres nos dias úteis do que os alunos que não fumavam no período analisado (p=0,033 e p=0,008, respectivamente. CONCLUSÕES: O consumo de substâncias psicoativas entre os alunos estudados foi comum, indicando a necessidade de implementação de medidas para reduzir tal consumo. Alunos com renda familiar alta e sem religião podem ser considerados com maior risco de consumo de drogas nessa população.

  5. Relações da anatomia radicular na absorção, no acúmulo e na tolerância ao chumbo em Echinodorus grandiflorus

    Directory of Open Access Journals (Sweden)

    Estefânia S. Ribeiro

    2015-06-01

    Full Text Available RESUMO A contaminação por chumbo (Pb é uma preocupação crescente em todo o mundo uma vez que os ambientes aquáticos são sujeitos sobretudo a inúmeras fontes de poluição. Este trabalho teve, como objetivo, avaliar a tolerância de E. grandiflorus ao Pb e sua capacidade de acumular e alocar o poluente e a relação dessas características com a anatomia radicular. Foram montados experimentos com plantas de E. grandiflorus expostas às seguintes concentrações de Pb em solução nutritiva: [0; 0,75; 1,5; 3,0 e 9,0 μM de Pb(NO32]. As plantas foram mantidas nessas condições, durante 60 dias. Avaliaram-se, ao final do experimento, a concentração de chumbo na biomassa das plantas e as modificações na anatomia radicular. As plantas de E. grandiflorus acumularam 113,74 mg Pb kg-1 de matéria seca com translocação reduzida para a parte aérea. As modificações no xilema radicular demonstraram aumento na capacidade de condução de água e nutrientes nas plantas expostas ao Pb. Constatou-se espessamento da exoderme e do córtex radicular; é provável que essas modificações estejam relacionadas com a maior alocação de Pb nas raízes. As plantas de Echinodorus grandiflorus são capazes de absorver e acumular Pb principalmente nas raízes; esta absorção é, por outro lado, modulada pela anatomia radicular.

  6. RESPOSTAS MORFODINÂMICAS E FISIOGRÁFICAS DA ZONA COSTEIRA AO NORTE DA BACIA DE CAMPOS FRENTE À EVENTOS DE TEMPESTADE

    Directory of Open Access Journals (Sweden)

    Mayte Gomes Ribeiro

    2017-01-01

    Full Text Available As barreiras arenosas no litoral norte fluminense estão distribuídas com tipologias e orientações distintas, relativas às principais direções de incidência de ondas oceânicas atuantes no litoral fluminense. A capacidade de resiliência destas feições quando submetidas a eventos de ondas de tempestade está associada ao estoque pretérito de sedimentos. O objetivo é a avaliação da vulnerabilidade física da zona costeira norte da Bacia de Campos, sob o ponto de vista dos impactos de ondas de tempestade na dinâmica de praia, envolvendo erosão costeira e transporte de sedimentos. Simulações de ondas extremas para a Bacia de Campos permitiram avaliar o comportamento ao longo de pontos selecionados. Dados morfológicos permitiram identificar áreas mais ou menos vulneráveis à erosão costeira. Áreas mais vulneráveis estão relacionadas ao déficit de sedimentos induzidos por transporte longitudinal e aonde a barreira arenosa se eleva a cotas inferiores a 3 metros. Áreas menos vulneráveis são as áreas de progradação da barreira arenosa pela incorporação atual de sedimentos. A posição sul do município de São João da Barra recebe as maiores ondulações independente das direções de propagação e o município de São Francisco de Itabapoana é protegido das ondulações mais fortes em função do aspecto embaiado da linha de costa.

  7. Avaliação da qualidade de vida relacionada à visão em crianças com catarata congênita bilateral Assessing vision-related quality of life in children with bilateral congenital cataracts

    Directory of Open Access Journals (Sweden)

    Marcia Caires Bestilleiro Lopes

    2009-08-01

    Full Text Available OBJETIVO: Avaliar a qualidade de vida relacionada à visão em crianças com catarata congênita bilateral, utilizando o Questionário de Função Visual Infantil (QFVI. MÉTODOS: O QFVI possui duas diferentes apresentações: crianças menores e maiores de 3 anos, sendo dividido em seis domínios: saúde geral, saúde geral da visão, competência, personalidade, impacto familiar e tratamento. O QFVI foi aplicado aos pais/cuidadores/responsáveis de crianças com catarata congênita bilateral do Instituto da Visão da Universidade Federal de São Paulo. As notas encontradas nos domínios foram comparadas entre os grupos controle - crianças com visão normal (n=32, média da idade=38 meses; dp=17,3 e experimental - crianças com catarata congênita (menores de 3 anos, n=19, idade média=14,6 meses; dp=10,7 e maiores de 3 anos, n=18, idade média=4,4 anos; dp=1,5, alocados segundo o grau de comprometimento visual em n=16 - sem deficiência visual; n=10 - deficiência visual leve; n=11 - deficiência visual grave. Para a análise estatística foram utilizados os testes t e análise de variância (ANOVA. RESULTADOS: O grupo experimental apresentou redução estatisticamente significativa em todos os domínios do questionário, quando comparado ao grupo controle. O domínio competência apresentou-se com baixa nota havendo redução estatisticamente significante de acordo com a gravidade da deficiência visual (ANOVA F 5,1, p=0,01; teste de Tukey pPURPOSE: To assess vision-related quality of life in children with bilateral congenital cataracts, using the recently developed Children's Visual Function Questionnaire (CVFQ. METHODS: CVFQ has two presentations, one for children under 3 years of age and the other for older children, and is divided in six subscales - general health; general vision; competence; personality; family impact and treatment. From those, a composite score can also be calculated. The CVFQ was applied in the hospital setting to

  8. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  9. Reptiles and Amphibians of Curaçao

    NARCIS (Netherlands)

    Rooij, de Nelly

    1922-01-01

    The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles

  10. Variability in olecranon AO fracture fixation: A radiological study ...

    African Journals Online (AJOL)

    Background: Tension Band Wire(TBW) fixation of olecranon fracture is a commonly used technique by orthopaedic surgeons. However surgeons do not strictly adhere to the AO standard. Objectives: To determine the use and variability of this technique by surgeons at the hospital. Design: A hospital based retrospective ...

  11. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  12. The Foraminifera of Piscadera Bay, Curaçao

    NARCIS (Netherlands)

    Hofker, J.

    1971-01-01

    Piscadera Bay is situated 4 km West of Willemstad, Curaçao, between two limestone hills which have a height of about 100 m. It is a drowned river system, the entrance of which is almost completely blocked by a bar of coral debris reaching to about 2 meters above sea level. The following parts may be

  13. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for

  14. A Internet das Coisas aplicada ao conceito de eficiência energética: uma análise quantitativo-qualitativa do estado da arte da literatura

    Directory of Open Access Journals (Sweden)

    Arildo Antônio Sônego

    2017-01-01

    Full Text Available Introdução: A Internet das Coisas corresponde a um novo paradigma, que imputa aos objetos a capacidade de disponibilizar informações a respeito de seu funcionamento e ao ambiente no qual tais objetos estão inseridos, caracterizando-se como abrangentes e diversificados os universos de prováveis aplicações a ela relacionadas. Em uma época em que se evidenciam ações e discussões dedicadas à sustentabilidade e ao meio ambiente, este artigo objetiva apurar o estado atual das pesquisas envolvendo a Internet das Coisas associado ao conceito de “eficiência energética”. Método: Tendo como referência a base de dados Scopus procedeu-se uma revisão sistemática da literatura, acompanhada de uma análise quantitativo-qualitativa. Foram aferidas informações no período compreendido entre os anos de 2001 a 2016, além da análise das cinquenta publicações com maiores citações. Resultados: Constatou-se a existência de 895 documentos relacionados aos assuntos pesquisados. Contudo, poucos (foram identificados sete documentos discorrem sobre a efetiva aplicação da Internet das Coisas à “eficiência energética”. Conclusão: Além de se determinar o estado da arte das pesquisas a nível mundial dos temas propostos, foi possível ratificar os conceitos a eles associados, bem como identificar as publicações mais relevantes, para que possam servir de referência e ponto de partida a outros trabalhos do gênero.

  15. Rol de la evidencia científica en las políticas publicas relacionadas con los sistemas de salud.

    OpenAIRE

    Patiño, Daniel; Lavis, John N; Moat, Kaelan

    2013-01-01

    Existen diferentes modelos para explicar cómo la evidencia de la investigación se utiliza en los procesos de formulación de políticas sobre los sistemas de salud. En este artículo argumentamos que los modelos que se desarrollaron desde el contexto clínico, como el de políticas basadas en la evidencia, pueden ser útiles en algunas decisiones políticas. Sin embargo, debido a su “silencio” sobre el contexto político, estos modelos son incompatibles con las decisiones relacionadas con la modifica...

  16. Hemocultivos simultáneos y diagnóstico de sepsis relacionada a catéter Simultaneous haemocultures and diagnosis of catheter-related sepsis

    OpenAIRE

    G. González-Ávila; H. Bello-Villalobos

    2004-01-01

    Objetivo: determinar el valor diagnóstico de hemocultivos simultáneos. Antecedentes: El criterio clínico no es suficiente para establecer el diagnóstico de infección relacionada a catéter y en retiro por sospecha o el recambio rutinario no son prácticas recomendadas. Sujetos: Se evalúan 164 catéteres empleados para nutrición endovenosa colocados en 127 pacientes con cáncer, a quienes se les tomó una muestra simultánea de sangre a través del catéter y una vena periférica cuando existía sospech...

  17. Las imágenes relacionadas con el medio natural en los libros de texto de Educación Física

    OpenAIRE

    Moya-Mata, Irene; Ros, Concepción; Menescardi, Cristina

    2013-01-01

    El objetivo de esta investigación es analizar las imágenes relacionadas con el Medio Natural, en los libros de texto de Educación Física (EF) en la etapa de Educación Primaria (EP) y su relación con los bloques de contenido en dicho currículo. Se realiza un análisis descriptivo de 53 imágenes, pertenecientes a nueve libros de texto de EF publicados por seis editoriales diferentes (Anaya, Bruño, Inde, Paidotribo, Santillana y Serbal), a partir de la LOE. El análisis de contenido se llevó a cab...

  18. Calidad de vida relacionada con la salud infantil y el trasplante de órganos: una revisión de literatura

    Directory of Open Access Journals (Sweden)

    Bernardo Moreno-Jiménez

    2005-01-01

    Full Text Available En el presente artículo los autores revisan algunas cuestiones teóricas y estudios empíricos sobre la calidad de vida relacionada con la salud infantil, en especial en niños con enfermedades crónicas que necesitan trasplantes de órganos. Pocas investigaciones han sido realizadas sobre el tema hasta el momento. Sus resultados han mostrado que el trasplante mejora el bienestar físico pero no hay conclusiones definitivas sobre su relación con el bienestar psicológico. Se discute la necesidad de evaluar los efectos del trasplante de órganos pediátrico en cada fase evolutiva, en distintos órganos y en diversas culturas.

  19. CALIDAD DE VIDA RELACIONADA CON LA SALUD INFANTIL Y EL TRASPLANTE DE ÓRGANOS: UNA REVISIÓN DE LITERATURA

    Directory of Open Access Journals (Sweden)

    Elisa Kern de Castro

    2005-06-01

    Full Text Available En el presente artículo los autores revisan algunas cuestiones teóricas y estudios empíricos sobre la calidad de vida relacionada con la salud infantil, en especial en niños con enfermedades crónicas que necesitan trasplantes de órganos. Pocas investigaciones han sido realizadas sobre el tema hasta el momento. Sus resultados han mostrado que el trasplante mejora el bienestar físico pero no hay conclusiones definitivas sobre su relación con el bienestar psicológico. Se discute la necesidad de evaluar los efectos del trasplante de órganos pediátrico en cada fase evolutiva, en distintos órganos y en diversas culturas.

  20. O desenvolvimento de um modelo de assistência continua ao parto Desarrollo de un modelo de asistencia continua en el parto Development of a delivery continued care model

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Silveira Lambert

    2010-07-01

    Full Text Available Objetivo. Descrever as experiências das enfermeiras obstétricas relacionadas com o desenvolvimento de um modelo de assistência ao parto. Metodologia. investigação do tipo estudo de caso. Analisaramse as declarações de quatro enfermeiras obstétricas, que desenvolveram o modelo de assistência ao parto proposto pelo Hospital Universitário da Universidade de São Paulo. A informação obtida se analisou de modo indutivo e interpretativo. Resultados. das narrativas surgiram quatro categorias descritivas: a a convivência com o sentimento de ambivalência, b o trabalho com facilidades e dificuldades com a adoção do novo modelo, c as mudanças no conceito da assistência ao parto, e d os benefícios proporcionados pelo modelo. As enfermeiras reconhecem a viabilidade do modelo, mas sua implementação definitiva na instituição depende das mudanças nas diretrizes filosóficas e gerenciais relacionadas com a assistência ao parto e do compromisso dos profissionais. Conclusão. Reconheceramse os diversos aspectos envolvidos na implementação do modelo de atendimento no parto.Objetivo. Describir las experiencias de las enfermeras obstétricas relacionadas con el desarrollo de un modelo de asistencia al parto. Metodología. Investigación del tipo estudio de caso. Se analizaron las declaraciones de cuatro enfermeras obstétricas, que desarrollaron el modelo de asistencia al parto propuesto por el Hospital Universitario de la Universidad de São Paulo. La información obtenida se analizó de modo inductivo e interpretativo. Resultados. De las narrativas surgieron cuatro categorías descriptivas: a la convivencia con el sentimiento de ambivalencia, b el trabajo con facilidades y dificultades con la adopción del nuevo modelo, c los cambios en el concepto de la asistencia al parto, y d los beneficios proporcionados por el modelo. Las enfermeras reconocen la viabilidad del modelo, pero su implementación definitiva en la institución depende de

  1. Relationship between anthropogenic impacts and bleaching-associated tissue mortality of corals in Curaçao (Netherlands Antilles

    Directory of Open Access Journals (Sweden)

    I Nagelkerken

    2006-12-01

    Full Text Available Chronic anthropogenic impacts can have a negative effect on coral health and on coral energy budgets needed for regeneration of lesions. I therefore hypothesise that during massive bleaching events, the degree of corals showing bleaching-related tissue mortality is higher in areas subject to chronic anthropogenic impacts than in relatively pristine areas. In the present study, the degree of bleaching and bleaching-related tissue mortality was estimated for eight abundant coral species in Curaçao, at the onset of a massive Caribbean bleaching event in 1995, and three months afterwards. To study the possible effects of anthropogenic disturbances, the study was done at four unpolluted control sites, two polluted sites (sedimentation, sewage, and four sites at the mouth of lagoons with outflow of nutrient-rich, warm and turbid seawater. No pattern of an overall difference in bleaching between impacted and control sites was found for the degree of bleaching. However, the percentage of corals showing bleaching-related tissue mortality was higher at the impacted sites than at the control sites for the total number of corals and for corals with Los impactos antropogénicos crónicos pueden tener efectos negativos en la salud y en las cantidades de energía necesarias para la regeneración de lesiones en los corales. Mi hipótesis fue que durante los casos de blanqueamiento masivo, el grado en que los corales muestren mortalidades de tejido relacionadas con el blanqueamiento, será mayor en áreas sujetas a impactos antropogénicos crónicos que en áreas relativamente prístinas. Estimé los grados de blanqueamiento y mortalidad tisular en ocho especies de coral abundantes en Curaçao, durante el comienzo de un de blanqueamiento masivo en el Caribe en 1995 y tres meses después. El estudio se realizó en cuatro sitios control no contaminados, dos sitios contaminados (sedimentación, aguas residuales, y cuatro sitios en la boca de lagunas con aguas

  2. Qualidade de frutas de tangerineira 'ponkan' submetidas ao raleio químico Quality of 'ponkan' mandarin fruits submitted to chemical thinning

    Directory of Open Access Journals (Sweden)

    Maria do Céu Monteiro da Cruz

    2009-03-01

    Full Text Available Para o mercado de frutas destinadas ao consumo in natura, o tamanho é uma das principais características relacionadas à qualidade. A aplicação de Ethephon em tangerineira 'Ponkan' é realizada para promover o raleio, visando ao aumento do tamanho das frutas. Além disso, outras características relacionadas à qualidade das frutas podem ser influenciadas pela aplicação de Ethephon. O trabalho foi conduzido em pomar comercial, com objetivo de estudar o efeito do raleio químico sobre a qualidade das frutas de tangerineira 'Ponkan', enxertadas sobre limoeiro 'Cravo' (Citrus limonia Osbeck, com dez anos de idade. Foram testadas cinco concentrações de Ethephon: 0; 150; 300; 450 e 600 mg L-1, em dois estádios de desenvolvimento das frutas: 30 e 40 mm de diâmetro. Foi utilizado o esquema fatorial 5 x 2, com quatro repetições, em delineamento de blocos casualizados, sendo os fatores as cinco concentrações de Ethephon e os dois estádios de desenvolvimento dos frutos. O raleio químico, com a aplicação de Ethephon, melhorou a qualidade das frutas de tangerineira 'Ponkan'. O estádio de desenvolvimento de 40 mm mostrou-se mais adequado para a aplicação do Ethephon.For the market, the size is one of the major characteristics related to quality for fruits fresh consume. The Ethephon application in mandarin 'Ponkan' is accomplished for thinning to increase fruit size. Moreover, other features related to fruit quality can be influenced by the ethephon application. The aim of this work was to evaluate the chemical thinning effect on mandarin 'Ponkan' fruit quality grafted on tenyear-old 'Rangpur' lime tree in a commercial orchard. Five Ethephon concentrations were tested: 0, 150, 300, 450 and 600 mg L-1, in two fruit development stages: 30 and 40 mm of diameter. The experiment was set in 5 x 2 factorial scheme, being the factors the Ethephon concentrations and the two fruit development stages, with four randomized block replications. The

  3. Percepção de servidores municipais frente ao diagnóstico de distúrbio osteomuscular relacionado ao trabalho Public officers' perceptions of work-related musculoskeletal disorder diagnosis

    Directory of Open Access Journals (Sweden)

    Mirna Albuquerque Frota

    2008-12-01

    Full Text Available As doenças osteomusculares relacionadas ao trabalho (DORT são distúrbios do aparelho locomotor de etiologia ligada à atividade laboral que vêm apresentando incidência crescente em todo o mundo. Este estudo teve o objetivo de descrever a forma como servidores municipais de Fortaleza, CE, vivenciam as DORT. O estudo qualitativo foi realizado em uma clínica de fisioterapia em 2004. Os informantes foram nove servidores (com idades entre 40 e 57 anos em atendimento fisioterápico na clínica - agentes administrativos, professores e um técnico. Os dados foram coletados por meio da observação participante e de entrevista semi-estruturada. Da análise emergiram as categorias temáticas "reações frente ao diagnóstico e tratamento" e "vivência da doença nas relações interpessoais". Os resultados permitiram inferir o impacto do diagnóstico da DORT no cotidiano do trabalhador: a limitação funcional leva à frustração e indignação; o não-reconhecimento pelos colegas gera a percepção de rejeição ou exclusão social. A reação de negação inicial, que leva o trabalhador a evitar a procura de atendimento especializado, é importante pela subnotificação gerada, que provoca limitação nas medidas de prevenção e controle das DORT.Work-related musculoskeletal disorders (WRMD have shown increasing incidence all over the world. This study aimed at describing how public officers (in Fortaleza, CE react to a WRMD diagnosis. In this qualitative study, data were collected by means of participant observation and interviews with nine informants (aged 40 through 57, recruited at a rehabilitation clinic in 2004; they were office clerks, teachers, and a technician. Two subject-matter categories emerged from data analysis: reactions to diagnosis and treatment; and interpersonal relation changes after diagnosis. Results allowed for inferring the impact of WRMD in workers' daily lives: functional limitation leads to frustration and indignation

  4. Análise do desenvolvimento de competências gerenciais na construção civil através do modelo da Aprendizagem Baseada em Problemas adaptado ao contexto organizacional

    Directory of Open Access Journals (Sweden)

    Vitor William Batista Martins

    Full Text Available As mudanças no cenário da engenharia civil e consequentemente da gestão da produção das obras exigem um engenheiro com perfil diferente, resultando na necessidade novas competências, relacionadas a inovação, foco no cliente, planejamento e controle, sistemas de gestão da qualidade, sustentabilidade e uma visão humanista. O objetivo principal deste artigo é identificar as competências desenvolvidas em uma empresa construtora com o processo de implantação da Aprendizagem Baseada em Problemas adaptado ao contexto organizacional. A estratégia de pesquisa adotada foi a pesquisa-ação, na qual a equipe de pesquisa atua com profissionais para melhorar a forma como estes entendem e resolvem problemas. Os resultados alcançados envolveram o desenvolvimento de competências relacionadas ao contexto organizacional, à aprendizagem individual, coletiva e organizacional, apontando problemas e possíveis soluções de gestão na empresa. Através do desenvolvimento de competências gerenciais, foi estimulada uma visão humanística, sustentável, com foco no cliente, além de um melhor sistema de gestão da qualidade. Identificaram-se problemas no sistema de gestão organizacional, ficando evidente a necessidade da criação de um ambiente propício para troca de informações entre diferentes setores da empresa.

  5. Calidad de vida relacionada a la salud tras una intervención con dieta mediterránea y ejercicio físico en pacientes con síndrome metabólico

    OpenAIRE

    Landaeta Díaz, Leslie

    2012-01-01

    El síndrome metabólico (SMet) se asocia con depresión, estrés psicosocial y peor calidad de vida relacionada a la salud. La dieta mediterránea y el ejercicio físico tienen un efecto positivo sobre el SMet aunque se desconoce su impacto sobre la calidad de vida relacionada a la salud y la capacidad física en estos pacientes. Objetivos: Estudiar el efecto de un modelo de dieta mediterránea, combinada o no con un programa de ejercicio físico de moderada a alta intensidad, sobre...

  6. Prevenção ao crime e teoria social

    OpenAIRE

    Sento-Sé, João Trajano

    2011-01-01

    O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime ...

  7. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  8. Da esclerodermia ao síndrome de poems

    Directory of Open Access Journals (Sweden)

    Ana Sofia Montez

    2015-12-01

    Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite

  9. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  10. Relacionando o planejamento de produto ao processo criativo: uma proposta

    Directory of Open Access Journals (Sweden)

    Cesar Antônio Mantovani

    2003-03-01

    Full Text Available Este trabalho apresenta algumas considerações relacionadas à criatividade da mesma manei-ra que são estabelecidas conexões entre os estágios do processo criativo e o planejamento de produtos industriais. Também se menciona sua aplicação na resolução de problemas dentro de áreas distintas: marketing; projeto; educação e produção, para tanto, é traçado um quadro comparativo com os estágios do processo criativo. Este trabalho está embasado em descri-ções de autores representativos destas áreas de conhecimento. O principal objetivo é estabe-lecer as correlações existentes entre os estágios do processo criativo com os diferentes está-gios e níveis do processo de planejamento de produto induzindo a uma proposta de universa-lização de linguagem. Palavras-chave: criatividade, processo criativo, planejamento de produtos industriais

  11. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  12. Diálise peritoneal: a percepção tátil do cliente na convivência com o cateter Diálisis peritoneal: la percepción táctil del cliente en la convivencia con el catéter Peritoneal dialysis: the tactile perception of clients that live with the catheter

    Directory of Open Access Journals (Sweden)

    Doris de Oliveira Araújo Cruz

    2008-01-01

    Full Text Available OBJETIVO: Este estudo objetivou investigar a percepção tátil do cliente na convivência com o cateter de diálise peritoneal indicadora de necessidades de cuidado. MÉTODOS: Estudo de abordagem qualitativa baseado nos princípios da sociopoética e no dispositivo do grupo pesquisador. Realizado no período de março a maio de 2006, empregou dinâmica de criação artística com sete clientes, em um hospital universitário. RESULTADOS: As análises apontaram para a adaptação, a negação, o cuidado, a indiferença, o mal-estar, que revelaram as categorias auto-estima e auto-imagem. CONCLUSÕES: O grupo como sujeito ativo da pesquisa evidenciou experiências através do diálogo. Emergiram através da criatividade os saberes inconscientes, desconhecidos e inesperados.OBJETIVO: En este estudio se tuvo como objetivo investigar la percepción táctil del cliente en la convivencia con el catéter de diálisis peritoneal indicador de necesidades de cuidado. MÉTODOS: Se trata de un estudio con abordaje cualitativo basado en los principios de la sociopoética y en el dispositivo del grupo investigador. Se llevó a cabo en el período de marzo a mayo del 2006, empleándose la dinámica de creación artística con siete clientes, en un hospital universitario. RESULTADOS: Los análisis señalaron la adaptación, la negación, el cuidado, la indiferencia, el malestar, reveladas en las categorías auto-estima y autoimagem. CONCLUSIONES: El grupo como sujeto activo de la investigación evidenció experiencias a través del diálogo. Emergieron por medio de la creatividad los saberes inconscientes, desconocidos e inesperados.OBJECTIVE: The purpose of this study was to investigate the clients' tactile perception toward living with a peritoneal dialysis catheter indicating their care needs. METHODS: This qualitative study was based on the principles of social poetics and according to the research group. It was carried out in the period from March to May

  13. Nurses' attitudinal and normative beliefs concerning hemodynamic assessement by pulmonary artery catheterization Creencias normativas y de actitud de los enfermeros sobre el estudio hemodinámico por medio del catéter de arteria pulmonar Crenças atitudinais e normativas dos enfermeiros sobre o estudo hemodinâmico por meio do cateter de artéria pulmonar

    Directory of Open Access Journals (Sweden)

    Cristiano José Mendes Pinto

    2006-12-01

    Full Text Available The objective of this study was to identify, by using the Theory of Reasoned Action/Theory of Planned Behavior, the attitude and normative beliefs that influence the behavioral intention of the nurse to perform a hemodynamic assessment using the pulmonary artery catheterization. Data were collected through semi-structured interviews involving 23 nurses from three hospitals in the city of Campinas, São Paulo. The data were analyzed according to a qualitative methodology. Among the Attitude Beliefs, affective beliefs and those related to the advantages and disadvantages of performing the behavior stand out. Among the Normative Beliefs social referents were identified for the behavior, as well as the behavior-stimulating factors and the factors that discourage the performance of the behavior.El objetivo de este estudio fue identificar, por medio de la Teoría del Comportamiento Planificado, las creencias normativas y de actitud que contribuyen para la formación de la intención de comportamiento del enfermero en realizar el estudio hemodinámico (EH por medio del catéter de la arteria pulmonar. Los datos fueron obtenidos atraves de entrevista semi estructurada de 23 enfermeros de unidades de terapia intensiva de tres hospitales del municipio de Campinas-São Paulo. Los datos fueron analizados según la metodología cualitativa. Entre las Creencias de Actitud se destacaron las creencias afectivas y aquellas relativas a las ventajas y desventajas de la realización del comportamiento. En las Creencias Normativas se evidenciaron los referentes sociales para la ejecución del comportamiento, así como factores estimulantes y que no estimulan la realización del EH.O objetivo deste estudo foi identificar, por meio da Teoria da Ação Racional/Teoria do Comportamento Planejado, as crenças de atitude e normativas que contribuem para a formação da intenção comportamental do enfermeiro em realizar o estudo hemodinâmico (EH por meio do cateter de

  14. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  15. Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

    Science.gov (United States)

    Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

    2017-01-01

    The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

  16. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  17. Desigualdades socioeconómicas relacionadas con el cuidado y el control del embarazo Socioeconomic inequalities in the provision and uptake of prenatal care

    Directory of Open Access Journals (Sweden)

    Gemma Cano-Serral

    2006-02-01

    Full Text Available Objetivo: Describir las desigualdades socioeconómicas relacionadas con el cuidado y el control del embarazo de las gestantes de Barcelona durante 1994-2003. Métodos: Diseño transversal de las gestantes de Barcelona que tuvieron un hijo sin anomalías congénitas. La información se obtuvo de las historias hospitalarias y una encuesta realizada a las madres del Registro de Defectos Congénitos de Barcelona, que recoge una muestra aleatoria del 2% del total de nacimientos de esta ciudad (n = 2.299. Se estudiaron las siguientes variables dependientes: visitas al obstetra, trimestre de la primera visita, número de ecografías, ecografía del quinto mes, realización de una prueba invasiva, consumir ácido fólico, planificación del embarazo, consumo y abandono del tabaco. Las variables independientes fueron la edad y la clase social. Se ajustaron modelos de regresión logística para cada variable dependiente. Resultados: Las gestantes de clases sociales con ocupaciones manuales realizan, en mayor proporción, menos de 6 visitas y la primera visita después del primer trimestre; además, tienen menor probabilidad de realizar alguna prueba invasiva, tomar ácido fólico, planificar el embarazo, no fumar y abandonar el consumo de tabaco. Y las gestantes de clases no manuales realizan, en mayor proporción, más de 12 visitas y más de 3 ecografías. Conclusiones: Hay desigualdades socioeconómicas relacionadas con el cuidado y el control del embarazo en Barcelona. Las gestantes de las clases sociales más favorecidas realizan un mejor cuidado y control del embarazo, pero en todas se observa una excesiva medicalización. Una racionalización del uso de recursos sanitarios y una reducción de la medicalización podría disminuir las desigualdades relacionadas con el cuidado y el control de la gestación en Barcelona.Objective: To describe socioeconomic inequalities in the provision and uptake of prenatal care among women in Barcelona (Spain between

  18. Identificación y clasificación de las lesiones relacionadas con la dependencia: de la teoría a la práctica clínica

    Directory of Open Access Journals (Sweden)

    Alba Roca-Biosca

    Full Text Available Objetivo: clasificar y categorizar las lesiones relacionadas con la dependencia según la teoría de García-Fernández y cols. Metodología: estudio descriptivo y longitudinal realizado en una unidad de cuidados intensivos en el que se incluyó a todos los pacientes ingresados sin lesiones previas. Cada paciente fue evaluado diariamente hasta desarrollar una lesión relacionada con la dependencia o salida de estudio. Resultados: El 27,9% de los pacientes (n = 136 desarrollaron lesiones relacionadas con la dependencia, sin diferencias estadísticamente significativas entre pacientes que las desarrollaron y aquellos que no lo hicieron salvo para EMINA primer día (p = 0,035. Solo el 46,4% de las lesiones relacionadas con la dependencia se catalogaron como úlceras por presión. El 36,8% se relacionaron con dispositivos terapéuticos. Conclusiones: los resultados apoyan el cambio de paradigma propuesto por los autores, lo que permite diferenciar entre úlceras por presión y otro tipo de lesiones.

  19. Energia estática sobre o norte e nordeste do Brasil relacionada com a temperatura da superfície do mar Static energy in the north and northeast of Brazil related with the sea surface temperature

    National Research Council Canada - National Science Library

    Ana Cleide Nascimento Bezerra; Enilson Palmeira Cavalcanti

    2008-01-01

    ... atmosférica de grande escala, nas regiões Norte e Nordeste do Brasil (NEB), relacionadas com a variabilidade da temperatura da superfície do mar (TSM) nos oceanos Atlântico e Pacífico Tropicais...

  20. Desafios da adesão ao tratamento de pessoas vivendo com HIV/Aids no Brasil Challenges of treatment adherence by people living with HIV/AIDS in Brazil

    Directory of Open Access Journals (Sweden)

    Regina Melchior

    2007-12-01

    Full Text Available OBJETIVO: Analisar as dificuldades referentes à adesão ao tratamento de pacientes vivendo com HIV/Aids em terapia anti-retroviral altamente ativa. MÉTODOS: Pesquisa qualitativa baseada em 34 entrevistas com pacientes em tratamento de diversos serviços ambulatoriais do estado de São Paulo em 1998-1999. O grupo compreendeu pessoas de diferentes níveis socioeconômicos, sexo, tempo no tratamento e diferentes graus de adesão de acordo com a percepção da equipe de saúde. As entrevistas foram focalizadas na narrativa do paciente sobre sua doença. A análise de conteúdo classificou as dificuldades relacionadas a fatores sociais e do estilo de vida, incluindo o estigma; a crenças acerca do uso da medicação; e diretamente ao uso da medicação. RESULTADOS: Todos os entrevistados relataram dificuldades relacionadas ao estigma de viver com HIV/Aids. As dificuldades relacionadas ao uso da medicação predominaram entre pacientes com melhor adesão. Pacientes com aderência média apresentaram os três tipos de dificuldade. CONCLUSÕES: Os fatores sociais e culturais são mais difíceis de serem superados para adesão ao tratamento do que aqueles relacionados a tomar a medicação, o que torna importante o papel desempenhado pelo setor saúde, apoiado por políticas públicas sociais claras. Essas dimensões devem ser enfrentadas não somente no setor saúde, mas também nos âmbitos político e social.OBJECTIVE: To analyze the difficulties related to treatment adherence by patients living with HIV/AIDS in highly active antiretroviral therapy. METHODS: Qualitative research based on 34 interviews with patients under treatment in several outpatient services in the state of São Paulo, in 1998-1999. The group was comprised of people from different socioeconomic levels, gender, length of treatment and varied adherence levels, according to healthcare staff perception. The interviews focused on the patient's narrative about his/her disease. The

  1. Autopercepção corporal de variáveis da aptidão física relacionada à saúde Bodily self-perception of health-related physical fitness variables

    Directory of Open Access Journals (Sweden)

    Denise Sardinha Mendes Soares de Araújo

    2002-04-01

    Full Text Available FUNDAMENTAÇÃO: A aptidão física apresenta duas dimensões, uma relacionada à saúde e outra ao desempenho. Não é sabido se adultos não-atletas possuem autopercepção corporal (ApC apropriada sobre a sua aptidão física relacionada à saúde. OBJETIVOS: a testar a ApC de indivíduos não-atletas em algumas variáveis morfofuncionais constituintes da aptidão física, b verificar se a margem de acerto ou de erro nessa ApC depende dos resultados obtidos; e c verificar se aqueles com maior ApC são mais aptos fisicamente. MÉTODOS: Foram obtidos dados em 63 adultos (51 homens, com idade entre 22 e 85 anos, tendo sido medida e testada a ApC das seguintes variáveis: VO2 máximo, flexibilidade, força de preensão manual, potência muscular máxima absoluta e relativa, localização predominante de gordura corporal e peso de referência, habilidade de sentar e levantar do solo e relação peso/altura, além da altura e do peso corporal. A influência da magnitude das variáveis sobre o escore de ApC (soma dos acertos nas 12 variáveis testadas foi testada pela comparação entre os resultados do primeiro e do quinto quintis da distribuição e por correlações. RESULTADOS: Os indivíduos tendem a errar mais do que a acertar, em média, a ApC: 60 vs. 40%. A ApC é mais incorreta para a variável flexibilidade 84% de erro - e mais precisa para a habilidade de levantar do solo 66% de acerto. O escore de ApC foi maior nos indivíduos mais flexíveis (p = 0,01 e nos que possuíam maior força de preensão manual (p = 0,04 e tendia a ser maior nos que alcançavam percentual mais elevado do VO2 máximo previsto (p = 0,08. O sedentarismo era quase três vezes mais prevalente nos indivíduos com pior ApC. Os 20% com maiores escores de ApC tendiam a melhores resultados nas variáveis da aptidão física (p entre 0,03 e 0,11. CONCLUSÕES: O nível global de ApC de variáveis da aptidão física é baixo, dependendo dos níveis de flexibilidade e de

  2. Registro y análisis de algunas variables epidemiológicas relacionadas con las malformaciones congénitas mayores

    Directory of Open Access Journals (Sweden)

    Elisa Dyce Gordon

    1999-01-01

    Full Text Available Se realizó estudio de casos y controles sobre algunas variables epidemiológicas relacionadas con las 42 malformaciones congénitas mayores clínicamente más severas, presentadas en dos áreas de salud del municipio Camagüey desde enero de 1986 hasta diciembre de 1994. Los datos fueron obtenidos de las planillas del Registro Provincial de Malformaciones Congénitas, certificados de defunción, historias clínicas familiares de los consultorios del Médico de la Familia, historias clínicas de riesgo genético y pediátricas, así como entrevistas a los padres. Las malformaciones más frecuentes fueron las del aparato cardiovascular. El antecedente de aborto espontáneo y la amenaza de aborto estuvieron relacionadas con el 9,52 y 21,6 % de los malformados respectivamente. Una posible asociación causal se encontró con la ingestión de alcohol, la exposición al calor y la gripe. Estadísticamente significativa resultó la asociación entre la ingestión materna de tranquilizantes y analgésicos, y la presencia de malformaciones. Estos factores ambientales deben evitarse durante el embarazo y mantenerse en el área una estrecha vigilancia sobre ellos, lo cual se logra a través del registro de estos defectos.A case-control study on some epidemiological variables connected with the 42 most clinically severe major congenital malformations reported in 2 health areas of Camagüey municipality from January, 1986,to December, 1994, was conducted. Data were obtained from the forms of the Provincial Registry of Congenital Malformations, death certificates, family medical histories of the family physicians offices, medical histories of genetic risk and pediatrics and from interviews to parents. The most frequent malformations were those of the cardiovacular system. Histories of miscarriage and threatened abortion were related to 9,52 and 21,6 % of the malformed, respectively. A possible causal association with alcohol ingestion, exposure to heat and

  3. Aptitud física relacionada con salud en los estudiantes de primer semestre académico de un programa de fisioterapia, 2007

    Directory of Open Access Journals (Sweden)

    Claudia Lucía Ariza-García

    2016-08-01

    Full Text Available Objetivo: Evaluar la aptitud física relacionada con salud (AFRS de las estudiantes de primer semestre de fisioterapia de una universidad privada de Santander. Metodología: Estudio descriptivo transversal realizado en 20 estudiantes (17,8 ± 1,33 años de sexo femenino de primer semestre, seleccionadas por conveniencia. Se recolectaron las variables edad, sexo, composición corporal, la flexibilidad de la musculatura posterior, la capacidad aeróbica y la resistencia muscular de miembros superiores y abdominales. Se calcularon medidas de tendencia central, de dispersión, frecuencias y porcentajes. Resultados: En promedio el peso fue de 52,8 ± 9,5 kg, la estatura de 1,58 ± 0,05 m, el IMC de 20,9 ± 3,5 kg/m2. La circunferencia de cintura y de cadera fue de 69,3 ± 9,2 cms y 91,3 ± 7,3 cm, respectivamente. El promedio del cuarto cuartil de las mediciones perímetro de cintura, perímetro de cadera, relación cintura-cadera, frecuencia cardiaca después de 30 s y distancia en la prueba de flexibilidad fueron estadísticamente mayores comparado con los demás cuartiles. El 50% de los pacientes realizó entre 0 y 3 repeticiones de la prueba Push-Up y entre 0 y 21 repeticiones en la prueba Cu rl-Up. El 65% fue físicamente apta hasta en cuatro pruebas y el 35% en 5 y 6 pruebas. Ninguna fue apta en todas las pruebas. Conclusiones: Dado que ninguna de las estudiantes posee una aptitud física relacionada con salud óptima, se sugiere que en los programas de fisioterapia se fomente una AFRS adecuada junto con estilos de vida saldables para prevenir enfermedades crónicas no transmisibles.

  4. Aptitud física relacionada con salud en los estudiantes de primer semestre académico de un programa de fisioterapia, 2007

    Directory of Open Access Journals (Sweden)

    Claudia Lucía Ariza-García

    2014-06-01

    Full Text Available Objetivo: Evaluar la aptitud física relacionada con salud (AFRS de las estudiantes de primer semestre de fisioterapia de una universidad privada de Santander. Metodología: Estudio descriptivo transversal realizado en 20 estudiantes (17,8 ± 1,33 años de sexo femenino de primer semestre, seleccionadas por conveniencia. Se recolectaron las variables edad, sexo, composición corporal, la flexibilidad de la musculatura posterior, la capacidad aeróbica y la resistencia muscular de miembros superiores y abdominales. Se calcularon medidas de tendencia central, de dispersión, frecuencias y porcentajes. Resultados: En promedio el peso fue de 52,8 ± 9,5 kg, la estatura de 1,58 ± 0,05 m, el IMC de 20,9 ± 3,5 kg/m2. La circunferencia de cintura y de cadera fue de 69,3 ± 9,2 cms y 91,3 ± 7,3 cm, respectivamente. El promedio del cuarto cuartil de las mediciones perímetro de cintura, perímetro de cadera, relación cintura-cadera, frecuencia cardiaca después de 30 s y distancia en la prueba de flexibilidad fueron estadísticamente mayores comparado con los demás cuartiles. El 50% de los pacientes realizó entre 0 y 3 repeticiones de la prueba Push-Up y entre 0 y 21 repeticiones en la prueba Cu rl-Up. El 65% fue físicamente apta hasta en cuatro pruebas y el 35% en 5 y 6 pruebas. Ninguna fue apta en todas las pruebas. Conclusiones: Dado que ninguna de las estudiantes posee una aptitud física relacionada con salud óptima, se sugiere que en los programas de fisioterapia se fomente una AFRS adecuada junto con estilos de vida saldables para prevenir enfermedades crónicas no transmisibles.

  5. Conservação ambiental no campo ou estratégia de transferência de recursos do rural ao urbano / Environmental Conservation Strategy In The Field Or Transfer Of Funds From Rural To Urban

    Directory of Open Access Journals (Sweden)

    Fabiana Faxina,

    2011-09-01

    Full Text Available Os discursos recentemente formulados por grupos sociais relacionados ao meio rural sobre áreas protegidas trazem de volta o antigo confl ito entre o rural e o urbano, conhecido na literatura como urban bias. O pressuposto subjacente neste confl ito é de que o viés urbano das políticas públicas está orientado para transferir riqueza do campo para as áreas urbanas, reproduzindo, desta forma, a pobreza no campo. Analisa-se aqui como reagem os proprietários de imóveis, nos quais se desenvolvem ações relacionadas ao turismo rural, quanto às políticas públicas sobre áreas de conservação. A verificação empírica fundamenta-se em entrevistas efetuadas com 22 proprietários rurais, no entorno do Parque do Iguaçu, Paraná. Os resultados indicam que quase todos entrevistados acreditam que a existência de áreas protegidas traz benefícios para a sociedade; mas, ao considerar o desenvolvimento local e o imóvel, um número expressivo tende a uma percepção negativa das áreas protegidas, em razão do modelo político de conservação que imputa aos donos dos empreendimentos rurais o custo total, enquanto toda a sociedade recebe os benefícios. Discute-se a necessidade de revisão das políticas públicas voltadas para a conservação, no sentido de dividir com toda a sociedade os custos resultantes de medidas que benefi ciam a todos.

  6. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  7. Data of evolutionary structure change: 1AO5B-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-2AGEX 1AO5 2AGE B X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  8. Data of evolutionary structure change: 1AO5A-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5A-2AGEX 1AO5 2AGE A X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  9. Expectativas de resultados frente ao uso de álcool, maconha e tabaco Outcome expectancy considering the use of alcohol, cannabis and tobacco

    Directory of Open Access Journals (Sweden)

    Rosemeri Siqueira Pedroso

    2006-08-01

    Full Text Available Este artigo teve como objetivo realizar uma revisão teórica acerca do construto expectativas de resultados frente ao uso de álcool, maconha e tabaco. As expectativas de resultados são determinadas a partir do que as pessoas acreditam acerca dos efeitos de determinada droga, sendo uma variável importante no tratamento de dependentes químicos. Foram realizadas buscas de artigos publicados nas bases de dados MEDLINE, PsycINFO, ProQuest, Ovid, LILACS e Cork, usando os descritores belief, expectancy, expectation, drugs, psychoactive e effect. Os resultados demonstraram que as expectativas de resultados frente ao uso dessas substâncias podem surgir de fontes como: exposição a estímulos condicionados, dependência física, crenças pessoais e culturais e fatores situacionais e ambientais. Conclui-se que ainda há necessidade de novas pesquisas quanto às expectativas relacionadas às diferentes substâncias psicoativas e faixas etárias para uma melhor compreensão deste construto.This article aims to perform a theoretical review about the outcome expectancy construct considering the use of alcohol, cannabis and tobacco. Outcome expectancy is determined by people's belief about the effects of a drug. It is an important variable for the treatment of chemically dependent patients. Searches in the electronic databases MEDLINE, PsycINFO, ProQuest, Ovid, LILACS and Cork were carried out, using the following descriptors: belief, expectancy, expectation, drugs, psychoactive, and effect. Results showed that outcome expectancy considering the use of those substances can be generated from: exposure to conditioning stimuli, physical dependence, personal and cultural beliefs, and situational and environmental factors. In conclusion, there is the need of new researches on expectancies related to psychoactive substances and age groups in order to have a better understanding of this construct.

  10. Baixos níveis de aptidão física relacionada à saúde em universitários Low levels of health-related physical fitness among university students

    Directory of Open Access Journals (Sweden)

    Maruí Weber Corseuil

    2010-03-01

    Full Text Available Este estudo teve por objetivo identificar a prevalência de baixos níveis de aptidão física relacionada à saúde em universitários, quanto aos componentes músculo-esqueléticos (motores. Participaram da amostra 234 estudantes (112 moças e 122 rapazes, entre 17 e 29 anos, matriculados em diversos cursos da Universidade Federal de Santa Catarina. Foi utilizada uma bateria de testes proposta pela Sociedade Canadense de Fisiologia do Exercício. Os testes propostos foram: força de preensão manual; extensão dos braços; flexão do tronco; impulsão vertical; resistência abdominal e força dorsal. Os resultados apontam uma prevalência de aptidão física abaixo dos indicadores recomendados à saúde de 16,6% (13,4% feminino e 19,6% masculino. Especificamente, observaram-se os seguintes índices de prevalência de universitários que não atingiram os critérios recomendados: 69,2% para a potência de membros inferiores, 62% para extensão de braços, 38,4% para a preensão manual, 13,2% para flexão de tronco, 11,1% para força dorsal e 10,7% para força abdominal. Em se tratando de indivíduos jovens, observou-se que boa parte dos universitários encontra-se com baixos níveis de aptidão física, sugerindo a importância da implantação de programas para o desenvolvimento e/ou manutenção da aptidão física destes estudantes, fornecendo subsídios para que estes adotem um estilo de vida mais ativo e saudável por toda a sua vidaThe aim of this study was to identify the prevalence of low health-related physical fitness levels among university students in terms of muscle-skeletal components (motor performance. A total of 234 students (112 girls and 122 boys aged 17 to 29 years, enrolled in different courses of the Federal University of Santa Catarina, Brazil, participated in the study. The test battery proposed by the Canadian Society for Exercise Physiology was used: handgrip strength, push-ups, sit and reach, vertical jump, partial

  11. Lacunas e falhas relacionadas à importação de produtos para a saúde em contêiner | Breaches and errors related to imports of health products in containers

    Directory of Open Access Journals (Sweden)

    Mariene Castilho D’Ávila

    2016-08-01

    Full Text Available Metade das mercadorias relacionadas à saúde, importadas via Porto do Rio de Janeiro, é armazenada em contêineres, 70% deles não possui sistema de refrigeração, por isto, não é possível assegurar a manutenção das recomendações do fabricante conforme exigem as regulamentações sanitárias estabelecidas. Estes contêineres geralmente são fabricados em aço, suas especificações são voltadas para possibilitar segurança e eficiência no transporte de mercadorias diversas e estão inseridos em um complexo contexto multimodal. O presente estudo objetivou obter conhecimento sobre este segmento de importação, na produção científica, legislação internacional, orientações técnicas e práticas operacionais atuais. As análises realizadas entre 2014 e 2015 revelaram que os contêineres são sensíveis ao ambiente em que estão depositados, 30% das medições apresentaram discrepâncias em relação às recomendações de temperatura para a armazenagem. Foram registradas temperaturas acima de 60°C. A exposição das mercadorias a estas condições foi estimada em no mínimo 38 dias. Não foram localizados estudos científicos sobre o acondicionamento de mercadorias para a saúde em contêineres. As produções técnica e legal são incipientes. Esses resultados reforçam a preocupação com a eficácia das mercadorias importadas e a necessidade de se promover o debate sobre a armazenagem em contêineres onde se estabeleçam requisitos mínimos de qualidade obrigatórios. ===================================================== Half of the health products imported through the Port of Rio de Janeiro are stored in containers. As 70% of these containers do not have refrigeration system, manufacturer’s recommendations –as required by health regulations- cannot be guaranteed. Containers are usually made of steel, aim to enable safe and efficient transportation of various goods, and are embedded in a complex multi-modal system. This

  12. Probing circumplanetary disks with MagAO and ALMA

    Science.gov (United States)

    Wu, Ya-Lin

    2018-01-01

    The dedication of the Magellan Adaptive Optics (MagAO) on the 6.5 m Clay Telescope has opened a new era in high-contrast imaging. Its unique diffraction-limited wavelengths of 0.6 to 1 micron helps to probe circumplanetary disks by measuring the amount of dust reddening as well as by searching for the strongest gas accretion indicator H-alpha (0.65 micron). Using MagAO, I found that two wide-orbit planetary-mass companions CT Cha B and 1RXS 1609 B have a significant dust extinction of Av ~ 3 to 5 mag likely from their disks. For GQ Lup B, I found that it is actively accreting material from its disk and emitting strong H-alpha emission. My research with MagAO demonstrates that circumplanetary disks could be ubiquitous among young giant planets. I later carried out a survey using ALMA to image accretion disks around several wide planet-mass companions at 1.3 mm continuum and CO (2-1). This is the first systematic study aiming to measure the size, mass, and structure of planetary disks. However, except for FW Tau C (which was shown to actually be a low-mass star from the dynamical mass measurement) no disks around the companions were found in my ALMA survey. This surprising null result implies that circumplanetary disks are much more compact and denser than expected, so they are faint and optically thick in the radio wavelengths. Therefore, mid- to far-infrared may be more favorable to characterize disk properties. The MIRI camera on the JWST can test this compact optically-thick disk hypothesis by probing disk thermal emission between 10 and 25 micron.

  13. Identification of system misregistrations during AO-corrected observations

    Science.gov (United States)

    Béchet, C.; Thiébaut, É.; .; Tallon, M.; Kolb, J.; Madec, P.-Y.

    2011-09-01

    The E-ELT will be equipped with a deformable mirror inside the telescope. The performance of reconstruction and control depends on the calibration of the interaction matrix- or a model of the interaction matrix- , which characterizes the system and the relationship between the commands sent to the deformable mirrors (DM) and the wavefront sensors (WFS) slopes. Such a calibration will be more complex than for the current systems at the VLT since it will have to be at least partly measured on sky and for a much larger number of degrees of freedom (more than 5000). In addition, gravity or temperature variations for instance are likely to introduce slow evolution of the matching between the M4 Deformable mirror and the WFS geometry. This can occur during observations and therefore degrade the adaptive optics (AO) correction. To relax the need of frequent painful calibrations and to prevent a loss of performance due to misregistrations, we investigate how to track the evolution of the interaction matrix errors in closed-loop without introducing any degradation in the observations. This is done thanks to identification methods and optimization theory. First, we formally describe the problem and the difficulties of such an identification in closed-loop configuration. Then, we present 2 solutions, based on the optimization of the error of estimates of the WFS slopes, at the output of the closed-loop AO. The performance of the methods and their limitations are discussed formally and thanks to numerical simulations of a high order AO system. We finally explore to which extent these methods currently studied for the Adaptive Optics Facility (AOF) at the VLT can be applied to the E-ELT.

  14. Anemia e peso ao nascer Anemia and birthweight

    Directory of Open Access Journals (Sweden)

    Taqueco T Uchimura

    2003-08-01

    Full Text Available OBJETIVO: Verificar a influência do baixo peso ao nascer (BPN na anemia e desnutrição da criança, ao longo do primeiro ano de vida. MÉTODOS: A população amostral foi constituída por todas as crianças menores de um ano de idade atendidas nas unidades de saúde do Município de Maringá, PR, em 1998, num total de 587. Considerou-se baixo peso ao nascer, todas as crianças com peso OBJECTIVE: To verify the influence of Low Birthweight (LBW on child anemia and malnutrition during the first year of life. METHODS: Sample population included all children under one year seen at Health Units of the municipality of Maringá, southern Brazil, in 1998. Total sample size was 587 children. LBW was defined as birthweight below 2 500 g. The analysis of growth for the weigh-for-age and height-for-age indicators was based on NationalCenter for HealthSstatiscs standards. For anemia diagnosis, a biochemical hemoglobin concentration dosage, using HemoCue direct colorimetric method was employed. Children with [Hb] <11,0 g/dL were considered as anemic. RESULTS: Fifty-eight percent of the studied population were anemic, and 37 children (6.3% presented LBW. Anemia was more prevalent during the second semester of life (p=0.0093. Undernutrition, as indicated by the height-for-age indicator, was high especially for children aged 0-3 months with LBW. CONCLUSIONS: Although LBW rates among the studied population were similar to those of developed countries, we suggest the implementation of specific antenatal care for high-risk women, aiming at reducing LBW, an event that affects the child, hampering its growth and increasing the risk of anemia and its countless deleterious consequences.

  15. Child abuse: a common problem in Curaçao?

    Science.gov (United States)

    Klein, K; Boersma, A A; Meyboom-de Jong, B; de Bruijn, J

    2013-02-01

    To assess the prevalence of child abuse among high school students in Curacao. A questionnaire survey among high school students up to 17 years of age was conducted. The questionnaire was based on existing literature and validated questionnaires. The questionnaire used was analysed and adapted to the situation in Curaçao by a panel of experts on child abuse. The primary objective was to gain insight into the incidence, prevalence and various forms of child abuse among students in Curaçao. Five forms of child abuse are distinguished in the literature: physical abuse, emotional abuse, sexual abuse, neglect and exploitation. Furthermore, the degree of confidence of the students in general practitioners (GPs) as care providers in the field of child abuse was explored. Questionnaires from 545 of the 628 respondents were included. In total, 43% of the respondents had ever-experienced an event which could be defined as (a form of) child abuse. More than one-third of the respondents reporting child abuse ever had an experience that could be interpreted as physical abuse. More than 15% of the respondents reporting child abuse had experienced sexual abuse. Girls experienced significantly more sexual abuse than boys. Emotional abuse in the last year was experienced by 3% of the respondents. One per cent of the respondents ever-experienced neglect. According to most respondents, GPs were not seen as care providers in cases of child abuse; they believed that GPs were mainly to be consulted for illnesses or physical symptoms and not for forms of child abuse. The prevalence of ever-having-experienced a form of child abuse is estimated at 431 per 1000 students. Child abuse, particularly physical abuse, is common in Curaçao, and is probably comparable to other surrounding countries. General practitioners were not seen as care providers in identifying and reporting cases of child abuse according to most respondents.

  16. Fatores para não-adesão ao programa de controle da hipertensão arterial em Campo Grande, MS

    Directory of Open Access Journals (Sweden)

    Lia Lusitana Cardozo Castro

    2010-06-01

    Full Text Available A adesão ao tratamento farmacológico em doenças crônicas como a hipertensão arterial, é fundamental para o controle, prevenção de complicações e diminuição da mortalidade. Identificar os fatores que levam a não adesão ao programa de controle de hipertensão arterial, em Unidades Básicas de Saúde de Campo Grande, MS e produzir um modelo de predição desta condição foi o objetivo do presente estudo. Utilizou-se o método de caso-controle, aninhado a coorte de pacientes cadastrados no programa, no período de 2002 a 2005. Foi utilizada regressão logística tendo como variável-resposta ‘adesão ao programa’. As associações significativas identificadas na análise univariada foram: características socioeconômicas, da doença, do tratamento e as relacionadas ao programa. Para prever a adesão, mantiveram-se no modelo as seguintes variáveis: dificuldade em ir ao programa, renda familiar, presença de diabetes, escolaridade e viver com companheiro. Com base no modelo, a probabilidade do paciente ser classificado corretamente como aderente, é de aproximadamente, 80% e como não aderente, 67%. O modelo identifica precocemente, pacientes vulneráveis à não adesão ao programa propiciando que este institua medidas voltadas aos prováveis, não aderentes. Palavras-chave: Hipertensão arterial. Programa de controle da hipertensão. Estudo caso-controle. Modelo de predição. Farmacoepidemiologia. ABSTRACT Factors for nonadherence to the Arterial Hypertension Control Program in Campo Grande, MS, Brazil Introduction: Adherence to the pharmacological treatment of chronic diseases such as arterial hypertension is decisive in their control, in preventing complications, and in decreasing mortality rates. Objective: To identify factors that led patients to drop out of an arterial hypertension control program available at local district clinics of the government-run National Health Service in Campo Grande, MS, Brazil, and to design a

  17. Assistência de enfermagem humanizada ao paciente em UTI

    OpenAIRE

    Vieira, Claudir Aparecido; Maia, Luiz Faustino dos Santos

    2013-01-01

    Hoje em dia a humanização é ponto de pauta nos encontros nacionais e internacionais da área da saúde. Assim, cada vez mais enfermeiros nas unidades de terapia intensiva tem se preocupado com a sua prática. O presente estudo foi desenvolvido com o objetivo de compreender, reconhecer e entender como o comportamento humanizado reflete ao paciente e identificar a percepção da equipe de enfermagem sobre o processo de humanização. Trata-se de uma pesquisa de revisão bibliográfica descritiva com aná...

  18. Resistencia ao brometo de etidio em aspergillus nidulans

    OpenAIRE

    Maria Elizabeth Scarazzatti Frau

    1985-01-01

    Resumo: O presente trabalho teve por objetivo isolar e ana-lisar geneticamente mutantes de Aspergillus nidulans resistentes ao Brometo de Etídio (BE), bem como estudar os efeitos da riboflavina em relação a toxicidade do BE. Foram isolados mutantes espontâneos e induzidos. Dos mutantes isolados espontaneamente apenas 3 continuaram a apresentar resistência, sendo 1 da linhagem A e 2 da linhagem biAl methGl. Os outros mutantes (16) foram obtidos por indução com luz ultravioleta. Destes apenas 9...

  19. Stream-Field Interactions in the Magnetic Accretor AO Piscium

    Science.gov (United States)

    Hellier, Coel; van Zyl, Liza

    2005-06-01

    UV spectra of the magnetic accretor AO Psc show absorption features for half the binary orbit. The absorption is unlike the wind-formed features often seen in similar stars. Instead, we attribute it to a fraction of the stream that overflows the impact with the accretion disk. Rapid velocity variations can be explained by changes in the trajectory of the stream depending on the orientation of the white dwarf's magnetic field. Hence, we are directly observing the interaction of an accretion stream with a rotating field. We compare this behavior to that seen in other intermediate polars and in SW Sex stars.

  20. Atenção ao Suicídio

    Directory of Open Access Journals (Sweden)

    Berenice Rheinreimer

    2015-11-01

    Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.

  1. Aspect-Oriented Business Process Modeling with AO4BPMN

    Science.gov (United States)

    Charfi, Anis; Müller, Heiko; Mezini, Mira

    Many crosscutting concerns in business processes need to be addressed already at the business process modeling level such as compliance, auditing, billing, and separation of duties. However, existing business process modeling languages including OMG's Business Process Modeling Notation (BPMN) lack appropriate means for expressing such concerns in a modular way. In this paper, we motivate the need for aspect-oriented concepts in business process modeling languages and propose an aspect-oriented extension to BPMN called AO4BPMN. We also present a graphical editor supporting that extension.

  2. O papel do leite ao longo do ciclo de vida

    OpenAIRE

    Lima, Joana Catarina Dinis

    2012-01-01

    Resumo da tese: A presença do leite nos guias alimentares denota a sua importância na alimentação humana. Contudo, não é consensual que este alimento deva fazer parte da nossa alimentação ao longo de todo o ciclo de vida. Sabe-se que cada espécie produz um tipo de leite diferente, com diversas moléculas bioativas e nutrientes que modulam o seu crescimento e desenvolvimento corporal. Recentemente, uma parte da fração proteica do leite tem sido apontada como tendo um possível efeito estimulante...

  3. Segurança emocional como necessidade humana básica: atuação do enfermeiro junto ao cliente em unidade de terapia intensiva

    Directory of Open Access Journals (Sweden)

    Teresinha de Jesus Monteiro Espírito Santo

    1985-12-01

    Full Text Available Pesquisa descritiva exploratória que se propõe a investigara atuação do enfermeiro da Unidade de Terapia Intensiva, referenciando como este identifica, diagnostica e resolve os problemas ligados à segurança emocional dos clientes internados. O estudo abrangeu vinte e oito enfermeiros e dez clientes das unidades de três hospitais da Cidade do Rio de Janeiro. A técnica adotada para pesquisa consistiu da observação sistemática não participada. Os resultados obtidos demonstraram que os procedimentos terapêuticos dominantes recaem sobre alterações físicas em detrimento do emocional, evidenciando que o enfermeiro, ao distanciar-se de uma atuação holística, acarretará sérios prejuízos na assistência destes clientes, cuja necessidade humana básica afetada é predominantemente relacionada à segurança emocional.

  4. Apple fruit copper amine oxidase isoforms: peroxisomal MdAO1 prefers diamines as substrates, whereas extracellular MdAO2 exclusively utilizes monoamines.

    Science.gov (United States)

    Zarei, Adel; Trobacher, Christopher P; Cooke, Alison R; Meyers, Ashley J; Hall, J Christopher; Shelp, Barry J

    2015-01-01

    4-Aminobutyrate (GABA) accumulates in apple fruit during controlled atmosphere storage. A potential source of GABA is the polyamine putrescine, which can be oxidized via copper-containing amine oxidase (CuAO), resulting in the production 4-aminobutanal/Δ(1)-pyrroline, with the consumption of O2 and release of H2O2 and ammonia. Five putative CuAO genes (MdAO genes) were cloned from apple (Malus domestica Borkh. cv. Empire) fruit, and the deduced amino acid sequences found to contain the active sites typically conserved in CuAOs. Genes encoding two of these enzymes, MdAO1 and MdAO2, were highly expressed in apple fruit and selected for further analysis. Amino acid sequence analysis predicted the presence of a C-terminal peroxisomal targeting signal 1 tripeptide in MdAO1 and an N-terminal signal peptide and N-glycosylation site in MdAO2. Transient expression of green fluorescent fusion proteins in Arabidopsis protoplasts or onion epidermal cells revealed a peroxisomal localization for MdAO1 and an extracellular localization for MdAO2. The enzymatic activities of purified recombinant MdAO1 and MdAO2 were measured continuously as H2O2 production using a coupled reaction. MdAO1 did not use monoamines or polyamines and displayed high catalytic efficiency for 1,3-diaminopropane, putrescine and cadaverine, whereas MdAO2 exclusively utilized aliphatic and aromatic monoamines, including 2-phenylethylamine and tyramine. Together, these results indicate that MdAO1 may contribute to GABA production via putrescine oxidation in the peroxisome of apple fruit under controlled atmosphere conditions. MdAO2 seems to be involved in deamination of 2-phenylethylamine, which is a step in the biosynthesis of 2-phenylethanol, a contributor to fruit flavor and flower fragrance. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  5. Localização inicial da ponta de cateter central de inserção periférica (PICC em recém-nascidos Localización inicial de la punta del catéter central de inserción periférica (PICC en recién nacidos Initial placement of the peripherally inserted central catheter's tip in neonates

    Directory of Open Access Journals (Sweden)

    Patrícia Ponce de Camargo

    2008-12-01

    Full Text Available Estudo transversal com coleta prospectiva de dados, que objetivouidentificar o posicionamento inicial da ponta do cateter central de inserção periférica (PICC e verificar a prevalência de sucesso de sua inserção em neonatos. Os dados foram coletados no berçário anexo à maternidade do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo, entre março e setembro de 2006. Dos 37 neonatos submetidos à inserção do cateter PICC, a taxa de sucesso no procedimento foi de 72,3% (27 neonatos; destes, quatro (14,8% estavam com as pontas dos cateteres alojadas nas veias axilar ou inominada; outros três (11,1%, alojadas em veia jugular. Estes cateteres foram removidos por desvio de trajeto. 13 (48,2% estavam com as pontas alojadas em átrio direito, cujos cateteres foram tracionados para reposicionamento da ponta para a veia cava superior.Estudio transversal con recolección prospectiva de datos. La finalidad fue identificar la posición inicial de la punta del catéter central de inserción periférica (PICC y verificar la prevalencia de éxitos durante su introducción en neonatos. Los datos fueron recolectados en un servicio de neonatología anexo a la maternidad del Hospital de las Clínicas de la Facultad de Medicina de la Universidad de São Paulo, entre marzo y setiembre del 2006. De los 37 neonatos sometidos a introducción del catéter PICC, la tasa de éxito fue de 72.3% (27 neonatos, de ellos, cuatro (14.8% estaban con las puntas de los catéteres alojadas en las venas axilar o no determinada, tres (11.1% localizadas en la vena yugular. Siendo estos últimos retirados por desviación en su trayecto. El 48.2% (13 se encontraba con las puntas en el atrio derecho, siendo estos catéteres nuevamente posicionados en la vena cava superior.This is a cross-sectional study aiming to identify the initial tip position of peripherally inserted central catheters (PICC and to verify the prevalence of success in inserting

  6. Burden of care and its impact on health-related quality of life of caregivers of individuals with spinal cord injury Sobrecarga del cuidado e impacto en la calidad de vida relacionada a la salud de los cuidadores de individuos con lesión medular Sobrecarga do cuidado e impacto na qualidade de vida relacionada à saúde de cuidadores de indivíduos com lesão medular

    Directory of Open Access Journals (Sweden)

    Paula Cristina Nogueira

    2012-12-01

    del cuidado y peor CVRS se destacaron individuos cuadripléjicos y con complicaciones secundarias. Al asociar la sobrecarga del cuidado con la CVRS se logró que cuanto mayor la sobrecarga peor a CVRS. CONCLUSIÓN: precaver la sobrecarga del cuidado por medio de estrategias de adorno para alta, integración de la red de apoyo y acceso a servicios de salud, podrían minimizar los efectos de la sobrecarga del cuidado y aportar para una mejor CVRS.OBJETIVO: analisar a sobrecarga do cuidado e impacto na Qualidade de Vida Relacionada à Saúde (QVRS dos cuidadores de indivíduos com lesão medular traumática (LMT. MÉTODO: este é um estudo observacional, de corte transversal, realizado por revisão de prontuários e aplicação de questionários. Foram utilizadas as escalas Short Form 36 (SF-36 para avaliar a QVRS, Caregiver Burden Scale (CBScale para sobrecarga do cuidado, e os resultados foram analisados quantitativamente. A maioria dos indivíduos com LMT era do sexo masculino, com média de idade de 35,4 anos, com predomínio de lesão torácica, seguida de lesão cervical. A maioria dos cuidadores era do sexo feminino, com média de idade de 44,8 anos. RESULTADO: das características clínicas que contribuíram para maior sobrecarga do cuidado e pior QVRS destacaram-se indivíduos com tetraplegia e com complicações secundárias. Ao associar a sobrecarga do cuidado com a QVRS, obteve-se que quanto maior a sobrecarga pior a QVRS. CONCLUSÃO: prevenir a sobrecarga do cuidado por meio de estratégias de preparo para alta, integração da rede de apoio e acesso a serviços de saúde, poderia minimizar os efeitos da sobrecarga do cuidado e contribuir para melhor QVRS.

  7. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  8. Acanthamoeba sp.: un caso de queratitis no relacionada con el uso de lentes de contacto Acanthamoeba sp.: a case report in a non-contact lens wearer

    Directory of Open Access Journals (Sweden)

    Claudia Menghi

    2012-12-01

    Full Text Available La queratitis por Acanthamoeba sp. generalmente se relaciona con el uso de lentes de contacto y en menor proporción se vincula con el contacto con agua contaminada. Se caracteriza por una disminución de la capacidad visual y la presencia de un fuerte dolor ocular. al examen clínico, puede confundirse con una infección herpética. Si la infección no es diagnosticada y tratada a tiempo en forma adecuada, puede culminar en la perforación de la córnea y, eventualmente, en la pérdida del ojo. en este trabajo se informa uno de los pocos casos registrados de queratitis por Acanthamoeba sp. no relacionada con el uso de lentes de contacto.Acanthamoeba sp. keratitis is generally related to wearing contact lenses, and, to a lesser extent, to contaminated water. it is characterized by reduced visual capacity and the presence of severe ocular pain. Clinically, it can be mistaken for a herpes infection. if it is not diagnosed, and timely and adequately treated, it can result in corneal perforation and, eventually, in vision loss. One of the few registered cases of Acanthamoeba sp. keratitis not related to the use of contact lenses is herein reported.

  9. Cateter central de inserção periférica: descrição da utilização em UTI Neonatal e Pediátrica Catéter central de inserción periférica: descripción da utilización en UTI Neonatal y Pediátrica Peripherally inserted central catheter: description of its utilization in Neonatal and Pediatric ICU

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Baggio

    2010-03-01

    Full Text Available Estudo descritivo, retrospectivo, documental que objetivou descrever a utilização do cateter central de inserção periférica (PICC em uma Unidade de Terapia Intensiva Neonatal e Pediátrica quanto à inserção, manutenção e remoção, e identificar o perfil das crianças que receberam PICC, por meio de análise descritiva e estatística de 176 instrumentos preenchidos por enfermeiros, em um período de dois anos. A população assistida foi de 125 pacientes, principalmente prematuros (43,2% e do sexo masculino (60%. Para inserção do dispositivo as veias basílica e cefálica (43,2% e o cateter 1.9 Fr (85,8% foram utilizados. Houve índice de sucesso nas punções (98,9%, porém a remoção antecipada ocorreu em virtude de obstrução (25%, infiltração (18%, suspeita de contaminação (16,6%, tração (13,9%, ruptura (11,2%, retirada acidental (8,3%, flebite (4,2%, cianose (1,4% e migração (1,4%, com média de permanência de 14,5 dias. Para a manutenção do cateter é requerida a capacitação e a educação permanente dos profissionais, estratégias que qualificam a assistência.Estudio descriptivo, retrospectivo, documental, cuyo objetivo fue describir la utilización del catéter central de inserción periférica (PICC en una Unidad Pediátrica de Cuidados Intensivos en relación con la inserción, mantenimiento y remoción, e identificar el perfil de los niños que lo recibieron PICC, por medio de análisis descriptivo y estadístico de 176 instrumentos diligenciados por enfermeros, en un período de dos años. La población asistida fue de 125 pacientes, principalmente prematuros (43,2%, de sexo masculino (60%. Para inserción del dispositivo las venas basílica y cefálica (43,2% y el catéter 1.9 Fr (85,8% fueron principalmente utilizados. El éxito en las punciones fue (98,9%, aunque la remoción anticipada ocurrió en virtud de obstrucción (25%, infiltración (18%, sospecha de contaminación (16,6%, tracción (13

  10. Titanium alloys (AoN) and their involvement in osseointegration.

    Science.gov (United States)

    Danza, Matteo; Zollino, Ilaria; Candotto, Valentina; Cura, Francesca; Carinci, Francesco

    2012-12-01

    Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. The expression levels of some bone-related (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analyzed using real time reverse transcription-polymerase chain reaction (real time RT-PCR). Real-time RT-PCR data showed that after 3 days of treatment with TiA4GR, the genes up-regulated were COL3A1, ALPL, SPP1, and RUNX2. Moreover, no difference in gene expression was noticed 4 days later. On the other hand, the genes that overexpressed after 3 days of treatment with AoN5GR were ALPL, SPP1, and RUNX2. In both cases, the expression of COL1A1 and SPARC was negatively regulated. Our data showed that both titanium surfaces led to osteoblasts recruitment, maturation, and differentiation, thus promoting osseointegration at the tissue-implant interface.

  11. Atribuições de significados ao transplante renal

    Directory of Open Access Journals (Sweden)

    Quintana, Alberto M.

    2011-01-01

    Full Text Available Este trabalho teve foco na investigação das atribuições de significados ao transplante renal de pacientes com Insuficiência Renal Crônica (IRC de um Hospital Universitário da Região Sul. Foi utilizado um método qualitativo e participaram doze pessoas na pesquisa. Os instrumentos utilizados foram a entrevista semidirigida e a autofotografia. Para a análise dos dados foi empregada a técnica de análise de conteúdo, o que permitiu que fossem construídas quatro categorias temáticas: a ansiedade da espera, os conflitos ante o doador, as expectativas em relação ao devir e a vida antes e depois do transplante. Constatou-se que a possibilidade deste traz consigo uma série de repercussões psíquicas devido o fato de ser visto como algo que restitui a vida, proporciona bem-estar e sentimento de liberdade, mesmo levando em consideração que ainda persistem os cuidados com o corpo, com a alimentação e com os remédios

  12. New Results from the AO327 Drift Pulsar Survey

    Science.gov (United States)

    Deneva, Julia S.; Stovall, K.; McLaughlin, M.; Bates, S.; Freire, P.; Martinez, J.; Jenet, F.; Bagchi, M.

    2014-01-01

    The Arecibo 327 MHz drift pulsar survey (AO327) has operated since 2010 and aims to cover the entire Arecibo sky (declinations of -1 to 38 degrees). We present details on the progress of the survey and a new set of discoveries over the past year. Phase 1 of AO327 targets declinations of -1 to 28 degrees and is 55% complete; Phase 2 will target declinations of 28 to 38 degrees. The survey is expected to be completed in 2017. Out of a total of 28 new pulsars, 12 were found in 2013, including three millisecond pulsars. PSR J2234+06 has a rotation period of 3.58 ms and is in a 32-day orbit in a binary system with a white dwarf companion. This pulsar is bright and a very stable rotator, making it suitable for inclusion in Pulsar Timing Arrays. The orbit of J2234+06 has an eccentricity of 0.13, which cannot be accounted for by stellar evolution but may be explained by an origin in a subsequently disrupted hierarchical triple, or by an exchange interaction. PSR J0509+08 has a period of 4.06 ms and is in a 4.9-day binary system with a white dwarf companion. This pulsar is also a candidate for inclusion in PTAs.

  13. UMA PROPOSTA DE ABORDAGEM AO PROBLEMA DE FLÁVIO JOSEFO APLICADA AO ENSINO MÉDIO

    OpenAIRE

    Márcia Erondina Dias de Souza

    2013-01-01

    Neste trabalho, apresentamos uma sequência didática de atividades elaboradas para um grupo de alunos do ensino médio, na faixa etária de 15 a 18 anos, tendo como principal objetivo estudar o problema proposto pelo matemático Flávio Josefo, nos meados do ano 64. Conta a lenda que um grupo de rebeldes, dentre eles Flávio Josefo, foi encurralado numa caverna pelo exército inimigo. Preferindo o suicídio à captura, os rebeldes decidiram formar um círculo e, contando ao longo dest...

  14. OBSOLESCÊNCIA PROGRAMADA E TEORIA DO DECRESCIMENTO VERSUS DIREITO AO DESENVOLVIMENTO E AO CONSUMO (SUSTENTÁVEIS)

    OpenAIRE

    Oliveira da Silva, Maria Beatriz Beatriz; UNiversidade Federal de Santa Maria (UFSM)

    2012-01-01

    Inspirado em um documentário intitulado “Prêt à Jeter”, este texto tem como objetivo central colocar em apreciação algumas reflexões acerca da obsolescência programada como uma das estratégias do modelo de desenvolvimento capitalista e ensaiar uma reposta às seguintes questões: para combater a obsolescência programada se faz necessária a defesa de uma “teoria do decrescimento”? Sendo a obsolescência programada uma das estratégias da sociedade de consumo, é possível combatê-la e, ao mesmo temp...

  15. Variables involved in the perception of psychological harassment in the nursing work environment Variables relacionadas con la percepción del asedio moral en el ambiente laboral de la enfermería Variáveis envolvidas na percepção do assédio moral no ambiente laboral da Enfermagem

    Directory of Open Access Journals (Sweden)

    Kátia Biagio Fontes

    2012-08-01

    los últimos doce meses, el periodo y la frecuencia de las conductas. Al final del cuestionario fue adicionada una cuestión dicotómica relacionada a la percepción del enfermero cuanto a sentirse víctima de asedio moral en el trabajo. Los dos cuestionarios fueran aplicados electrónicamente e impresos entre mayo y septiembre de 2010. Los datos fueran tratados por estadística descriptiva. Los resultados mostraron que los sujetos se sintieron víctimas de asedio moral. Solamente las variables relacionadas a la caracterización del asedio moral presentaron asociación significativa. Entre las conductas más referidas, se destacaron: "Cuestionan las decisiones que usted toma" y "Usted recibe ataques verbales criticando trabajos realizados". Es importante la apertura de espacios de discusión sobre la violencia en el trabajo para que gestores puedan establecer medidas estratégicas de prevención y contención de este tipo de violencia a fin de garantizar la salud, la dignidad y el bienestar del profesional en el trabajo. También es importante discutir el tema en el ámbito académico, con el fin de dar mayor visibilidad a la cuestión, para que los futuras enfermeros puedan identificar y abordar adecuadamente este tipo de violencia.Trata-se de estudo descritivo-exploratório, de abordagem quantitativa, com o objetivo de identificar a percepção de enfermeiros sobre o assédio moral no trabalho, condutas vivenciadas e variáveis envolvidas. Na coleta de dados, utilizaram-se dois questionários: um socioprofissiográfico e outro para identificar as condutas de assédio moral, vivenciadas pelos sujeitos nos últimos 12 meses, o período e a frequência das condutas. Ao final do questionário, foi adicionada uma questão dicotômica que abordava a percepção do enfermeiro em relação a se sentir vítima de assédio moral no trabalho. Ambos os questionários foram aplicados no formato eletrônico e impresso, entre maio e setembro de 2010. Os dados foram tratados por

  16. Tendência da mortalidade relacionada à varicela no Estado de São Paulo, Brasil, 1985 a 2004: estudo usando causas múltiplas de morte Chickenpox-related mortality trends in the state of São Paulo, Brazil, 1985-2004: a multiple cause approach

    Directory of Open Access Journals (Sweden)

    Augusto Hasiak Santo

    2007-08-01

    Full Text Available OBJETIVO: Estudar a tendência da mortalidade relacionada à varicela tanto como causa básica quanto como causa associada de morte (informada em qualquer linha ou parte do atestado médico da declaração de óbito. MÉTODOS: Os dados provieram dos bancos de causas múltiplas de morte da Fundação Sistema Estadual de Análise de Dados de São Paulo (SEADE entre 1985 e 2004. As causas de morte foram processadas pelo Tabulador de Causas Múltiplas. RESULTADOS: Nesse período de 20 anos, ocorreram 1 037 óbitos em que a varicela foi identificada como causa básica e 150 nos quais foi causa associada. Os coeficientes de mortalidade pela causa básica foram superiores e declinaram, ao passo que a mortalidade por varicela como causa associada apresentou um pequeno aumento. Setenta e seis por cento das mortes ocorreram em menores de 10 anos de idade, especialmente nos menores de 1 ano. Ocorreu concentração de mortes entre os meses de julho e janeiro (86,8% do total de 1 187 óbitos, com valores máximos em outubro. Os coeficientes de mortalidade da capital para a varicela como causa básica e associada foram, respectivamente, 47,1 e 50,0% maiores do que os do interior do Estado. Para a varicela como causa básica, as pneumonias e septicemias foram as principais causas associadas, ao passo que para a varicela como causa associada, a AIDS e as neoplasias foram as principais causas básicas de morte. CONCLUSÕES: Em que pese o declínio da varicela como causa básica de morte, este estudo permitiu evidenciar o impacto da mortalidade relacionada à varicela em grupos de risco específicos, entre os quais as crianças entre 1 e 4 anos e os indivíduos com AIDS e neoplasias.OBJECTIVE: To study mortality trends related to chickenpox, as either the underlying or associated cause-of-death (recorded in any field of the medical section of the death certificate, in São Paulo, Brazil. METHODS: Mortality data for 1985-2004 were obtained from the multiple cause

  17. Parâmetros bioquímicos e cinética de lactato sanguíneo de sujeitos HIV+ submetidos ao treinamento físico combinado

    Directory of Open Access Journals (Sweden)

    Joice Cristina dos Santos TROMBETA

    2015-12-01

    Full Text Available Resumo O objetivo deste estudo foi verificar a cinética de lactato sanguíneo (CLS e a sua resposta ao treinamento físico combinado (TFC bem como avaliar os efeitos sobre os aspectos bioquímicos, imunológicos, cardiorrespiratório e composição corporal de pessoas vivendo com HIV/AIDS. Doze voluntários HIV+ realizaram o TFC, por um período de 16 semanas, e foram submetidos às avaliações nos momentos pré, oito e 16 semanas de TFC. Ao final, houve um aumento das células TCD4+ e manutenção da carga viral, aumento do consumo máximo de oxigênio e da força muscular e, ainda, aumento do HDL-c e diminuição dos triglicerídeos e glicemia de jejum. Ainda, ocorreu aumento da CLS após o período de treinamento. Concluímos que o TFC influenciou positivamente os parâmetros imunológicos, bioquímicos, cardiorrespiratório e muscular, no entanto, a questão relacionada à CLS necessita de estudos futuros para maiores esclarecimentos.

  18. "EU GANHEI MAIS O GOSTO DE ESTUDAR": O E-LEARNING COMO UM MEIO DE APRENDIZAGEM AO LONGO DA VIDA DE RECLUSAS DE UM ESTABELECIMENTO PRISIONAL PORTUGUÊS

    Directory of Open Access Journals (Sweden)

    Angélica Monteiro

    Full Text Available RESUMO: O artigo estudou as percepções de reclusas sobre formação na modalidade e-learning, num estabelecimento prisional feminino de Portugal. A análise do curso e da formação, inscritos no paradigma de aprendizagem ao longo da vida, objetiva estudar a possibilidade do e-learning constituir um dispositivo de diferenciação pedagógica que promove a inclusão digital. Os dados relativos ao percurso de aprendizagem em regime de e-learning foram recolhidos por dois questionários e um grupo focal. A análise dos dados evidencia que essas formandas, reclusas, consideram que a experiência de formação em e-learning lhes devolveu a confiança de que ainda têm capacidade de realizar novas aprendizagens, com impacto em perspectivas relacionadas a uma futura inserção no mercado de trabalho.

  19. Performance of the Sewage Treatment Plant of S˜ao Jo˜ao de Iracema (Brazil

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    2016-05-01

    Full Text Available Context: Some of the most important parameters measured in the sewage treatment plant –STP- are: organic matter, solids and faecal organisms. The objective of this work was to diagnose the performance of S˜ao Jo˜ao de Iracema STP for those parameters removal. Method: A batimetric survey of the anaerobic and facultative lagoons; the STP influent and effluent monitoring in three different climate seasons of 3-month long each were conducted by dissolved oxygen, pH, temperature, BOD, filtered BOD, COD, solids and coliforms measuring. Results: Sludge accumulations of 1.3 and 6.5% in the anaerobic and facultative lagoons were registered; average BOD removal was of 73.6%, smaller than the 80% recommended by Brazilian legislation; the average faecal coliform number on final effluent was of 9.55*106/100mL, above the per-missible limit of 1000/100mL. Conclusions: The STP needs to set-up a post treatment system that guarantees additional organic matter removal and fecal coliforms in order to adjust the effluent quality to the environmental legislation standards.

  20. Determinantes da adesão ao tratamento anti-retroviral em Brasília, DF: um estudo de caso-controle Determinants of antiretroviral treatment adherence in Brasília, Federal District: a case-control study

    Directory of Open Access Journals (Sweden)

    Cláudio Viveiros de Carvalho

    2007-10-01

    Full Text Available Buscou-se avaliar os fatores relacionados à adesão ao tratamento anti-retroviral no Distrito Federal. De 150 pacientes entrevistados em sete centros de referência, 35 não aderentes foram definidos como casos, sendo selecionados 70 controles aderentes, pareados por idade. Avaliaram-se variáveis sócio-demográficas, hábitos, suporte social, qualidade de vida, questões relacionadas a doença, estado clínico, tratamento e serviço. Na análise bivariada, houve associação da adesão com raça/cor, escolaridade, centros de referência em que faz acompanhamento e renda familiar. Após ajuste, cor parda, centros de referência localizado no Plano Piloto, escolaridade alta e receber apoio dos amigos quanto às necessidades permaneceram associados com adesão. Retirando raça/cor do modelo, mantiveram-se centros de referência, escolaridade, profissão, renda, apoio (contar com alguém que demonstre gostar de você e satisfação com o atendimento na farmácia de dispensação. Além dos fatores já consolidados na literatura, questões relacionadas ao apoio no âmbito micro-social e aos serviços de assistência mostraram-se associados à observância terapêutica.We sought to evaluate factors relating to adherence to antiretroviral treatment in the Federal District. Out of 150 patients interviewed at seven reference centers; 35 non-adherent subjects were considered to be cases; we selected 70 age-matched adherent individuals as controls. Variables relating to sociodemographics, habits, social support, quality of life, disease-related issues, clinical conditions, treatment and healthcare services were evaluated. Bivariate analysis showed that adherence was associated with race/color, educational level, the reference center where the patient was followed up and familial income. After adjustments, mixed race (parda, reference center location in central Brasília, high educational level and friends’ support for needs remained associated with

  1. Forma musical como um processo: do isomorfismo ao heteromorfismo

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2016-05-01

    Full Text Available Este artigo se propõe a analisar a questão da forma musical a partir do momento em que temos, no início do século XX, uma ruptura com sua predeterminação, passando a se configurar como o resultado de diferentes operações ou processos de composição. Neste contexto, abordamos a noção de forma estatística, ligada ao isomorfismo e à continuidade entre as diferentes escalas temporais presentes numa obra musical (MEYER-EPPLER, 2009 [1954]; STOCKHAUSEN 1959; EIMERT, 1959 e ao princípio do grau de mudança (STOCKHAUSEN, 1989b [1958]; KOENIG, 1963, 1965, bem como a noção da forma como uma emergência, ligada ao heteromorfismo e à descontinuidade entre as diversas escalas temporais (VAGGIONE, 1994, 2010. Para tanto, trazemos como fundamentação teórica o método alagmático e o princípio da individuação das formas de Gilbert Simondon (2005, assim como as características morfológicas perceptivas de saliência (saillance e pregnância (prégnance de René Thom (1988, 1990a, além de sua teoria das catástrofes (THOM, 1985. No contexto proposto, a fusão de timbres é pensada como um processo alagmático gerador de novas formas, sendo analisada a partir de diferentes possibilidades tais como por jitter (DUBNOV; TISHBY; COHEN, 1997, síntese granular, permeabilidade (LIGETI, 2010a [1958], micropolifonia (LIGETI, 2010c [1980] e convolução (ERBE, 1997; JAFFE, 1987; ROADS, 1993; VAGGIONE, 1996. Concluímos a respeito dos processos de fusão analisados não apenas considerando-os isoladamente, mas como operações que propiciam o nascimento da forma musical, afirmando o pensamento da forma como um processo e não como algo definido a priori.

  2. Neuroaccounting: a contribuição da neurociência para a análise da decisão relacionada a metas orçamentárias - doi: 10.4025/enfoque.v31i3.17320

    Directory of Open Access Journals (Sweden)

    Ana Maria Roux Valentini Coelho Cesar

    2012-12-01

    Full Text Available Os modelos clássicos em Economia não explicam como as variáveis de natureza psicológica interferem nos processos racionais de decisão. Este estudo parte de modelo decisório desenvolvido a partir de estudos recentes na área de neurociências. Com enfoque qualitativo, o estudo tem por objetivo captar o comportamento declarado de seis gestores de empresas de grande porte que atuam nas áreas de Contabilidade e Finanças quando estes tomam decisões relacionadas ao nível de metas orçamentárias. Os dados foram colhidos com entrevistas semi estruturadas e analisados com o método de análise de conteúdo. Os resultados mostram que os gestores utilizam métodos tradicionais para decisão, tanto para captar informações quanto para analisá-las, conforme esperado. Todavia, utilizam o que denominam feeling, que no estudo foi identificado como o uso de respostas condicionadas de acordo com as consequências auferidas pelas decisões, ou baseadas em reconhecimento de padrões ambientais (que não necessariamente foram analisados em termos de racionalidade. Também se observou que as decisões são afetadas por aspectos afetivos e por influência social. Outros estudos devam ser feitos para se aumentar o escopo da pesquisa, sendo este uma das limitações do estudo.

  3. Ablação da fibrilação atrial por cateter com radiofreqüência guiada por mapeamento espectral endocárdico dos "ninhos de FA" em ritmo sinusal Radiofrequency catheter ablation of atrial fibrillation guided by spectral mapping of atrial fibrillation nests in sinus rhythm

    Directory of Open Access Journals (Sweden)

    José Carlos Pachón Mateos

    2007-09-01

    Full Text Available FUNDAMENTO: Através de mapeamento espectral-(ME endocárdico em ritmo sinusal, observam-se dois tipos de miocárdio atrial: o compacto de espectro liso e o fibrilar de espectro segmentado ("Ninho de FA" [NFA]. Durante a FA o compacto tem ativação organizada e baixa freqüência (passivo enquanto o fibrilar apresenta ativação bastante desorganizada e alta freqüência (ativo/ressonante sendo ambos ativados por uma taquicardia protegida de alta freqüência, taquicardia de background (TB. OBJETIVO: Descrever o tratamento da FA pela ablação dos NFA e da TB. MÉTODOS: 1 Ablação por cateter-RF [4/8mm-60º/30-40J/30s] dos NFA guiada por ME em ritmo sinusal, fora das veias pulmonares; 2 Estimulação atrial-300ppm; 3 Ablação adicional de NFA se induzida FA; 4 Ablação focal se induzida TB e/ou Flutter; 5 Seguimento clínico+ECG+Holter. RESULTADOS: Foram tratados 50±18 NFA/paciente. Após 11,3±8m 81p (88% estavam sem FA (28,3% com antiarrítmico. Após a ablação dos NFA: a FA não foi reinduzida em 61p(71%; TB foi induzida e tratada em 24p(26%. Ocorreram 2 sangramentos pericárdicos (1 tratado clinicamente e 1 cirurgicamente ocasionados por bainhas não mais utilizadas. CONCLUSÃO: O ME em ritmo sinusal ablaciona os NFA. Durante a FA os NFA apresentam um padrão reativo-ressonante e o miocárdio compacto apresenta-se passivo, estimulados pela alta freqüência da TB. Após a ablação dos NFA e da TB não foi possível reinduzir FA sustentada. A ablação dos NFA fora das VP se mostrou segura e altamente eficiente para a cura e/ou o controle clínico da FA.BACKGROUND: Two types of myocardia can be observed through the endocardial spectral mapping (SM in sinus rhythm: the compact type with a smooth spectrum and the fibrillar type with a segmented spectrum (atrial fibrillation nests. During the atrial fibrillation (AF, the compact type has an organized activation and low frequency (passive, whereas the fibrillar type has a rather

  4. Apresentação clínica da alergia ao leite de vaca com sintomatologia respiratória Clinical presentation of cow milk allergy symptoms

    Directory of Open Access Journals (Sweden)

    FÁBIO FERREIRA DE CARVALHO JUNIOR

    2001-01-01

    Full Text Available Os alérgenos do leite de vaca são os primeiros antígenos a entrar em contato com a criança. A sintomatologia, em geral multissistêmica, pode estar relacionada ao trato gastrointestinal, à pele e, raramente, ao aparelho respiratório. Objetivo: Descrever algumas características clínicas e epidemiológicas de crianças com alergia ao leite de vaca com sintomas respiratórios. Casuística e método: Foram avaliadas retrospectivamente 17 crianças com acometimento do trato respiratório imediato à ingestão de leite de vaca que, com a exclusão deste tipo de alimento por quatro a seis semanas, se tornaram assintomáticas e, posteriormente, voltaram a apresentar sintomas respiratórios com a reintrodução, em ambiente hospitalar, do leite de vaca. Resultados: Não houve diferença quanto ao sexo e 14 das 17 crianças tinham antecedentes atópicos familiares. O tempo médio do aleitamento materno exclusivo foi de 2,9 meses e o do início dos sintomas, de 3,6 meses. Oito dos dez testes de hipersensibilidade cutânea imediata ao leite de vaca foram positivos. As manifestações clínicas foram: lactente chiador (nove, asma (cinco, otite de repetição (duas, deficiência seletiva de IgA associada com broncoespasmo (duas, rinoconjuntivite alérgica (uma. Conclusão: Em lactentes chiadores a alergia ao leite de vaca deve ser incluída no diagnóstico diferencial e em pacientes com antecedentes familiares atópicos deve ser estimulado o aleitamento materno exclusivo. Entretanto, o diagnóstico preciso é importante para evitar privações alimentares desnecessárias.Cow milk allergens are the first antigens children have contact with. The symptoms, which are frequently multi-systemic, may be related to the gastrointestinal tract, to the skin and, more rarely, to the respiratory tract. Objective: To describe some clinic and epidemiological characteristics of children who have cow milk allergy and present respiratory symptoms. Patients and method

  5. Manejo de capim pé-de-galinha em lavouras de soja transgênica resistente ao glifosato Management of goose grass on transgenic soybean, resistant to glyphosate

    Directory of Open Access Journals (Sweden)

    André da Rosa Ulguim

    2013-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a resistência de capim pé-de-galinha (Eleusine indica ao glifosato, em lavouras de soja transgênica; avaliar o efeito de aplicações de glifosato em diferentes estádios de desenvolvimento; identificar práticas agronômicas associadas à seleção de biótipos resistentes; e avaliar a eficiência dos herbicidas cletodim, fluazifope-P-butílico, clomazona, glufosinato de amônio e glifosato nas plantas resistentes. Plantas escapes ao tratamento com glifosato foram coletadas em 24 propriedades, no Rio Grande do Sul. As plantas foram cultivadas em casa de vegetação, tendo-se avaliado a sua resistência ao glifosato. Os acessos resistentes foram selecionados e avaliados quanto ao efeito da aplicação do glifosato em diferentes estádios de crescimento e quanto à sensibilidade aos herbicidas. Foi aplicado um questionário aos produtores para identificação das práticas agronômicas associadas às falhas no controle. O controle de E. indica pelo glifosato é mais efetivo com a aplicação em estádios iniciais de desenvolvimento. Práticas agronômicas, como uso contínuo de baixas doses do herbicida, aplicação em estádios de desenvolvimento avançados das plantas daninhas (mais de um afilho e a ausência de rotação de culturas foram relacionadas às falhas de controle observadas. Os herbicidas cletodim, fluazifope-P-butílico e glufosinato de amônio são alternativas eficientes para o controle de E. indica.The objective of this work was to evaluate the resistance of goose grass (Eleusine indica to glyphosate application in transgenic soybean crops; evaluate the effect of glyphosate applications in different growth stages; identify the main agronomic practices associated with the selection of resistant biotypes; and evaluate the effect of the herbicides clethodim, fluazifop-p-butyl, clomazone, glufosinate ammonium, and glyphosate on resistant plants. Plants that survived glyphosate application

  6. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  7. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  8. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Cenir Gonçalves Tier; Valéria Lerch Lunardi; Silvana Sidney Costa Santos

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar ...

  9. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Tier, Cenir Gonçalves; Lunardi, Valéria Lerch; Santos, Silvana Sidney Costa

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edg...

  10. Empreendedorismo: do ensino básico ao ensino superior

    OpenAIRE

    Gonçalves, Vitor

    2009-01-01

    A Sociedade da Informação exige cada vez mais indivíduos com capacidade e espírito empreendedor. Embora seja visto como uma resposta ao problema do desemprego através da promoção do auto-emprego, o empreendedorismo deve assumir uma semântica mais abrangente. Não basta correr o risco e criar empresas, é necessário procurar fazê-lo com responsabilidade, competência e excelência. Mas, essa atitude empreendedora não é apenas apanágio dos gestores ou empresários, terá de ser também uma necessi...

  11. MODERNIDADE E LIBERTAÇÃO: DOIS DESAFIOS AO CRISTIANISMO

    Directory of Open Access Journals (Sweden)

    . Editorial

    1987-01-01

    Full Text Available A recente Assembléia Geral da Sociedade de Teologia e Ciências da Religião (SOTER, reunida em Belo Horizonte de 6 a 9 de julho passado, dedicou boa parte de seus trabalhos ao "debate em torno da Modernidade em relação com as preocupações da Teologia da Libertação no Brasil". Está mais uma vez relançada a sempre conflitiva questão da relação entre Cristianismo e Modernidade, só que agora percebida num Continente que não simplesmente goza de algumas luzes da Modernidade, como também sofre efeitos perversos deste processo histórico.

  12. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  13. Sophia, Mésseder e um Timor contado aos jovens

    OpenAIRE

    Albuquerque, Pedro; Azevedo, Fernando; Vergopolan, Roseli

    2015-01-01

    Devido a sucessivos e quase ininterruptos períodos bélicos e de ocupação, a fragilidades socioeconómicas e à ausência de um ensino sistematizado numa língua oficial, a produção literária timorense escrita revela-se bastante modesta. Apesar de a literatura timorense ter assistido ao despertar do género romanesco - sendo Luís Cardoso o mais proeminente escritor de Timor -, a invenção literária dedicada a um público mais jovem é praticamente inexistente. Ainda assim, os jovens timorenses, que tê...

  14. Factores asociados a la calidad de vida relacionada a la salud en pacientes con cardiopatía coronaria y diabetes mellitus.

    Directory of Open Access Journals (Sweden)

    Moises Barrantes

    2010-07-01

    Full Text Available mellitus. Material y métodos: Se utilizó el cuestionario (SF-36 y se incluyeron 70 pacientes diabéticos y 140 no diabéticos admitidos por un evento coronario agudo en la Unidad Coronaria del Hospital Nacional Edgardo Rebagliati Martins entre diciembre 2006 y diciembre 2007. Se realizó análisis multivariado para determinar los factores asociados a los dos componentes sumarios de la calidad de vida relacionada a la salud (CVRS y si la diabetes mellitus era un factor independiente. Resultados: Ambos grupos de estudio tuvieron, en general, similares características basales. En la estimación de la calidad de vida global, los pacientes diabéticos tuvieron índices significativamente menores de percepción solamente en el componente sumario físico. Se construyeron modelos de regresión lineal múltiple entre ambos componentes sumario de la CVRS y las variables de estudio, identificándose la edad avanzada, el género femenino y la diabetes mellitus como los principales factores asociados a la CVRS. Conclusión: La edad, el género, el sobrepeso y la obesidad, la hemoglobina glucosilada, la diabetes mellitus, el antecedente de enfermedad coronaria, las comorbilidades, el estado civil y el nivel socioeconómico son factores asociados a la CVRS en pacientes con cardiopatía coronaria y diabetes mellitus.(Rev Med Hered 2010;21:118-127.

  15. Representaciones sociales relacionadas con la alimentación escolar: el caso de las escuelas públicas de la Ciudad de México

    Directory of Open Access Journals (Sweden)

    Florence L. Théodore

    2011-01-01

    Full Text Available México está confrontando una epidemia de sobrepeso/obesidad sin precedentes, en particular entre los niños. El objetivo de este trabajo fue identificar las principales representaciones sociales relacionadas con la alimentación en la escuela, presentes en los discursos de los diferentes actores escolares. Se realizaron 20 entrevistas con actores escolares y 10 grupos de discusión con niños y niñas de 12 escuelas. Se identificaron tres principales concepciones, representaciones en las que estructuran su relación con la alimentación en la escuela, 1 comida "chatarra" versus comida casera, 2 valoración de la fruta desde diferentes perspectivas, 3 función placentera de la comida escolar. Se argumentará la contribución de esta información para entender mejor la oferta y el consumo de los escolares. El estudio permitió identificar algunos elementos que estructuran profundamentela relación de los diferentes actores escolares con la alimentación escolar y que se relacionan con, 1 presencia en los discursos de ideas y conocimientos sobre la alimentación, a veces opuestos y generados por diferentes campos de saberes, que muestran el carácter dinámico y complejo del hecho alimentario, 2 interiorización por parte de los niños de un sistema de jerarquización de los alimentos, 3 carácter identitario de la alimentación.

  16. Potencial antimicrobiano de seis plantas do semiárido paraibano contra bactérias relacionadas à infecção endodôntica

    Directory of Open Access Journals (Sweden)

    Eveline Angélica Lira de Souza Sales Rocha

    2013-08-01

    Full Text Available Com o aumento dos microrganismos resistentes às substâncias antimicrobianas já conhecidas, vários extratos de plantas medicinais foram testados com a finalidade de procurar novos compostos com atividade antimicrobiana reconhecida. Assim este estudo teve como objetivo avaliar a atividade antimicrobiana de diferentes extratos vegetais em bactérias relacionadas à infecção endodôntica. Foram testados os extratos hidroalcóolicos das espécies Syderoxylum obtusifolium Roem e Schult (quixabeira, Bauhínia forficata Linn (mororó, Anadenanthera colubrina Brenan (angico, Spondias tuberosa Arruda (umbuzeiro, Tabebuia pentaphylla Vell. (ipê rosa e Guapira graciliflora Mart. (joão-mole, contra o Enterococcus faecalis, Staphylococcus aureus e Escherichia coli. Foram realizados os ensaios antimicrobianos pela técnica do disco difusão em ágar e pelo método de microdiluição em caldo. Todos os extratos analisados apresentaram atividade antimicrobiana contra pelo menos uma espécie bacteriana. Os melhores resultados foram encontrados com T. pentaphylla Vell e G. graciliflora Mart, apresentando atividade contra todas as cepas testadas, destacando-se a atividade de T. pentaphylla Vell frente a S.aureus na concentração de 0,78µl/µl e da casca de G. graciliflora Mart frente a E.faecalis na concentração de 6,25µl/µl. Os resultados sinalizam o potencial antimicrobiano dessas plantas, podendo ser promissoras para estudos de desenvolvimento de novos produtos de uso endodôntico.

  17. Incidência de acidentes de trabalho relacionada com a não utilização das precauções universais

    Directory of Open Access Journals (Sweden)

    Marcia de Souza

    1993-12-01

    Full Text Available Entrevistados todos (57 os funcionários do serviço de enfermagem de um hospital geral governamental de São Paulo, que sofreram acidentes de trabalho relacionados a materiais pérfuro-cortantes, ou que tiveram contato com sangue ou fluidos corpóreos contaminados no período de janeiro a setembro de 1992. Desses, 15,8% (9 eram enfermeiras, 49,1% (28 auxiliares de enfermagem, 33,3% (19 atendentes de atendentes de enfermagem e 1,8% (1 escriturária, que apresentavam idade inferior a 40 anos. 66,1% possuiam 2º grau completo ou superior e entre 4 a 7 anos de experiência na função. Em relação ao turno de trabalho, 49,1% dos acidentes ocorreram pela manhã e 38,7% durante a noite, principalmente no Pronto Socorro (36,8%. Materiais pérfuro-cortantes foram responsáveis por 71 ,9% dos acidentes, sendo 75,0% entre os auxiliares de enfermagem. Os funcionários acidentados atribuiram a causa do acidente: a fatalidade, ao descuido ou imprudencia da equipe medica e ao reencape de agulhas. Quanto as consequencias, 57,0% dos acidentados por. respingo de secreção nos olhos desenvolveram conjuntivite e uma das funcionárias, Hepatite B. Este estudo mostrou que 78,1 % dos acidentes poderiam ter sido evitados, 57,0% apenas com o uso das Precauções Universais.

  18. HST and Keck AO Images of Vortices on Jupiter

    Science.gov (United States)

    de Pater, Imke; Wong, M.; Luszcz-Cook, S.; Adamkovics, M.; Marcus, P.; Asay-Davis, X.; Conrad, A.; Go, C.

    2009-09-01

    Observations of Jupiter were conducted in April 2006 and May 2008 with both HST (250-890 nm) and the 10-m Keck telescope. On Keck we used the near-infrared camera NIRC2, coupled to the AO system, at 1.2 to 5 micrometers. At 5 um we are sensitive to Jupiter's thermal emission in cloud-free regions of the atmosphere, while at 1.2 um we see reflected sunlight from hazes and clouds in the troposphere-stratosphere. All small ovals (i.e., all except for Oval BA and the GRS) appear to be surrounded by bright rings at 5 mu, with typical brightness temperatures of 225-250 K, and hence probing depths to 2.5-4 bar. We argue that the small vortices are columnar structures, extending down into the water cloud. Air is rising along the center of these vortices, and descending around the outer periphery; the storm systems are likely fueled by the latent heat released from the water cloud. The descending part of the vertical circulation in the larger ovals is within the ovals, likely at the location of the red ring in Oval BA, which may indicate the maximum radial distance where such return flows can take place. On 19 July 2009, amateur observer Anthony Wesley (Australia) reported a dark spot/streak on Jupiter, near a southern latitude of 56 deg, which he attributed to an impact (analogous to the SL9 impact on Jupiter). We are scheduled to observe Jupiter with the Keck AO system on 24 July 2009 UT; if observations are successful, we will report preliminary results.

  19. Comportamento do gramado submetido aos herbicidas clethodim e sethoxydim.

    Directory of Open Access Journals (Sweden)

    Cleber D. de G. Maciel

    2007-06-01

    Full Text Available O principal fator do custo de manutenção de um gramado é o corte na altura adequada. O crescimento vegetativo e reprodutivo do gramado formado com grama-batatais (Paspalum notatum Flügge, submetido às doses de clethodim e sethoxydim foi avaliado em dois experimentos conduzidos no campus urbano da Escola Superior de Agronomia de Paraguaçu Paulista-ESAPP (SP, em gramado já estabelecido. Foi utilizado o delineamento experimental de blocos casualizados com seis tratamentos e quatro repetições, representados por clethodim nas subdoses de 0,0000; 0,0037; 0,0075; 0,0150; 0,0300 e 0,0600 kg i.a. ha-1, assim como pelo sethoxydim a 0,0000; 0,0156; 0,0312; 0,0625; 0,1250 e 0,2500 kg i.a. ha-1. O clethodim e sethoxydim, aos 7 DAA, intoxicaram as plantas a partir das doses de 0,0300 e 0,1250 kg ha-1, respectivamente. Os sintomas de intoxicação, aos 49 DAA, praticamente desapareceram para todos os tratamentos. O teor de clorofila nas folhas não apresentou diferenças significativas entre as subdoses de clethodim e sethoxydim em relação à testemunha, em nenhuma das épocas estudadas. Houve redução progressiva da altura média e no número de inflorescências do gramado em função do incremento das doses de clethodim e sethoxydim. Estes herbicidas apresentam viabilidade na redução vegetativa e reprodutiva da espécie P. notatum, sendo o sethoxydim mais seletivo em relação à preservação das características visuais do gramado

  20. Estilos de Aprendizagem versus Treinamento Vivencial ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Luciano Munck

    2010-04-01

    Full Text Available O objetivo deste estudo foi analisar a relação entre estilos individuais de aprendizagem e o treinamento vivencial ao ar livre. Os treinamentos vivenciais tiveram como técnicas o arvorismo, dinâmicas de grupo e paintball. Para alimentar a análise, foram aplicados dois instrumentos de pesquisa a cento e cinco participantes dos treinamentos: o Learning Style Inventory (LSI e um questionário para identificação da satisfação. A coleta de dados foi realizada nos próprios locais de treinamento, sendo a identificação dos estilos de aprendizagem realizada antes, e a da satisfação, depois dos treinamentos. Os dados evidenciaram que o estilo de aprendizagem predominante entre os participantes da pesquisa foi o estilo acomodador(24,8%. A satisfação foi predominantemente alta, com 100% das respostas variando entre mais ou menos satisfeito e muito satisfeito (arvorismo P=0,006. Os dados da pesquisa demonstraram fraca influência dos estilos individuais de aprendizagem na maior ou menor satisfação para com os treinamentos recebidos. Em suma, concluiu-se que os treinamentos vivenciais ao ar livre possuem características que proporcionam alta satisfação para diferentes habilidades e estilos de aprendizagem. Informação essa que deveria ser levada em consideração por gestores e líderes no momento de planejar e estruturar programas de treinamento e desenvolvimento para seus colaboradores.

  1. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at the university hospitals in Bern and Lausanne (Switzerland). Patient charts were retrospectively reviewed and fractures were classified from standard radiographs. Results - Of 2,292 upper extremity fractures in 2,203 children and adolescents, 26% involved the humerus and 74% involved the forearm. In the humerus, 61%, and in the forearm, 80% of single distal fractures involved the metaphysis. In adolescents, single humerus fractures were more often epiphyseal and diaphyseal fractures, and among adolescents radius fractures were more often epiphyseal fractures than in other age groups. 47% of combined forearm fractures were distal metaphyseal fractures. Only 0.7% of fractures could not be classified within 1 of the child-specific fracture patterns. Of the single epiphyseal fractures, 49% were Salter-Harris type-II (SH II) fractures; of these, 94% occurred in schoolchildren and adolescents. Of the metaphyseal fractures, 58% showed an incomplete fracture pattern. 89% of incomplete fractures affected the distal radius. Of the diaphyseal fractures, 32% were greenstick fractures. 24 Monteggia fractures occurred in pre-school children and schoolchildren, and 2 occurred in adolescents. Interpretation - The pattern of pediatric fractures in the upper extremity can be comprehensively described according to the PCCF. Prospective clinical studies are needed to determine its clinical relevance for treatment decisions and

  2. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the lower extremities of a representative population of children classified according to the PCCF. Patients and methods - We included patients up to the age of 17 who were diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at either of 2 tertiary care university hospitals in Switzerland. Patient charts were retrospectively reviewed. Results - More lower extremity fractures occurred in boys (62%, n = 341). Of 548 fractured long bones in the lower extremity, 25% involved the femur and 75% the lower leg. The older the patients, the more combined fractures of the tibia and fibula were sustained (adolescents: 50%, 61 of 123). Salter-Harris (SH) fracture patterns represented 66% of single epiphyseal fractures (83 of 126). Overall, 74 of the 83 SH patterns occurred in the distal epiphysis. Of all the metaphyseal fractures, 74 of 79 were classified as incomplete or complete. Complete oblique spiral fractures accounted for 57% of diaphyseal fractures (120 of 211). Of all fractures, 7% (40 of 548) were classified in the category "other", including 29 fractures that were identified as toddler's fractures. 5 combined lower leg fractures were reported in the proximal metaphysis, 40 in the diaphysis, 26 in the distal metaphysis, and 8 in the distal epiphysis. Interpretation - The PCCF allows classification of lower extremity fracture patterns in the clinical setting. Re-introduction of a specific code for toddler's fractures in the PCCF should be considered.

  3. Esofagite ulcerativa associada ao uso de alendronato de sódio: achados histopatológicos e endoscópicos

    Directory of Open Access Journals (Sweden)

    Fernandes Paula Ávila

    2002-01-01

    Full Text Available RACIONAL: A esofagite induzida por drogas pode ser decorrente do contato prolongado do medicamento com a mucosa ou de alterações das condições locais da mucosa esofágica. O uso de alendronato de sódio, um inibidor da reabsorção óssea utilizado na prevenção e tratamento da osteoporose, tem sido recentemente citado como causa de lesões no trato gastrointestinal superior. OBJETIVO: Descrever os achados clínicos, endoscópicos e histopatológicos de pacientes com esofagite ulcerativa associada ao uso de alendronato de sódio. PACIENTES: Quatro pacientes do sexo feminino e um do sexo masculino, em tratamento de osteoporose com alendronato de sódio, submetidos a endoscopia digestiva alta seguida de biopsia esofágica. RESULTADOS: Os pacientes apresentavam idade entre 64 e 84 anos e sintomatologia dispéptica após um período de 2 a 12 meses de uso de alendronato de sódio. A endoscopia digestiva mostrou área de mucosa friável, com erosão e/ou ulceração recobertas por fibrina, localizadas no terço distal do esôfago. O exame histopatológico mostrou esofagite ulcerativa caracterizada por material necrofibrinopurulento e tecido de granulação, além de material amarelado e refringente à luz polarizada. Os pacientes evoluíram com remissão completa dos sintomas após suspensão da droga. CONCLUSÕES: As lesões esofágicas associadas ao uso de alendronato de sódio não são freqüentes e parecem estar relacionadas ao uso incorreto da medicação. Os endoscopistas e patologistas devem ficar atentos à possibilidade do uso de alendronato de sódio diante do diagnóstico de úlceras esofágicas em pacientes idosos, principalmente do sexo feminino. Esta identificação implicaria em melhor tratamento dos pacientes.

  4. Anemia pós-cirurgia bariátrica: as causas nem sempre são relacionadas à cirurgia

    OpenAIRE

    Baretta,Giorgio Alfredo Pedroso; Marchesini,João Batista; Marchesini,João Caetano Dallegrave; Brenner,Sérgio; Sanches,Maria Elize Rocha

    2008-01-01

    RACIONAL: As anemias ferropriva, perniciosa e megaloblástica são comuns após procedimentos bariátricos como o bypass e as derivações biliopancreáticas. As principais causas devem-se ao desvio duodenal e do jejuno proximal do trânsito alimentar e, em menor grau, às úlceras anastomóticas. Entretanto a dieta pobre em nutrientes, a suplementação vitamínica inadequada, medicamentos, uso de álcool e neoplasias devem ser lembrados. RELATO DOS CASOS: Os autores relatam dois casos de pacientes pós-pro...

  5. Análise do nível de adesão ao disclosure do risco de mercado pelos bancos com ações negociadas na BM&FBOVESPA

    Directory of Open Access Journals (Sweden)

    Vinícius Costa da Silva Zonatto

    2015-05-01

    Full Text Available O objetivo deste estudo é analisar o nível de adesão ao disclosure do risco de mercado pelas instituições financeiras com ações negociadas na Bolsa de Valores, Mercadorias e Futuros (BM&F Bovespa, no tocante às recomendações do Acordo de Basileia II, em especial pelos bancos listados nos Níveis Diferenciados de Governança Corporativa da BM&F Bovespa. A metodologia utilizada na pesquisa consistiu num estudo descritivo, realizado por meio de uma pesquisa documental, com abordagem quantitativa dos dados. Os dados foram analisados por meio de consulta aos demonstrativos financeiros padronizados de 2010, disponibilizados por 24 bancos no sitio da BM&F Bovespa. Para tratar os dados foram utilizados o teste de Kolmogorov-Smirnov e o teste não-paramétrico de Mann-Whitney. A análise dos dados permitiu identificar os fatores que evidenciam o grau de transparência das informações relacionadas ao risco de mercado que se tornam necessárias para a tomada de decisão dos stakeholders dessas organizações. Os resultados encontrados indicam que instituições participantes de diferentes níveis de governança corporativa apresentam maior adesão às recomendações do Novo Acordo de Basileia para o disclosure do risco de mercado, do que as instituições participantes do mercado tradicional. No entanto, a partir da aplicação do teste não-paramétrico de Mann-Whitney, verificou-se que as práticas de disclosure das organizações em estudo não possuem diferenças estatisticamente significativas.

  6. Prevalência de lesões bucais associadas ao uso de próteses dentárias removíveis em um serviço de estomatologia

    Directory of Open Access Journals (Sweden)

    Gardênia Matos Paraguassú

    2011-09-01

    Full Text Available As próteses dentárias removíveis restabelecem a função e estética do sistema estomatognático, embora possam causar injúrias aos tecidos bucais. O objetivo deste estudo é avaliar a prevalência de lesões bucais relacionadas ao uso de próteses dentárias removíveis. Foi realizada a revisão de prontuários dos pacientes atendidos no Serviço de Estomatologia da Faculdade de Odontologia da Universidade Federal da Bahia, no periodo de junho de 2006 à dezembro de 2007. Dos 28 indivíduos usuários de próteses dentárias removíveis, 25 (89,3 % apresentaram alguma alteração na mucosa bucal, sendo que 42,8 % destas apresentavam-se mal-adaptadas. A hiperplasia fibrobrosa inflamatória (29,42 %, candidíase crônica atrófica (20,6 %, queilite angular (8,82 % e úlcera traumática (8,82 % foram as lesões mais prevalentes, e a mucosa alveolar (35,3 % e o palato duro (29,4 % os sítios anatômicos mais acometidos. Estes resultados reafirmam a importância da confecção de próteses adequadas, da necessidade de se realizar controles periódicos e fornecer instruções sobre higiene bucal aos pacientes que vierem fazer uso de próteses dentárias removíveis.

  7. IMPLICAÇÕES MONETÁRIAS DAS INFECÇÕES DE SÍTIO CIRÚRGICO AOS SERVIÇOS DE SAÚDE: UMA REVISÃO INTEGRATIVA

    Directory of Open Access Journals (Sweden)

    Suellen Rodrigues de Oliveira Maier

    2015-07-01

    Full Text Available Justificativa e Objetivo: Com o intuito de conhecer os custos relacionados à Infecção do Sítio Cirúrgico (ISC e a que eles estavam atrelados, esta pesquisa pautada na literatura científica foi desenvolvida com o seguinte objetivo: realizar uma revisão integrativa da literatura relacionada aos gastos e custos da infecção de sítio cirúrgico, ou ferida operatória, aos sistemas de saúde. Métodos: Foram selecionados 11 artigos científicos, disponíveis nas bases de dados eletrônicas do Medical Literature Analysis and Retrieval System Online (MEDLINE, e Literatura Latino-Americana em Ciências da Saúde (LILACS, por meio do portal da Biblioteca Virtual em Saúde (BVS. É também, um dos métodos de pesquisa utilizados na Prática Baseada na Evidência (PBE. Resultados: Foi possível observar que as ISC são onerosas aos serviços de saúde, as publicações em muito diferem e os métodos usados não descrevem especificamente como os resultados sobre os custos foram obtidos. Conclusão: Assim, outros estudos que adotem uma avaliação eficaz e padronizada para a obtenção e cálculo dos custos são necessários, para garantir uma maior confiabilidade nas informações obtidas. DESCRITORES: Infecção da ferida operatória. Custos. Serviços de Saúde.

  8. A contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle: um estudo sobre duas empresas de grande porte do setor automotivo

    OpenAIRE

    Quintairos, Paulo César Ribeiro; Andrade, Alequexandre Galvez de; Oliveira, Edson Aparecida de Araújo Querido

    2011-01-01

    A contabilidade gerencial é uma importante ferramenta para o planejamento e controle das organizações, pois integra medidas financeiras e não financeiras. O conjunto dessas informações forma um sistema integrado cuja finalidade é avaliar o alinhamento da produção de uma empresa aos seus objetivos estratégicos. Neste trabalho será apresentado um estudo sobre o uso da contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle de duas empresas de grande porte do setor automob...

  9. Neuropatia auditiva: alerta aos pediatras Auditory neuropathy: alert to pediatricians

    Directory of Open Access Journals (Sweden)

    Flávia Varela Capone

    2011-12-01

    Full Text Available OBJETIVO: Alertar os pediatras sobre a neuropatia auditiva, doença descrita recentemente e ainda desconhecida por muitos médicos. Descrever seus fatores de risco, características clínicas e diagnósticas, com a finalidade de possibilitar uma intervenção terapêutica precoce e eficaz. FONTES DE DADOS: Realizada pesquisa nas bases de dados PubMed, Lilacs e SciELO utilizando os descritores "neuropatia auditiva" e "auditory neuropathy", entre os anos de 1996 e 2010. SÍNTESE DOS DADOS: A neuropatia auditiva, também conhecida como dessincronia auditiva, descrita em 1996, caracteriza-se clinicamente pela dificuldade na compreensão das palavras, mesmo em casos de perdas auditivas leves ou moderadas. Foi relacionada a diversas neuropatias generalizadas e fatores de risco neonatais, como internação em terapia intensiva, hiperbilirrubinemia, sepse e hipóxia. Após suspeita clínica, o diagnóstico é confirmado pela presença das emissões otoacústicas associada a um potencial evocado auditivo de tronco encefálico ausente ou alterado. Sua terapêutica permanece controversa, tendo como opções a protetização auditiva, o acompanhamento fonoterápico para habilitação ou reabilitação da linguagem e, em casos de insucesso, há relatos de resultados satisfatórios com o implante coclear. CONCLUSÕES: Enfatiza-se a importância do reconhecimento pelo pediatra da neuropatia auditiva, entidade ainda pouco citada na literatura latino-americana da especialidade.OBJECTIVE: To alert pediatricians about the auditory neuropathy, a disease that has been only recently described and is still unknown by many physicians, and to describe its risk factors, clinical and diagnostic features in order to enable an early and effective therapeutic intervention. DATA SOURCE: A literature search using terms such as "auditory neuropathy" and "neuropatia auditiva" has been conducted in the PubMed, Lilacs and SciELO databases between 1996 and 2010. DATA SYNTHESIS

  10. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford

    2012-10-01

    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como

  11. Lesão brônquica e pneumotórax após reintubação usando um cateter para troca da via aérea Lesión brónquica y neumotórax posterior a la reintubación usando un catéter para el cambio de la vía aérea Bronchial injury and pneumothorax after reintubation