WorldWideScience

Sample records for recluse spider bite

  1. Spider Bites: First Aid

    Science.gov (United States)

    ... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

  2. Spider Bites (For Parents)

    Science.gov (United States)

    ... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

  3. Brown Recluse spider bite mediated hemolysis: clinical features, a possible role for complement inhibitor therapy, and reduced RBC surface glycophorin A as a potential biomarker of venom exposure.

    Directory of Open Access Journals (Sweden)

    Eric A Gehrie

    Full Text Available The venom of Loxosceles reclusa (Brown Recluse spider can cause a severe, life-threatening hemolysis in humans for which no therapy is currently available in the USA beyond supportive measures. Because this hemolysis is uncommon, relatively little is known about its clinical manifestation, diagnosis, or management. Here, we aimed to clarify the clinical details of envenomation, to determine the efficacy of the complement inhibitor eculizumab to prevent the hemolysis in vitro, and to investigate markers of exposure to Brown Recluse venom.We performed a 10-year chart review of cases of Brown Recluse spider bite-mediated hemolysis at our institution. We also designed an in vitro assay to test the efficacy of eculizumab to inhibit hemolysis of venom exposed red blood cells. Finally, we compared levels of CD55, CD59 and glycophorin A on venom exposed versus venom-naïve cells.Most victims of severe Brown Recluse spider mediated hemolysis at our institution are children and follow an unpredictable clinical course. Brown Recluse spider bite mediated hemolysis is reduced by 79.2% (SD=18.8% by eculizumab in vitro. Erythrocyte glycophorin A, but not CD55 or CD59, is reduced after red blood cells are incubated with venom in vitro.Taken together, our laboratory data and clinical observations indicate that L. reclusa venom exposure results in non-specific antibody and complement fixation on red blood cells, resulting in complement mediated hemolysis that is curtailed by the complement inhibitor eculizumab in vitro. Glycophorin A measurement by flow cytometry may help to identify victims of L. reclusa envenomation.

  4. Brown Recluse Spider

    Science.gov (United States)

    ... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

  5. Funnel-web spider bite

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

  6. Insect bites and stings

    Science.gov (United States)

    ... widow spider bite; Brown recluse bite; Flea bite; Honey bee or hornet sting; Lice bites; Mite bite; ... Saunders; 2016:chap 359. Otten EJ. Venomous animal injuries. In: Walls RM, Hockberger RS, Gausche-Hill M, ...

  7. Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

    Science.gov (United States)

    Vetter, Richard S

    2011-06-01

    Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

  8. Hey! A Brown Recluse Spider Bit Me!

    Science.gov (United States)

    ... like antibiotics, antihistamines, or pain medicines. Rarely, a skin graft might be needed if the skin is really damaged at the area of the bite. (A skin graft is when a small amount of skin is ...

  9. Matching global and regional distribution models of the recluse spider Loxosceles rufescens: to what extent do these reflect niche conservatism?

    Science.gov (United States)

    Taucare-Ríos, A; Nentwig, W; Bizama, G; Bustamante, R O

    2018-06-08

    The Mediterranean recluse spider, Loxosceles rufescens (Dufour, 1820) (Araneae: Sicariidae) is a cosmopolitan spider that has been introduced in many parts of the world. Its bite can be dangerous to humans. However, the potential distribution of this alien species, which is able to spread fairly quickly with human aid, is completely unknown. Using a combination of global and regional niche models, it is possible to analyse the spread of this species in relation to environmental conditions. This analysis found that the successful spreading of this species varies according to the region invaded. The majority of populations in Asia are stable and show niche conservatism, whereas in North America this spider is expected to be less successful in occupying niches that differ from those in its native region and that do not support its synanthropic way of living. © 2018 The Royal Entomological Society.

  10. Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

    Science.gov (United States)

    Vetter, Richard S; Rust, Michael K

    2010-06-01

    In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

  11. Coagulopathy after spider bites in a six-year-old boy

    Directory of Open Access Journals (Sweden)

    Ansari SH.

    2008-06-01

    Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

  12. Exposure of Brown Recluse and Brown Widow Spiders (Araneae: Sicariidae, Theridiidae) to a Commercial Sulfuryl Fluoride Fumigation.

    Science.gov (United States)

    Vetter, Richard S; Hoddle, Mark S; Choe, Dong-Hwan; Thoms, Ellen

    2014-10-01

    The body of pesticide research on spiders is sparse with most studies using topical or residual applications to assess efficacy. Data on the effects of fumigation on spider survivorship are scarce in the scientific literature. In this study, we exposed adult male and female brown recluse spiders, Loxosceles reclusa Gertsch & Mulaik, and female brown widow spiders, Latrodectus geometricus C. L. Koch, to a commercial fumigation event using sulfuryl fluoride directed at termite control. General consensus from the pest control industry is that fumigation is not always effective for control of spiders for a variety of reasons, including insufficient fumigant dosage, particularly, for contents of egg sacs that require a higher fumigant dosage for control. We demonstrated that a sulfuryl fluoride fumigation with an accumulated dosage of 162 oz-h per 1,000 ft(3) at 21°C over 25 h (≈1.7 × the drywood termite dosage) directed at termites was sufficient to kill adult brown recluse and brown widow spiders. The effectiveness of commercial fumigation practices to control spiders, and particularly their egg sacs, warrants further study. © 2014 Entomological Society of America.

  13. Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

    Directory of Open Access Journals (Sweden)

    Michael Makris

    2009-01-01

    Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

  14. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

    Science.gov (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

    2014-06-01

    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

  15. First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

    Science.gov (United States)

    Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

    2017-06-30

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

  16. Mediterranean Recluse Spider, Loxosceles rufescens (Araneae: Sicariidae from Charkhab Cave, Southern Iran

    Directory of Open Access Journals (Sweden)

    Saber Sadeghi

    2017-04-01

    Full Text Available Background: The best-known dangerous spiders belong to the six genera. The genus Loxosceles or violin spiders are well known for their ability to cause skin necrosis or loxoscelism. All Loxosceles species have medical im­portance due to their necrotizing venom. The present article reports the occurrence of L. rufescens in Charkhab Cave, south of Iran (Larestan.Methods: The specimens were collected from the Charkhab Cave using handling forceps, paintbrush and aspirator and preserved in 96% ethanol.Results: Loxosceles rufescens, a medically important spider, is recorded from Charkhab Cave in Fars Province (southwest of Iran. Identification of L. rufescens was performed based on external morphology and the features of male genitalia.Conclusion: Presence of L. rufescens in south of Iran especially in a cave confirmed that this species is a widely distributed species in Iran. Therefore, cavers or cave visitors should be aware of this poisonous spider in caves.

  17. First report of clinical presentation of a bite by a running spider ...

    African Journals Online (AJOL)

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

  18. Venomous snake bites, scorpions, and spiders.

    Science.gov (United States)

    Kularatne, S A M; Senanayake, Nimal

    2014-01-01

    Neurologic dysfunction due to natural neurotoxins is an important, but neglected, public health hazard in many parts of the world, particularly in the tropics. These toxins are produced by or found among a variety of live forms that include venomous snakes, arthropods such as scorpions, spiders, centipedes, stinging insects (Hymenoptera), ticks, certain poisonous fish, shellfish, crabs, cone shells, skin secretions of dart-poison frogs, and bacterial poisons such as botulinum toxin. These toxins commonly act on neuromuscular transmission at the neuromuscular junction where acetylcholine is the neurotransmitter, but in certain situations the toxins interfere with neurotransmitters such as GABA, noradrenaline, adrenaline, dopamine, and γ-aminobutyrate. Of the toxins, α-toxins and κ-toxins (e.g., Chinese krait, Bungarus multicinctus) act on the postsynaptic membrane, blocking the receptors, whilst β-toxin (e.g., common krait, B. caeruleus) acts on the presynaptic membrane, causing impairment of acetylcholine release. Conversely, dendrotoxins of the African mamba enhance acetylcholine release. The toxins of scorpions and spiders commonly interfere with voltage-gated ion channels. Clinically, the cardinal manifestation is muscle paralysis. In severe cases respiratory paralysis could be fatal. Effective antivenoms are the mainstay of treatment of envenoming, but their lack of availability is the major concern in the regions of the globe where they are desperately needed. Interestingly, some toxins have proved to be valuable pharmaceutical agents, while some others are widely exploited to study neuromuscular physiology and pathology. © 2014 Elsevier B.V. All rights reserved.

  19. How informative are case studies of spider bites in the medical literature?

    Science.gov (United States)

    Stuber, Marielle; Nentwig, Wolfgang

    2016-05-01

    We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Brown recluse spider

    Science.gov (United States)

    ... of the skin and whites of the eyes (jaundice) Kidney failure Seizures ... RS, Gausche-Hill M, eds. Rosen's Emergency Medicine: Concepts and Clinical Practice . 9th ed. Philadelphia, PA: Elsevier; ...

  1. A verified spider bite and a review of the literature confirm Indian ornamental tree spiders (Poecilotheria species) as underestimated theraphosids of medical importance.

    Science.gov (United States)

    Fuchs, Joan; von Dechend, Margot; Mordasini, Raffaella; Ceschi, Alessandro; Nentwig, Wolfgang

    2014-01-01

    Literature on bird spider or tarantula bites (Theraphosidae) is rare. This is astonishing as they are coveted pets and interaction with their keepers (feeding, cleaning the terrarium or taking them out to hold) might increase the possibility for bites. Yet, this seems to be a rare event and might be why most theraphosids are considered to be harmless, even though the urticating hairs of many American species can cause disagreeable allergic reactions. We are describing a case of a verified bite by an Indian ornamental tree spider (Poecilotheria regalis), where the patient developed severe, long lasting muscle cramps several hours after the bite. We present a comprehensive review of the literature on bites of these beautiful spiders and conclude that a delayed onset of severe muscle cramps, lasting for days, is characteristic for Poecilotheria bites. We discuss Poecilotheria species as an exception from the general assumption that theraphosid bites are harmless to humans. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. Black and brown widow spider bites in South Africa

    African Journals Online (AJOL)

    JUNIE 1993 ten were adults, 2 were aged 13 - 19 years and 11 were ... back 1). In contrast, 10 of the brown widow bites were on the upper part and 5 on the lower part of the body ..... patient develops generalised muscular pain and cramps,.

  3. Tarantula spider

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

  4. Exaggerated Arthropod Bite: A Case Report and Review of the Mimics

    Directory of Open Access Journals (Sweden)

    Sagah Ahmed

    2018-01-01

    Full Text Available Exaggerated arthropod bite reactions causing hemorrhagic or necrotic bullous lesions can mimic other serious conditions such as cutaneous anthrax, brown recluse spider bite, and tularemia. A 55- year-old, healthy woman presented to the emergency department with a 3.5-centimeter painless, collapsed hemorrhagic bulla at the left costal margin. She was afebrile and had no systemic symptoms. Laboratory evaluation was unremarkable. She was prescribed silver sulfadiazine cream and mupirocin ointment. The area denuded two days later and the lesion completely healed. This case illustrates the broad differential to be considered when evaluating patients with hemorrhagic bullous lesions.

  5. Spider Bites

    Science.gov (United States)

    ... gloves and boots when handling stored boxes or firewood, and when cleaning out sheds, garages, basements, attics ... the area around your house and avoid storing firewood against the house. Make sure beds aren't ...

  6. Clinical presentation and outcome of Sri-Lankan Ornamental Tarantula Poecilotheria fasciata spider bite: a case report

    OpenAIRE

    NP Dinamithra; S Sivansuthan; P Johnson; JGP Nishshanka

    2013-01-01

    We report on a 19-year-old boy with visible muscle spasms admitted to the hospitals 24 hours after spider bite. He was treated effectively with intravenous calcium gluconate followed by oral calcium supplements and made a full recovery 48 hours after the incident. Although no specific treatment exists in Srilanka, it has been suggested that calcium supplements may be beneficial to relieve the muscle spasms. Our patient made a full recovery with calcium supplements suggesting the treatment wit...

  7. Bug Bites and Stings

    Science.gov (United States)

    ... can carry other diseases, such as malaria and dengue fever. Spider Bites Most spider bites are minor, ... Clean the area with soap and water, and treat with an antiseptic or antibiotic cream to avoid ...

  8. Clinical presentation and outcome of Sri-Lankan Ornamental Tarantula Poecilotheria fasciata spider bite: a case report

    Directory of Open Access Journals (Sweden)

    NP Dinamithra

    2013-10-01

    Full Text Available We report on a 19-year-old boy with visible muscle spasms admitted to the hospitals 24 hours after spider bite. He was treated effectively with intravenous calcium gluconate followed by oral calcium supplements and made a full recovery 48 hours after the incident. Although no specific treatment exists in Srilanka, it has been suggested that calcium supplements may be beneficial to relieve the muscle spasms. Our patient made a full recovery with calcium supplements suggesting the treatment with calcium is beneficial in relieving the pain and muscle spasms caused by Sri-Lankan Ornamental Tarantula Poecilotheria fasciata.

  9. When Spiders Bite: The Use, Misuse, and Unintended Consequences of ``Silent Information''

    Science.gov (United States)

    Keenan, Thomas P.

    Spiders are the workhorses of the Internet, silently (and almost invisibly) traversing the online world, 24 hours a day, looking for information that may be of interest to someone. It is being archived, organized, and sold, usually without the knowledge or consent of the subject of the information. Serious consequences are starting to appear, such as the withdrawal of three candidates from the October 2008 Canadian Federal election because of previous online indiscretions. While these were intentional if mis-guided postings, information made available without our consent can have equally devastating effects. Advances in artificial intelligence, as well as the increasing tendency to post more and more information, such as videos, will make the gathering, aggregation, and republishing of this “silent information” an increasingly important issue that must be addressed from the technical, social, ethical and legal perspectives, and sooner rather than later.

  10. Spiders in dermatology.

    Science.gov (United States)

    Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

    2014-09-01

    Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

  11. Inactivation of complement by Loxosceles reclusa spider venom.

    Science.gov (United States)

    Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

    1979-07-01

    Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

  12. A clinico-epidemiological study of bites by spiders of the genus Phoneutria Estudo clínico-epidemiológico dos acidentes causados por aranhas do gênero Phoneutria

    Directory of Open Access Journals (Sweden)

    Fábio BUCARETCHI

    2000-02-01

    Full Text Available From January, 1984 to December, 1996, 422 patients (ages 9 m-99 y, median 29 y were admitted after being bitten by spiders which were brought and identified as Phoneutria spp. Most of the bites occurred at March and April months (29.2%, in the houses (54.5%, during the day (76.5%, and in the limbs (feet 40.9%, hands 34.3%. Upon hospital admission, most patients presented only local complaints, mainly pain (92.1% and edema (33.1% and were classified as presenting mild (89.8%, moderate (8.5% and severe (0.5% envenomation. Few patients (1.2% did not present signs of envenomation. Severe accidents were only confirmed in two children (9 m, 3 y. Both developed acute pulmonary edema, and the older died 9 h after the accident. Patients more than 70 year-old had a significantly greater (pForam estudados, de janeiro de 1984 a dezembro de 1996, 422 pacientes (9 meses-99 anos, mediana 29 anos, picados por aranhas capturadas e identificadas como Phoneutria spp. A maioria dos acidentes ocorreu nos meses de março e abril (29,2%, dentro das residências (54,5%, no período diurno (76,5% e nos membros (pés, 40,9% e mãos, 34,3%. À admissão, a maioria dos pacientes apresentava somente queixas locais, principalmente dor (92,1% e edema (33,1%, tendo sido classificados como acidentes leves (89,8%, moderados (8,5%, graves (0,5% e assintomáticos (1,2%. Constatou-se que os acidentes classificados como moderados foram significativamente mais freqüentes nos pacientes com idade acima de 70 anos, quando comparados com o grupo etário de 10 a 70 anos (p 70 anos.

  13. On the predation of fly, Chrysomya rufifacies (Macquart) by a spider, Oxyopes sp. Latreille (Oxyopidae).

    Science.gov (United States)

    Heo, C C; Mohamad, A M; John, J; Baharudin, O

    2008-04-01

    During a forensic entomological study conducted in a palm oil plantation in Tg.Sepat, Selangor in September 2007, a spider (Arachnida), Oxyopes sp. (Oxyopidae) was found to predate on a calliphorid fly (Chrysomya rufifacies). The female spider laid a silk thread, or "drag line", behind it as it moved. This spider bites its prey by using a pairs of chelicerae, and injecting venom into the fly. The fly was moving its wing trying to escape, however, it succumbed to the deadly bite.

  14. The reclusive patient-a case report & clinical review of Merkel cell carcinoma

    Directory of Open Access Journals (Sweden)

    Ramanathan C

    2005-01-01

    Full Text Available Advanced Merkel Cell Carcinoma with intra - hepatic metastases in a reclusive gentleman is described. We present an interesting case with learning points and a review of this uncommon malignancy.

  15. Animal Bites

    Science.gov (United States)

    Wild animals usually avoid people. They might attack, however, if they feel threatened, are sick, or are protecting their ... or territory. Attacks by pets are more common. Animal bites rarely are life-threatening, but if they ...

  16. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

    Science.gov (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

    2014-06-01

    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. SPIDER SILK

    Directory of Open Access Journals (Sweden)

    PORAV Viorica

    2014-05-01

    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  18. Human bites - self-care

    Science.gov (United States)

    Bites - human - self-care ... Human bites can occur in 2 ways: If someone bites you If your hand comes into contact ... bite to express anger or other negative feelings. Human bites may be more dangerous than animal bites. ...

  19. Spider Vein Removal

    Science.gov (United States)

    Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

  20. Cat and Dog Bites

    Science.gov (United States)

    ... Wellness Staying Healthy Pets and Animals Cat and Dog Bites Cat and Dog Bites Share Print Cat and dog bites are common injuries. A family pet or ... bites. Path to safety If a cat or dog bites you, you should: Wash the wound gently ...

  1. Insect Bites and Stings

    Science.gov (United States)

    Most insect bites are harmless, though they sometimes cause discomfort. Bee, wasp, and hornet stings and fire ant bites usually hurt. Mosquito and flea bites usually itch. Insects can also spread diseases. In the United States, ...

  2. Animal Bites: First Aid

    Science.gov (United States)

    First aid Animal bites: First aid Animal bites: First aid By Mayo Clinic Staff These guidelines can help you care for a minor animal bite, such ... 26, 2017 Original article: http://www.mayoclinic.org/first-aid/first-aid-animal-bites/basics/ART-20056591 . Mayo ...

  3. Nature Study Tips. Spiders.

    Science.gov (United States)

    Mulaik, Stanley B.

    1990-01-01

    Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

  4. Black widow spider

    Science.gov (United States)

    ... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

  5. Animal Bites of the Hand

    Science.gov (United States)

    ... Therapist? Media Find a Hand Surgeon Home Anatomy Animal Bites Email to a friend * required fields From * ... key to prevent problems from a bite. CAUSES Animal Bites Millions of animal bites occur in the ...

  6. The events of 1812 in the comprehension of Russian writers and St. Theophan the Recluse

    Directory of Open Access Journals (Sweden)

    Mozharova Marina Anatolievna

    2014-07-01

    Full Text Available The article analyzes works of the Russian literature classics and about sermons of St. Theophan the Recluse covering the topic of 1812, which became the time of the true self-knowledge for the Russian people. By the will of Providence Russia was carried through the purgatorial suffering for salvation. Being enthusiastic about western education, contemporaries thoughtlessly sacrificed themselves in voluntary spiritual captivity of those terrible events have finally turned to faith, repentance and prayer. Lessons of 1812 that became a matter of thought for both the Orthodox pastors, and for Russian writers, will forever remain poignant reminder for the descendants.

  7. Did You Say Spiders?

    Science.gov (United States)

    Campbell, Alene

    This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

  8. Human bites (image)

    Science.gov (United States)

    Human bites present a high risk of infection. Besides the bacteria which can cause infection, there is ... the wound extends below the skin. Anytime a human bite has broken the skin, seek medical attention.

  9. Exotic reptile bites.

    Science.gov (United States)

    Kelsey, J; Ehrlich, M; Henderson, S O

    1997-09-01

    Reptiles are a growing part of the exotic pet trade, and reptile bites have been considered innocuous in the emergency medicine literature. Two cases are reported of reptile bites, one from a green iguana and the other from a reticulated python. The treatment concerns associated with reptile bites are discussed.

  10. Attending to detail by communal spider-eating spiders.

    Science.gov (United States)

    Jackson, Robert R; Nelson, Ximena J

    2012-07-01

    Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

  11. Spiders in caves.

    Science.gov (United States)

    Mammola, Stefano; Isaia, Marco

    2017-04-26

    World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

  12. Animal bites - self-care

    Science.gov (United States)

    Bites - animals - self-care ... Most animal bites come from pets. Dog bites are common and most often happen to children. Cat bites are ... which can cause deeper puncture wounds. Most other animal bites are caused by stray or wild animals, ...

  13. Respiration in spiders (Araneae).

    Science.gov (United States)

    Schmitz, Anke

    2016-05-01

    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

  14. [Mammal bite management].

    Science.gov (United States)

    Contreras-Marín, Misael; Sandoval-Rodríguez, Jorge Issac; García-Ramírez, Raúl; Morales-Yépez, Héctor Adolfo

    Animal bites are a major public health problem, it is estimated that 2% of the population is bitten each year. Most bites are by dogs and the risk factors include young children, men, certain breeds of dogs and untrained dogs. The risk of infection after bites differs between animal species and depends on the animal teeth and oral flora. Animal bites are still a major cause of morbidity in patients of all ages and have caused several preventable childhood deaths. These wounds often become infected. If the wound requires it, early surgical evaluation must be performed. The use of antibiotics is only recommended for high risk bite wounds. Copyright © 2016 Academia Mexicana de Cirugía A.C. Publicado por Masson Doyma México S.A. All rights reserved.

  15. Élisée RECLUS. Géographe, anarchiste, écologiste, Jean-Didier VINCENT, 2010

    Directory of Open Access Journals (Sweden)

    Alain Marre

    2012-06-01

    Full Text Available Lire la biographie d'un géographe écrite par un non géographe est un grand plaisir ! Jean-Didier VINCENT, comme Élisée RECLUS, est natif, de Sainte-Foy-la-Grande. C'est peut être la raison pour laquelle il s'est lancé dans cette biographie hommage qui, comme il l'écrit lui-même en fin de son ouvrage est "une histoire d'amour". On citera les dernières lignes de son livre, qui donnent tout l'objectif de cet ouvrage : "J'ai voulu écrire une histoire d'amour. L'œuvre d'Élisée RECLUS a suscité bie...

  16. Bat Predation by Spiders

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  17. Bat predation by spiders.

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

  18. Spider bite in southern Africa: diagnosis and management

    African Journals Online (AJOL)

    Dr Müller is part-time consultant in the Division of Pharmacology, Department of Medicine, Faculty of ... Poison Information Centre and currently a consultant clinical pharmacist and lecturer in pharmacology ..... Journal 2011;15:76- 81. Prins A ...

  19. Spider bite in southern Africa: diagnosis and management

    African Journals Online (AJOL)

    Ms Wium is a principal medical scientist employed as a toxicologist in the Tygerberg ... Tygerberg Poison Information Centre and the Therapeutic Drug Monitoring Laboratory, .... of action of neurotoxic venoms on the peripheral nervous system.

  20. Fire Ant Bites

    Science.gov (United States)

    ... Favorite Name: Category: Share: Yes No, Keep Private Fire Ant Bites Share | Fire ants are aggressive, venomous insects that have pinching ... across the United States, even into Puerto Rico. Fire ant stings usually occur on the feet or ...

  1. Avoid Mosquito Bites

    Science.gov (United States)

    ... visiting CDC Travelers’ Health website . Pack a travel health kit . Remember to pack insect repellent and use it as directed to prevent mosquito bites. See a healthcare provider familiar with travel medicine, ideally 4 to 6 weeks ...

  2. Fighting and Biting

    Science.gov (United States)

    ... on Demand Maintenance of Certification and Lifelong Learning Modules Online CME Pathways My Profile Store Cart Donate ... child, or put the child down. For a young child (2-3 years) say, "biting is not ...

  3. David and Goliath: potent venom of an ant-eating spider (Araneae) enables capture of a giant prey

    Science.gov (United States)

    Pekár, Stano; Šedo, Onřej; Líznarová, Eva; Korenko, Stanislav; Zdráhal, Zdeněk

    2014-07-01

    It is rare to find a true predator that repeatedly and routinely kills prey larger than itself. A solitary specialised ant-eating spider of the genus Zodarion can capture a relatively giant prey. We studied the trophic niche of this spider species and investigated its adaptations (behavioural and venomic) that are used to capture ants. We found that the spider captures mainly polymorphic Messor arenarius ants. Adult female spiders captured large morphs while tiny juveniles captured smaller morphs, yet in both cases ants were giant in comparison with spider size. All specimens used an effective prey capture strategy that protected them from ant retaliation. Juvenile and adult spiders were able to paralyse their prey using a single bite. The venom glands of adults were more than 50 times larger than those of juvenile spiders, but the paralysis latency of juveniles was 1.5 times longer. This suggests that this spider species possesses very potent venom already at the juvenile stage. Comparison of the venom composition between juvenile and adult spiders did not reveal significant differences. We discovered here that specialised capture combined with very effective venom enables the capture of giant prey.

  4. Biomechanics of Spider Silks

    Science.gov (United States)

    2006-03-02

    water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

  5. Attentional bias to moving spiders in spider fearful individuals.

    Science.gov (United States)

    Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

    2009-05-01

    We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

  6. Anthropology of St. Theophan the Recluse and the Origin of First Personalistic Concepts in Russian Theology

    Directory of Open Access Journals (Sweden)

    Khondzinskii Pavel,

    2017-05-01

    Full Text Available Studying the development of personalistic ideas in Russian theology, we are led to Kiev school as a starting point in this development. It was Kiev Theological Academy that paid serious attention to the study of philosophy and psychology of the modern period earlier than other religious schools did. The initial features of the school of thought that we deal with first manifested themselves in lectures by St. Innocent of Kherson, rector of Kiev Theological Academy, and in his controversy with Kant. It was the Kiev Academy graduate, Professor V. Karpov, who became the founder of St. Petersburg school of psychology, the representative of which, the future Bishop Michael (Gribanovsky, suggested the first personalistic concept that implied the “double presence” of personality and nature in man. A little later, based on the idea proposed St. Innocent and, independently, by Bishop Michael, V. Nesmelov, a representative of Kazan school, came to similar conclusions and suggested a reinterpretation of the terms person, self and self-consciousness. This inevitably leads to the question how these concepts, mostly generated by new philosophy and psychology, relate to traditional Christian ideas about man. To give the answer, it is important to compare them with the doctrine of another graduate of Kiev Academy, St. Theophan the Recluse. This paper shows that it was him who managed to maintain the balance between traditional ideas and modern anthropological discoveries.

  7. Insect bite reactions

    Directory of Open Access Journals (Sweden)

    Sanjay Singh

    2013-01-01

    Full Text Available Insects are a class of living creatures within the arthropods. Insect bite reactions are commonly seen in clinical practice. The present review touches upon the medically important insects and their places in the classification, the sparse literature on the epidemiology of insect bites in India, and different variables influencing the susceptibility of an individual to insect bites. Clinical features of mosquito bites, hypersensitivity to mosquito bites Epstein-Barr virus NK (HMB-EBV-NK disease, eruptive pseudoangiomatosis, Skeeter syndrome, papular pruritic eruption of HIV/AIDS, and clinical features produced by bed bugs, Mexican chicken bugs, assassin bugs, kissing bugs, fleas, black flies, Blandford flies, louse flies, tsetse flies, midges, and thrips are discussed. Brief account is presented of the immunogenic components of mosquito and bed bug saliva. Papular urticaria is discussed including its epidemiology, the 5 stages of skin reaction, the SCRATCH principle as an aid in diagnosis, and the recent evidence supporting participation of types I, III, and IV hypersensitivity reactions in its causation is summarized. Recent developments in the treatment of pediculosis capitis including spinosad 0.9% suspension, benzyl alcohol 5% lotion, dimethicone 4% lotion, isopropyl myristate 50% rinse, and other suffocants are discussed within the context of evidence derived from randomized controlled trials and key findings of a recent systematic review. We also touch upon a non-chemical treatment of head lice and the ineffectiveness of egg-loosening products. Knockdown resistance (kdr as the genetic mechanism making the lice nerves insensitive to permethrin is discussed along with the surprising contrary clinical evidence from Europe about efficacy of permethrin in children with head lice carrying kdr-like gene. The review also presents a brief account of insects as vectors of diseases and ends with discussion of prevention of insect bites and some

  8. Marine animal stings or bites

    Science.gov (United States)

    Stings - marine animals; Bites - marine animals ... Things you can do to prevent a marine animal sting or bite include: Swim near a lifeguard. Observe posted signs that may warn of danger from jellyfish or other hazardous marine life. ...

  9. Mosquito Bites are Bad!

    Centers for Disease Control (CDC) Podcasts

    2016-08-11

    In this podcast for kids, the Kidtastics talk about the dangers of mosquito bites and how to prevent getting them.  Created: 8/11/2016 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 8/11/2016.

  10. Rat bite fever.

    NARCIS (Netherlands)

    Gaastra, W.; Boot, R.G.A.; Ho, H.; Lipman, L.J.A.

    2009-01-01

    Rat bite fever (RBF) is a bacterial zoonosis for which two causal bacterial species have been identified: Streptobacillis moniliformis and Spirillum minus. Haverhill fever (HF) is a form of S. moniliformis infection believed to develop after ingestion of contaminated food or water. Here the

  11. Bug Bites and Stings

    Science.gov (United States)

    ... or sting. Handling Bee and Wasp Stings A bee will usually leave behind a stinger attached to a venom sac. Try to remove it as quickly as ... child has had an allergic reaction to a bee or wasp sting in the past, see your ... shape on its underbelly. The venom (a toxic substance) in a black widow bite ...

  12. Low Health System Performance, Indigenous Status and Antivenom Underdosage Correlate with Spider Envenoming Severity in the Remote Brazilian Amazon.

    Directory of Open Access Journals (Sweden)

    Vanderson Souza Sampaio

    Full Text Available A better knowledge of the burden and risk factors associated with severity due to spider bites would lead to improved management with a reduction of sequelae usually seen for this neglected health problem, and would ensure proper use of antivenoms in remote localities in the Brazilian Amazon. The aim of this study was to analyze the profile of spider bites reported in the state of Amazonas in the Western Brazilian Amazon, and to investigate potential risk factors associated with severity of envenomation.We used a case-control study in order to identify factors associated with spider bite severity in the Western Brazilian Amazon from 2007 to 2014. Patients evolving to any severity criteria were considered cases and those with non-severe bites were included in the control group. All variables were retrieved from the official Brazilian reporting systems. Socioeconomical and environmental components were also included in a multivariable analysis in order to identify ecological determinants of incidence and severity. A total of 1,181 spider bites were recorded, resulting in an incidence of 4 cases per 100,000 person/year. Most of the spider bites occurred in males (65.8%. Bites mostly occurred in rural areas (59.5%. The most affected age group was between 16 and 45 years old (50.9%. A proportion of 39.7% of the bites were related to work activities. Antivenom was prescribed to 39% of the patients. Envenomings recorded from urban areas [Odds ratio (OR = 0.40 (95%CI = 0.30-0.71; pmedian [OR = 0.64 (95%CI = 0.39-0.75; p300 km away from the state capital Manaus [OR = 1.90 (95%CI = 1.28-2.40; p300 km away from the state capital Manaus [OR = 1.53 (95%CI = 1.15-2.02; p = 0.003] and living in a municipality with a MHSPI 300 km away from the state capital Manaus could be contributing factors to higher severity of spider envenomings in this area, as well as to antivenom underdosage.

  13. Application of computer graphics to generate coal resources of the Cache coal bed, Recluse geologic model area, Campbell County, Wyoming

    Science.gov (United States)

    Schneider, G.B.; Crowley, S.S.; Carey, M.A.

    1982-01-01

    Low-sulfur subbituminous coal resources have been calculated, using both manual and computer methods, for the Cache coal bed in the Recluse Model Area, which covers the White Tail Butte, Pitch Draw, Recluse, and Homestead Draw SW 7 1/2 minute quadrangles, Campbell County, Wyoming. Approximately 275 coal thickness measurements obtained from drill hole data are evenly distributed throughout the area. The Cache coal and associated beds are in the Paleocene Tongue River Member of the Fort Union Formation. The depth from the surface to the Cache bed ranges from 269 to 1,257 feet. The thickness of the coal is as much as 31 feet, but in places the Cache coal bed is absent. Comparisons between hand-drawn and computer-generated isopach maps show minimal differences. Total coal resources calculated by computer show the bed to contain 2,316 million short tons or about 6.7 percent more than the hand-calculated figure of 2,160 million short tons.

  14. Epidemiology of Snake, Spider and Scorpion Envenomation in Mashhad, Khorasan Razavi, Iran (2004-2011

    Directory of Open Access Journals (Sweden)

    Majid Khadem-Rezaiyan

    2018-01-01

    Full Text Available Backgrounds: Envenomation is common in Asia including Iran that induces morbidity and mortality. This study investigated the epidemiological characteristics of cases with snake, spider and scorpion bites. Methods: In this cross-sectional design, epidemiologic data of admitted cases to the Toxicology Department of Imam Reza Hospital of Mashhad, Iran were analyzed across a 7-yr period, from 2004 to 2011. SPSS was used for data analysis. Results: This study reports 686 admissions due to animal envenomation with an incidence rate of 2.9 per 100000. Mean (SD, min-max age of admitted patients was 30 (19, 1-90 yr, and 471 (69% were male. Snakebite (n, percentage, annual incidence (299, 44%, 1.3 per 100000 and spider bite (188, 27%, 0.8 per 100000 and scorpion sting (126, 18.4%, 0.5 per 100000 were most frequent cases. Overall, case fatality rate was 0.09 per 100000 which were due to scorpion and unknown bite. No cases of snakebites died in this period. The highest age-specific incidence rate was 4.6 per 100000 and related to 10-20 yr of age. Conclusion: Animal envenomation is frequent in this area and a matter of health concern. While deaths related to snake bite are no longer reported-presumably due to using effective anti-venom - managing unknown and scorpion bites need to be addressed. Envenomation was not overtly an age-specific event in this province.

  15. The Spider Files

    Science.gov (United States)

    McDonald, James; Dominguez, Lynn

    2012-01-01

    As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

  16. PATHWAYS TO SPIDER PHOBIA

    NARCIS (Netherlands)

    MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

    Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

  17. Spider Web Pattern

    Science.gov (United States)

    2006-01-01

    A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

  18. Brown spider dermonecrotic toxin directly induces nephrotoxicity

    International Nuclear Information System (INIS)

    Chaim, Olga Meiri; Sade, Youssef Bacila; Bertoni da Silveira, Rafael; Toma, Leny; Kalapothakis, Evanguedes; Chavez-Olortegui, Carlos; Mangili, Oldemir Carlos; Gremski, Waldemiro; Dietrich, Carl Peter von; Nader, Helena B.; Sanches Veiga, Silvio

    2006-01-01

    Brown spider (Loxosceles genus) venom can induce dermonecrotic lesions at the bite site and systemic manifestations including fever, vomiting, convulsions, disseminated intravascular coagulation, hemolytic anemia and acute renal failure. The venom is composed of a mixture of proteins with several molecules biochemically and biologically well characterized. The mechanism by which the venom induces renal damage is unknown. By using mice exposed to Loxosceles intermedia recombinant dermonecrotic toxin (LiRecDT), we showed direct induction of renal injuries. Microscopic analysis of renal biopsies from dermonecrotic toxin-treated mice showed histological alterations including glomerular edema and tubular necrosis. Hyalinization of tubules with deposition of proteinaceous material in the tubule lumen, tubule epithelial cell vacuoles, tubular edema and epithelial cell lysis was also observed. Leukocytic infiltration was neither observed in the glomerulus nor the tubules. Renal vessels showed no sign of inflammatory response. Additionally, biochemical analyses showed such toxin-induced changes in renal function as urine alkalinization, hematuria and azotemia with elevation of blood urea nitrogen levels. Immunofluorescence with dermonecrotic toxin antibodies and confocal microscopy analysis showed deposition and direct binding of this toxin to renal intrinsic structures. By immunoblotting with a hyperimmune dermonecrotic toxin antiserum on renal lysates from toxin-treated mice, we detected a positive signal at the region of 33-35 kDa, which strengthens the idea that renal failure is directly induced by dermonecrotic toxin. Immunofluorescence reaction with dermonecrotic toxin antibodies revealed deposition and binding of this toxin directly in MDCK epithelial cells in culture. Similarly, dermonecrotic toxin treatment caused morphological alterations of MDCK cells including cytoplasmic vacuoles, blebs, evoked impaired spreading and detached cells from each other and from

  19. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing

    2012-01-01

    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  20. A rare cause of cellulitis (necrotic arachnidism: a report of two cases

    Directory of Open Access Journals (Sweden)

    Tugba Sari

    2014-09-01

    Full Text Available Bites from brown recluse spiders (Loxosceles reclusa result in several clinical manifestations, causing painful, disfiguring necrotic ulcers and, uncommonly, severe systemic effects. We report two cases reports with necrotic arachnidism from Turkey. A 21-year-old man was admitted to our clinic with the complaints of pruritis, redness on his neck. He had a history of spider bite one day ago. A 52-year-old woman had a cellulitis with hemorrhagic lesion and superficial necrosis on her arm and had a history of spider bite one day ago. Based on these clinical and epidemiological findings, a diagnosis of necrotic arachnidism was suspected, and the diagnosis of necrotic arachnidism was confirmed with these typical skin lesions and spiders bites in histories of patients. The outcome of our patients were good after antihistaminic, antibiotic, analgesic and anti-inflammatory treatments. The brown recluse spider is notorious for its necrosisinducing bite. Its venom contains a rare toxin, sphingomyelinase D, which activates the vascular endothelium and initiates a cascade of activation of neutrophils and granulocyte macrophage colony-stimulating factor, resulting in tissue destruction. In many cases, diagnosis of spider bite is very difficult. Therefore, clinical and epidemiological findings, as well as a detailed history, may establish the diagnosis.

  1. Food aroma affects bite size

    Directory of Open Access Journals (Sweden)

    de Wijk René A

    2012-03-01

    Full Text Available Abstract Background To evaluate the effect of food aroma on bite size, a semisolid vanilla custard dessert was delivered repeatedly into the mouth of test subjects using a pump while various concentrations of cream aroma were presented retronasally to the nose. Termination of the pump, which determined bite size, was controlled by the subject via a push button. Over 30 trials with 10 subjects, the custard was presented randomly either without an aroma, or with aromas presented below or near the detection threshold. Results Results for ten subjects (four females and six males, aged between 26 and 50 years, indicated that aroma intensity affected the size of the corresponding bite as well as that of subsequent bites. Higher aroma intensities resulted in significantly smaller sizes. Conclusions These results suggest that bite size control during eating is a highly dynamic process affected by the sensations experienced during the current and previous bites.

  2. Extended spider cognition.

    Science.gov (United States)

    Japyassú, Hilton F; Laland, Kevin N

    2017-05-01

    There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

  3. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... your fingers and from your nails to your face and mouth. To help you stop biting your ... re inclined to bite may help solve the problem. Try to gradually stop biting your nails: Some ...

  4. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... skin, hair, and nails Skin dictionary Camp Discovery Good Skin Knowledge lesson plans and activities Video library ... biting. Replace the nail-biting habit with a good habit: When you feel like biting your nails, ...

  5. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... this safe, but awful-tasting formula discourages many people from biting their nails. Get regular manicures: Spending ... longer bite any of your nails. For some people, nail biting may be a sign of a ...

  6. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... biting can make the skin around your nails feel sore, and it can damage the tissue that ... biting habit with a good habit: When you feel like biting your nails, try playing with a ...

  7. Morphology of open bite.

    Science.gov (United States)

    Krey, Karl-Friedrich; Dannhauer, Karl-Heinz; Hierl, Thomas

    2015-05-01

    The purpose of this work was to define and illustrate the skeletal morphology of open-bite patients against the background of sagittal jaw relationships on the basis of lateral cephalograms. Lateral cephalograms of 197 untreated adults were analyzed in dental imaging software (Onyx Ceph 3™; Image Instruments, Chemnitz, Germany). Four groups were formed based on vertical (Index scores) and sagittal (individualized ANB values) parameters. Ninety-nine patients were defined as the control group due to their neutral sagittal and vertical relationships. The remaining patients were found by their vertical relationships to represent open-bite cases and were divided by their sagittal relationships into three study groups: neutral (Class I, n = 34), distal (Class II, n = 26), and mesial (Class III, n = 38). A geometric morphometric approach was used to analyze the x,y-coordinates of 28 skeletal landmarks on each cephalogram. Relative size was captured based on centroid size (CS). The shape-determining factors in the groups were compared by permutation testing after Procrustes transformation, and intergroup differences were visualized in the form of thin-plate splines. While size (CS) was significantly increased in the Class III group, the other two groups were not different from the control group. After Procrustes transformation, characteristic and invariably significant (p common that the mandibular ramus is compressed, but marked differences are seen in terms of vertical development of the maxilla. This differentiated view of open-bite cases should be taken into consideration during individual etiology assessment and treatment planning.

  8. Pigeon tick bite

    DEFF Research Database (Denmark)

    Rolla, G; Heffler, E; Boita, M

    2018-01-01

    Anaphylaxis is a serious systemic allergic reaction with rapid onset and potentially life-threatening. We report in detail a case of severe nocturnal anaphylaxis due to pigeon tick bite showing the diagnostic value of the extract and the recombinant allergen in the diagnostic procedures (basophil...... reagents. Because of the growing number of pigeons in Middle and Southern Europe cities, some cases of idiopathic anaphylaxis could potentially be caused by A. reflexus in those countries. The identification of pigeon ticks as a trigger of anaphylaxis would greatly improve medical care and advice...

  9. Animal coloration: sexy spider scales.

    Science.gov (United States)

    Taylor, Lisa A; McGraw, Kevin J

    2007-08-07

    Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

  10. Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

    Science.gov (United States)

    Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

    2011-01-01

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

  11. Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

    Science.gov (United States)

    Llandres, Ana L; Rodríguez-Gironés, Miguel A

    2011-02-16

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

  12. Esthetic correction in open bite

    Directory of Open Access Journals (Sweden)

    Swapnil Parlani

    2011-01-01

    Full Text Available Deleterious oral habits, which are persistent, can lead to poor esthetics of a beautiful face. Conventional treatment modalities for an open bite usually include orthodontic treatment and/or skeletal surgery. This article focuses on a different treatment modality for an anterior open bite.

  13. A spider elevator

    Energy Technology Data Exchange (ETDEWEB)

    Butylkin, A.V.; Butylkin, V.A.; Izosimov, A.M.

    1983-01-01

    A spider elevator is proposed which contains a body, a wedge clamp with wedges hinged to each other, a subassembly for holding the wedge clamp in the open and closed positions and a mechanism for changing the wedge clamp, which is made in the form of levers with ears for cleats and installed in the body with the capability of turning. To increase reliability in the operational mode through using the external force for clamping the pipe, the free ends of the levers are hinged with the body by a power cylinder.

  14. Shrieking, Biting, and Licking

    Directory of Open Access Journals (Sweden)

    Sarah Stang

    2018-01-01

    Full Text Available This article examines examples of the monstrous-feminine in the form of abject female monsters in a selection of critically acclaimed and commercially successful video games. Various female monsters from CD Projekt RED’s The Witcher series (2007-2015, and Santa Monica Studio’s God of War series (2005-2013 are considered as examples of the abject monstrous-feminine which fall into a long tradition in horror media of making the female body and body movements into something horrific and repulsive. These female monsters use shrieking, biting, licking, and spreading disease as weapons against the male protagonist, who must slay them to restore symbolic order and progress in the games.

  15. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... gloves to prevent biting. Replace the nail-biting habit with a good habit: When you feel like biting your nails, try ... recommend taking a gradual approach to break the habit. Try to stop biting one set of nails, ...

  16. Identifying Insect Bites and Stings

    Science.gov (United States)

    ... Editor & Contributors Sponsors Sponsorship Opportunities Spread the Word Shop AAP Find a Pediatrician Health Issues Conditions Abdominal ... birdbaths) and are attracted by bright colors and sweat. Bites result in stinging sensation followed by a ...

  17. Tips to Prevent Mosquito Bites

    Science.gov (United States)

    ... discourage mosquitoes, ticks and other biting insects from landing on you. Here are tips for other preventive ... CDC Mosquito Control Methods - NPIC Exit Top of Page Contact Us to ask a question, provide feedback, ...

  18. Spiders from Mars?

    Science.gov (United States)

    2003-01-01

    MGS MOC Release No. MOC2-426, 19 July 2003No, this is not a picture of a giant, martian spider web. This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a plethora of polygonal features on the floor of a northern hemisphere impact crater near 65.6oN, 327.7oW. The picture was acquired during spring, after the seasonal carbon dioxide frost cap had largely migrated through the region. At the time the picture was taken, remnants of seasonal frost remained on the crater rim and on the edges of the troughs that bound each of the polygons. Frost often provides a helpful hint as to where polygons and patterned ground occur. The polygons, if they were on Earth, would indicate the presence of freeze-thaw cycles in ground ice. Although uncertain, the same might be true of Mars. Sunlight illuminates the scene from the lower left.

  19. Sclerotherapy of Varicose Veins and Spider Veins

    Science.gov (United States)

    ... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

  20. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    OpenAIRE

    Jiang Min

    2016-01-01

    Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  1. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    Directory of Open Access Journals (Sweden)

    Jiang Min

    2016-01-01

    Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  2. Tropical House Gecko (Hemidactylus mabouia predation on brown spiders (Loxosceles intermedia

    Directory of Open Access Journals (Sweden)

    E.N. Ramires

    2004-01-01

    Full Text Available Brown spiders (Loxosceles spp. are venomous arachnids, successfully adapted to urban habitats in Brazil. Loxoscelism became a serious public health problem in Paraná State, especially at the capital Curitiba, where the most abundant species is Loxosceles intermedia. Hemidactylus mabouia (Gekkonidae lizards are synanthropic predators of arthropods. In this paper, we describe the predatory behavior of the Tropical House Gecko H. mabouia on L. intermedia under laboratory conditions. Twelve geckos were observed, and all of them fed on brown spiders (n=123 observations. The attack consisted of a fast run followed by one bite on the spider’s abdomen or legs. The geckos did not attack L. intermedia anterior body parts, probably due to the fangs present in this region. Two Hemidactylus individuals were killed by L. intermedia bites: during a predatory encounter, and by an induced bite on a restrained lizard. The observations summarized in this paper show that H. mabouia could be used in the biological control of Loxosceles populations in human dwellings. However, additional field studies are necessary to quantify the impact of H. mabouia predation on urban populations of L. intermedia and other species of the same genus.

  3. Spider phylogenomics: untangling the Spider Tree of Life

    Directory of Open Access Journals (Sweden)

    Nicole L. Garrison

    2016-02-01

    Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

  4. Spider phylogenomics: untangling the Spider Tree of Life

    Science.gov (United States)

    Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

    2016-01-01

    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

  5. Approach and avoidance in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Becker, E.S.

    2007-01-01

    We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

  6. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1980-01-01

    An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

  7. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Tips to prevent and treat bug bites Although most bug bites are harmless, some can spread dangerous ... one’s greatest efforts, bug bites still happen. Fortunately, most bug bites and stings can be safely treated ...

  8. Injurious tail biting in pigs

    DEFF Research Database (Denmark)

    D'Eath, R.B.; Amott, G.; Turner, S. P.

    2014-01-01

    not allow tail docking at all. Against this background, using a novel approach focusing on research where tail injuries were quantified, we review the measures that can be used to control tail biting in pigs without tail docking. Using this strict criterion, there was good evidence that manipulable...... substrates and feeder space affect damaging tail biting. Only epidemiological evidence was available for effects of temperature and season, and the effect of stocking density was unclear. Studies suggest that group size has little effect, and the effects of nutrition, disease and breed require further...... underlying processes of tail biting. A quantitative comparison of the efficacy of different methods of provision of manipulable materials, and a review of current practices in countries and assurance schemes where tail docking is banned, both suggest that daily provision of small quantities of destructible...

  9. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... nails, or even an entire hand. The goal is to get to the point where you no longer bite any of your nails. For some people, nail biting may be a sign of a more serious psychological ...

  10. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... biting your nails Nail biting typically begins in childhood and can continue through adulthood, and the side ... set of nails, such as your thumb nails, first. When that’s successful, eliminate your pinky nails, pointer ...

  11. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Mohs AUC MyDermPath+ Psoriasis Patient education resources ... Try to gradually stop biting your nails: Some doctors recommend taking a gradual approach to break the habit. Try to stop biting ...

  12. Rat bite fever without fever.

    Science.gov (United States)

    Stehle, P; Dubuis, O; So, A; Dudler, J

    2003-09-01

    Rat bite fever is a rarely reported acute febrile bacterial illness caused by Streptobacillus moniliformis or Spirillum minus following a rat bite. It is classically characterised by abrupt onset of fever with rigors, myalgias, headache, and the appearance of a generalised maculopapular petechial skin rash. Polyarthritis complicates the course of the disease in up to 50% of infected patients, and numerous hurdles can make the diagnosis particularly difficult in the absence of fever or rash, as in the present case. A high degree of awareness is necessary to make the correct diagnosis in such cases. Diagnosis has important prognostic implications as the disease is potentially lethal, but easily treatable.

  13. Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

    Science.gov (United States)

    Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

    2014-11-01

    The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

  14. TOXICOLOGY AND TREATMENT: MEDICAL AUTHORITIES AND SNAKE-BITE IN THE MIDDLE AGES.

    Science.gov (United States)

    Walker-Meikle, Kathleen

    2014-12-01

    By end of the thirteenth century, surgeons and university-trained physicians in Western Europe had a plethora of authorities from the Greco-Roman and Arabic tradition from which to consult for the treatment of snake-bites. Venomous animals receive the largest share of attention in the literature on biting animals. Nearly all of the sources focus on the idea of the animal biting or puncturing the skin's surface with their mouths and few poisonous animals where the venom is passed on through the skin or hairs are mentioned. Venomous animals frequently appear in discussions on poisons in general, with poisons of animal, mineral or vegetable origin. The bulk of the discourse dealt with venomous snakes and rabid dogs, the latter considered venomous due to its 'poisonous' saliva, and to a lesser extent, scorpions and spiders. In general the bites of non-venomous animals received scant attention. Unlike modern taxonomical categories, medieval categories for animals were usually connected to the movement or the locale of the animal: flying animals, animals in water, land animals (which mainly covered quadrupeds), and crawling animals. It is in the latter category that snakes were located, along with lizards.

  15. Systematics, Bioecology, and Medical Importance of Widow Spiders (Lathrodectus spp. in Khorasan Province, Iran

    Directory of Open Access Journals (Sweden)

    J Rafijenad

    2007-06-01

    Full Text Available Following the hospitalization of 195 individuals due to the spider bite in 1995 and three cases of recorded death in the year of 1993 which were referred to Emam Reza Hospital in Mashad, the present study was undertaken on bionomics and medical importance of Lathrodectus spp in Khorasan Province, during 1995-2005. A total cases of 195 bites were studied composing of 70.8 % males and 29.2% females. The most prevalence cases were observed in mid age (20-55 years old and par¬ticularly among farmers (36.4%. A total number of 216 adult widow spiders and 258 egg sacs were collected from their habitats in different localities of 15 counties in the province. The following species have been recognized: Lathrodectus tredecimgottatus (62%, L. dahli (32%, L. geometricus (5% and L. pallidus (1%. Here is the first report on the occurrence of males of L. pallidus as well as both sexes of L. trdecimgottatus and L. geometricus in the country. The sex ratio among collected specimens was 88% and 12% female and male, respectively. Summer provides the most suitable and favorable climatic condition for the activities of these spiders. However 65% of spiders were collected in this season. Among different cit¬ies, Mashad had (60% the most reported cases in the study area. Foot was more injured than other parts. 96.5% of pa¬tients exhib¬ited localized pain from which only 2% had no pain in the bitten part and 87% had a generalized pain in whole body.

  16. An unusual complication of snake bite

    Directory of Open Access Journals (Sweden)

    Mary Grace

    2014-01-01

    Full Text Available Anterior pituitary hypofunction is a well-known complication following snake bite. However, central diabetes insipidus as a complication of snake bite is only rarely reported in the literature. We are reporting a case of central diabetes insipidus, which developed as sequelae to viper bite.

  17. 21 CFR 882.5070 - Bite block.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Bite block. 882.5070 Section 882.5070 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES NEUROLOGICAL DEVICES Neurological Therapeutic Devices § 882.5070 Bite block. (a) Identification. A bite block...

  18. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... of hangnails, or other triggers, such as boredom, stress, or anxiety. By figuring out what causes you to bite your nails, you can figure out how to avoid these situations and develop a plan to stop. Just knowing when you’re inclined to bite may help solve the problem. Try to gradually stop biting ...

  19. Reconstitutable control rod spider assembly

    International Nuclear Information System (INIS)

    Shallenberger, J.M.; Ferian, S.J.

    1990-01-01

    A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

  20. Terrestrial Biological Inventory Degognia and Fountain Bluff Levee and Drainage District and Grand Tower Drainage and Levee District, Jackson County, Illinois.

    Science.gov (United States)

    1978-08-01

    species were carefully noted which may prove to be a hazard to public health . Threatened, Rare, or Endangered Species Special effort was made to seek...50 Smartweed Polygonum pensylvanicum 32.5 50 White Smartweed Polygonum lapathifolium 5.0 20 Manna Grass Glyceria striata 3.5 20 Hibiscus Hibiscus ...recluse, lives in upland forests and around human habitation. There are no recent cases of poisonous spider bites reported by the Jackson County Health

  1. THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

    Science.gov (United States)

    Cross, Fiona R.; Jackson, Robert R.

    2016-01-01

    Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

  2. Mosquito Bite Prevention For Travelers

    Science.gov (United States)

    ... bites. Here’s how: Keep mosquitoes out of your hotel room or lodging Š Choose a hotel or lodging with air conditioning or screens on ... percentages of active ingredient provide longer protection Some brand name examples* (Insect repellents may be sold under ...

  3. K-9 Police Dog Bite

    Directory of Open Access Journals (Sweden)

    Vy Han

    2017-01-01

    Full Text Available History of present illness: A 30-year-old male who was brought into the emergency department (ED by police officers after being bitten in the right lower extremity by a police German Shepard after attempting to flee authorities on foot. The patient stated that the dog immediately bit down on his right calf and proceeded to violently shake its head side to side without releasing its grip until police manually pulled the dog off of him. Upon arrival to the ED, he was tachycardic in the 120’s, complaining of severe, throbbing, sharp pain in the right lower extremity, and was neurovascular intact on exam. Significant findings: The photograph is of the anterior compartment of the right lower leg demonstrating multiple deep lacerations with exposed and torn muscle. X-ray showed no foreign body. Discussion: Police dog bites should be treated more cautiously than typical dog bites because these highly-trained dogs are generally larger breeds which are taught to subdue suspects with a bite-and-hold technique rather than bite and release. This can lead to extensive crush injuries, fractures, large caliber lacerations with associated muscle tissue injury and/or severe neurovascular compromise.1 Hence, police dog bites often require provocative diagnostic testing, specialist consultation for possible operative repair, and aggressive irrigation and ultimately admission for intravenous antibiotics.1 This patient’s wound was aggressively irrigated and evaluated by plastic surgery in the ED. He was ultimately admitted for intravenous antibiotics, pain control, wound care, and healing by secondary intention.

  4. Effect of ebastine on mosquito bites.

    Science.gov (United States)

    Reunala, T; Brummer-Korvenkontio, H; Petman, L; Palosuo, T; Sarna, S

    1997-07-01

    Mosquito bites usually cause wealing and delayed bite papules. Cetirizine decreases wealing, bite papules and pruritus but the effect of other antihistamines on mosquito bites is unknown. We studied the effect of ebastine in 30 mosquito bite-sensitive adult subjects. Ebastine 10 mg or 20 mg and placebo were given for 4 days in a cross-over fashion. Aedes aegypti bites were given on forearms. The size of the bite lesions and pruritus (visual analogue score) were measured at 15 min, 2, 6, and 24 h after the bites. Twenty-five subjects were evaluable in the study. At 15 min ebastine decreased significantly the size of the bite lesion (p = 0.0017) and pruritus (ptime points were compiled the size of the bite lesion and pruritus score decreased significantly. Sedation occurred during ebastine treatment in 6 (21%) and during placebo treatment in 2 (7%) subjects. The present results show that prophylactically given ebastine is effective against immediate mosquito bite symptoms.

  5. The Spider and the Fly

    Science.gov (United States)

    Mellinger, Keith E.; Viglione, Raymond

    2012-01-01

    The Spider and the Fly puzzle, originally attributed to the great puzzler Henry Ernest Dudeney, and now over 100 years old, asks for the shortest path between two points on a particular square prism. We explore a generalization, find that the original solution only holds in certain cases, and suggest how this discovery might be used in the…

  6. Reliable quantification of bite-force performance requires use of appropriate biting substrate and standardization of bite out-lever.

    Science.gov (United States)

    Lappin, A Kristopher; Jones, Marc E H

    2014-12-15

    Bite-force performance is an ecologically important measure of whole-organism performance that shapes dietary breadth and feeding strategies and, in some taxa, determines reproductive success. It also is a metric that is crucial to testing and evaluating biomechanical models. We reviewed nearly 100 published studies of a range of taxa that incorporate direct in vivo measurements of bite force. Problematically, methods of data collection and processing vary considerably among studies. In particular, there is little consensus on the appropriate substrate to use on the biting surface of force transducers. In addition, the bite out-lever, defined as the distance from the fulcrum (i.e. jaw joint) to the position along the jawline at which the jaws engage the transducer, is rarely taken into account. We examined the effect of bite substrate and bite out-lever on bite-force estimates in a diverse sample of lizards. Results indicate that both variables have a significant impact on the accuracy of measurements. Maximum bite force is significantly greater using leather as the biting substrate compared with a metal substrate. Less-forceful bites on metal are likely due to inhibitory feedback from mechanoreceptors that prevent damage to the feeding apparatus. Standardization of bite out-lever affected which trial produced maximum performance for a given individual. Indeed, maximum bite force is usually underestimated without standardization because it is expected to be greatest at the minimum out-lever (i.e. back of the jaws), which in studies is rarely targeted with success. We assert that future studies should use a pliable substrate, such as leather, and use appropriate standardization for bite out-lever. © 2014. Published by The Company of Biologists Ltd.

  7. Specialised use of working memory by Portia africana, a spider-eating salticid.

    Science.gov (United States)

    Cross, Fiona R; Jackson, Robert R

    2014-03-01

    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  8. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.

    2007-01-01

    . Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

  9. Radiation effect onto biodiversity of spiders

    International Nuclear Information System (INIS)

    Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

    2010-01-01

    At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

  10. Anger biting. The hidden impulse.

    Science.gov (United States)

    Walter, R D

    1985-09-01

    Based upon the paralogical reasoning of the anger-impulsive biter, this paper addresses the overload of emotional catharsis which can block a full memory of the biting event and suspend the logical infrastructure of rational behavior. In an effort to overcome these types of investigative difficulties, the paper suggests an approach to resolve dilemma through decompressing the emotional content into path ways of logical understanding. By offering a network of rationale hooks, the perpetrator becomes better equipped to acknowledge the deed.

  11. Monkey Bites among US Military Members, Afghanistan, 2011

    Science.gov (United States)

    Baker, Katheryn A.

    2012-01-01

    Bites from Macaca mulatta monkeys, native to Afghanistan, can cause serious infections. To determine risk for US military members in Afghanistan, we reviewed records for September–December 2011. Among 126 animal bites and exposures, 10 were monkey bites. Command emphasis is vital for preventing monkey bites; provider training and bite reporting promote postexposure treatment. PMID:23017939

  12. Rat bite fever in a pet lover.

    Science.gov (United States)

    Cunningham, B B; Paller, A S; Katz, B Z

    1998-02-01

    Rat-bite fever is an uncommon bacterial illness resulting from infection with Streptobacillus moniliformis that is often transmitted by the bite of a rat. The cutaneous findings in rat-bite fever are nonspecific but have been described as maculopapular or petechial. We describe a 9-year-old girl with acrally distributed hemorrhagic pustules, fever, and arthralgias. Diagnosis was delayed because of difficulty in identifying the pathologic organism. She was successfully treated with 10 days of ceftriaxone.

  13. The influence of bite size and multiple bites on oral texture sensations

    NARCIS (Netherlands)

    Wijk, de R.A.; Engelen, L.; Prinz, J.F.; Weenen, H.

    2003-01-01

    The influence of bite size on sensory mouth- and afterfeel sensations was explored in two studies in which single bites of vanilla custard desserts were varied from 2 to 11 ml (study 1) and in which series of five bites of two different custard desserts were presented consecutively (study 2). In

  14. The influence of bite size and multiple bites on oral texture sensations

    NARCIS (Netherlands)

    Wijk, R.A. de; Engelen, L.; Prinz, J.F.; Weenen, H.

    2003-01-01

    The influence of bite size on sensory mouthfeel and afterfeel sensations was explored in two studies in which single bites of vanilla custard desserts were varied from 2 to 11 mL (study 1) and in which series of five bites of two different custard desserts were presented consecutively (study 2). In

  15. Venom of the Brazilian spider Sicarius ornatus (Araneae, Sicariidae) contains active sphingomyelinase D: potential for toxicity after envenomation.

    Science.gov (United States)

    Lopes, Priscila Hess; Bertani, Rogério; Gonçalves-de-Andrade, Rute M; Nagahama, Roberto H; van den Berg, Carmen W; Tambourgi, Denise V

    2013-01-01

    The spider family Sicariidae includes two genera, Sicarius and Loxosceles. Bites by Sicarius are uncommon in humans and, in Brazil, a single report is known of a 17-year old man bitten by a Sicarius species that developed a necrotic lesion similar to that caused by Loxosceles. Envenomation by Loxosceles spiders can result in dermonecrosis and severe ulceration. Sicarius and Loxosceles spider venoms share a common characteristic, i.e., the presence of Sphingomyelinases D (SMase D). We have previously shown that Loxosceles SMase D is the enzyme responsible for the main pathological effects of the venom. Recently, it was demonstrated that Sicarius species from Africa, like Loxosceles spiders from the Americas, present high venom SMase D activity. However, despite the presence of SMase D like proteins in venoms of several New World Sicarius species, they had reduced or no detectable SMase D activity. In order to contribute to a better understanding about the toxicity of New World Sicarius venoms, the aim of this study was to characterize the toxic properties of male and female venoms from the Brazilian Sicarius ornatus spider and compare these with venoms from Loxosceles species of medical importance in Brazil. SDS-PAGE analysis showed variations in the composition of Loxosceles spp. and Sicarius ornatus venoms. Differences in the electrophoretic profiles of male and female venoms were also observed, indicating a possible intraspecific variation in the composition of the venom of Sicarius spider. The major component in all tested venoms had a Mr of 32-35 kDa, which was recognized by antiserum raised against Loxosceles SMases D. Moreover, male and female Sicarius ornatus spiders' venoms were able to hydrolyze sphingomyelin, thus showing an enzymatic activity similar to that determined for Loxosceles venoms. Sicarius ornatus venoms, as well as Loxosceles venoms, were able to render erythrocytes susceptible to lysis by autologous serum and to induce a significant loss of

  16. Venom of the Brazilian spider Sicarius ornatus (Araneae, Sicariidae contains active sphingomyelinase D: potential for toxicity after envenomation.

    Directory of Open Access Journals (Sweden)

    Priscila Hess Lopes

    Full Text Available BACKGROUND: The spider family Sicariidae includes two genera, Sicarius and Loxosceles. Bites by Sicarius are uncommon in humans and, in Brazil, a single report is known of a 17-year old man bitten by a Sicarius species that developed a necrotic lesion similar to that caused by Loxosceles. Envenomation by Loxosceles spiders can result in dermonecrosis and severe ulceration. Sicarius and Loxosceles spider venoms share a common characteristic, i.e., the presence of Sphingomyelinases D (SMase D. We have previously shown that Loxosceles SMase D is the enzyme responsible for the main pathological effects of the venom. Recently, it was demonstrated that Sicarius species from Africa, like Loxosceles spiders from the Americas, present high venom SMase D activity. However, despite the presence of SMase D like proteins in venoms of several New World Sicarius species, they had reduced or no detectable SMase D activity. In order to contribute to a better understanding about the toxicity of New World Sicarius venoms, the aim of this study was to characterize the toxic properties of male and female venoms from the Brazilian Sicarius ornatus spider and compare these with venoms from Loxosceles species of medical importance in Brazil. METHODOLOGY/PRINCIPAL FINDINGS: SDS-PAGE analysis showed variations in the composition of Loxosceles spp. and Sicarius ornatus venoms. Differences in the electrophoretic profiles of male and female venoms were also observed, indicating a possible intraspecific variation in the composition of the venom of Sicarius spider. The major component in all tested venoms had a Mr of 32-35 kDa, which was recognized by antiserum raised against Loxosceles SMases D. Moreover, male and female Sicarius ornatus spiders' venoms were able to hydrolyze sphingomyelin, thus showing an enzymatic activity similar to that determined for Loxosceles venoms. Sicarius ornatus venoms, as well as Loxosceles venoms, were able to render erythrocytes susceptible to

  17. Science Education Resources on the Web--Spiders.

    Science.gov (United States)

    Thirunarayanan, M. O.

    1997-01-01

    Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

  18. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

    2012-01-01

    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

  19. Talking to Patients about Preventing Tick Bites

    Centers for Disease Control (CDC) Podcasts

    2012-02-14

    This podcast will help health care providers identify patients who are at increased risk of getting tick bites and provide these patients with tick bite prevention and removal tips.  Created: 2/14/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 2/14/2012.

  20. Functional Analysis and Treatment of Nail Biting

    Science.gov (United States)

    Dufrene, Brad A.; Watson, T. Steuart; Kazmerski, Jennifer S.

    2008-01-01

    This study applied functional analysis methodology to nail biting exhibited by a 24-year-old female graduate student. Results from the brief functional analysis indicated variability in nail biting across assessment conditions. Functional analysis data were then used to guide treatment development and implementation. Treatment included a…

  1. Open bite in prematurely born children.

    Science.gov (United States)

    Harila, V; Heikkinen, T; Grön, M; Alvesalo, L

    2007-01-01

    The aims of this study were to: examine the expression of open bite in prematurely born children and discuss the etiological factors that may lead to bite it. The subjects were 328 prematurely born (cross-sectional study of the Collaborative Perinatal Project in the 1960s and 1970s. Dental documents, including casts and photographs, were taken once at the age of 6-12 years in the mixed dentition. The occlusion was recorded by examining and measuring the hard stone casts. Vertical open bite was recorded only for full erupted teeth. The statistical method used was chi-square analysis. Significant differences in the incidence of anterior open bite (from left to right canine) was found between the preterm and control groups and between gender and ethnic groups. The prevalence of anterior open bite was nearly 9% in the preterm group and almost 7% in the control group. African Americans (9%) had a significantly greater incidence of open bite than Caucasians (3%; Pbite than boys (8% vs 6%; Pbite was increased--especially in preterm African American boys compared to controls (11% vs 8%). The results show differences in the development of anterior open bite between ethnic and gender groups. Premature birth may also influence dental occlusal development. Of importance are the patient's: general health condition; respiratory infections; inadequate nasal- and mouth-breathing; oral habits; and other medical problems. Preterm children may be relatively more predisposed to etiological factors for the development of anterior open bite.

  2. Iguana bites reported to Texas poison centers.

    Science.gov (United States)

    Forrester, Mathias B

    2010-09-01

    Although thousands of iguanas are kept as pets in the United States, information on their bites is limited. The intent of this investigation was to describe the pattern of iguana bites reported to Texas poison centers. Iguana bites reported during 1998-2008 were identified. The distribution of cases by various factors was determined. Of 59 total bites, 71% were managed on-site, 17% of the patients were at or en route to a health care facility when the poison center was contacted, and 10% were referred to a health care facility. The medical outcome was no effect in 9% of the cases, minor effect in 24%, moderate effect in 2%, not followed but minimal effects possible in 64%, and unable to follow but potentially toxic in 2%. Most iguana bites reported to Texas poison centers did not result in serious effects and were managed on-site. Copyright © 2010 Elsevier Inc. All rights reserved.

  3. Biting

    Science.gov (United States)

    ... Distraction works wonders with kids this age. If emotions and energy levels are running high or if boredom has set in, help redirect a little one's attention to a more positive activity, like dancing to music, coloring, or playing a game. Discipline usually is not necessary, since most kids ...

  4. Maternal care and subsocial behaviour in spiders.

    Science.gov (United States)

    Yip, Eric C; Rayor, Linda S

    2014-05-01

    While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  5. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl

    2014-09-01

    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  6. Understanding Spider-Man: Your Everyday Superhero

    OpenAIRE

    Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

    2014-01-01

    This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

  7. Measurement of dynamic bite force during mastication.

    Science.gov (United States)

    Shimada, A; Yamabe, Y; Torisu, T; Baad-Hansen, L; Murata, H; Svensson, P

    2012-05-01

    Efficient mastication of different types and size of food depends on fast integration of sensory information from mechanoreceptors and central control mechanisms of jaw movements and applied bite force. The neural basis underlying mastication has been studied for decades but little progress in understanding the dynamics of bite force has been made mainly due to technical limitations of bite force recorders. The aims of this study were to develop a new intraoral bite force recorder which would allow the study of natural mastication without an increase in the occlusal vertical dimension and subsequently to analyze the relation between electromyographic (EMG) activity of jaw-closing muscles, jaw movements and bite force during mastication of five different types of food. Customized force recorders based on strain gauge sensors were fitted to the upper and lower molar teeth on the preferred chewing side in fourteen healthy and dentate subjects (21-39 years), and recordings were carried out during voluntary mastication of five different kinds of food. Intraoral force recordings were successively obtained from all subjects. anova showed that impulse of bite force as well as integrated EMG was significantly influenced by food (Pmastication with direct implications for oral rehabilitation. We also propose that the control of bite force during mastication is achieved by anticipatory adjustment and encoding of bolus characteristics. © 2012 Blackwell Publishing Ltd.

  8. Court presentation of bite mark evidence.

    Science.gov (United States)

    Drinnan, A J; Melton, M J

    1985-12-01

    The uniqueness of an individual's bite mark is generally accepted. The use of bite mark analysis to identify or exclude those suspected of crimes is now a well established activity in forensic dentistry. Although the techniques for evaluating bite mark evidence are extremely sophisticated, it is important that the courtroom presentation of such evidence should be as simple as possible and be directed towards those who must judge it. Dentists likely to be involved in the courtroom presentation of bite mark evidence should: be certain that their local law enforcement personnel are frequently updated on the techniques to be used for producing the optimum evidence needed to evaluate bite marks; become acquainted with the current techniques of evaluating bite mark evidence and understand their difficulties and pitfalls; meet with the lawyers (prosecution or defence) before a courtroom appearance, briefing them on the significance of the particular findings; prepare clear and easily understandable visual aids to present to the court the techniques used in the analysis and the bases for the conclusion reached; and offer conclusions derived from the bite mark investigation.

  9. Venomous Snake Bite Injuries at Kitui District Hospital | Kihiko ...

    African Journals Online (AJOL)

    Background Snake bites are a neglected public health issue in poor rural communities, and the true burden of snake bites is not known. Kitui County has a high incidence of snake bites and no functional snake bite control programs exists. Diagnostic tests for snake species identification are not available and management ...

  10. Non-webbuilding spiders: prey specialists or generalists?

    Science.gov (United States)

    Nentwig, Wolfgang

    1986-07-01

    Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

  11. Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

    2016-03-30

    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

  12. Edge effect on weevils and spiders

    OpenAIRE

    Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

    2002-01-01

    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  13. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Hair care / hair loss Injured skin Nail care Artificial nails Healthy nails Child nail care Manicure safety Nail biting Nail changes a dermatologist should examine Anti-aging skin care Kids’ zone Video library Find a ...

  14. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... figure out how to avoid these situations and develop a plan to stop. Just knowing when you’ ... a doctor. If you bite your nails and develop a skin or nail infection, consult a board- ...

  15. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... your nails to your face and mouth. To help you stop biting your nails, dermatologists recommend the ... stress ball or silly putty instead. This will help keep your hands busy and away from your ...

  16. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... like biting your nails, try playing with a stress ball or silly putty instead. This will help ... of hangnails, or other triggers, such as boredom, stress, or anxiety. By figuring out what causes you ...

  17. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Part 1: Structure Part 2: Origin Part 3: Function Textbook Study notes Image library 3-D animated ... hair, and nail care Nail care Nail biting "); (function () { var a = "", b = [ "adid=aad-aad-1", "site= ...

  18. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... and nails Skin dictionary Camp Discovery Good Skin Knowledge lesson plans and activities Video library Find a ... counter, this safe, but awful-tasting formula discourages many people from biting their nails. Get regular manicures: ...

  19. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Center Coding and reimbursement Coding MACRA Fee schedule Managing a practice Prior authorization assistance Evaluating practice models ... Child nail care Manicure safety Nail biting Nail changes a dermatologist should examine Anti-aging skin care ...

  20. [Bites of venomous snakes in Switzerland].

    Science.gov (United States)

    Plate, Andreas; Kupferschmidt, Hugo; Schneemann, Markus

    2016-06-08

    Although snake bites are rare in Europe, there are a constant number of snake bites in Switzerland. There are two domestic venomous snakes in Switzerland: the aspic viper (Vipera aspis) and the common European adder (Vipera berus). Bites from venomous snakes are caused either by one of the two domestic venomous snakes or by an exotic venomous snake kept in a terrarium. Snake- bites can cause both a local and/or a systemic envenoming. Potentially fatal systemic complications are related to disturbances of the hemostatic- and cardiovascular system as well as the central or peripheral nervous system. Beside a symptomatic therapy the administration of antivenom is the only causal therapy to neutralize the venomous toxins.

  1. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... hair loss Injured skin Nail care Artificial nails Healthy nails Child nail care Manicure safety Nail biting Nail changes a dermatologist should examine Anti-aging skin care Kids’ zone Video library Find a ...

  2. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Mohs AUC MyDermPath+ Psoriasis Patient education resources Practice Management Center Coding and reimbursement Coding MACRA Fee schedule ... as boredom, stress, or anxiety. By figuring out what causes you to bite your nails, you can ...

  3. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... your head About nails: More important than you think Questions lots of kids ask about their skin, ... habit with a good habit: When you feel like biting your nails, try playing with a stress ...

  4. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... care / hair loss Injured skin Nail care Anti-aging skin care Kids’ zone About skin: Your body's ... biting Nail changes a dermatologist should examine Anti-aging skin care Kids’ zone Video library Find a ...

  5. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Hair care / hair loss Injured skin Nail care Anti-aging skin care Kids’ zone About skin: Your ... Nail biting Nail changes a dermatologist should examine Anti-aging skin care Kids’ zone Video library Find ...

  6. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... biting can also leave you vulnerable to infection as you pass harmful bacteria and viruses from your ... your triggers: These could be physical triggers, such as the presence of hangnails, or other triggers, such ...

  7. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Rotation PICMED Grant Professionalism Award Resident-Fellow QI Project Award Resident International Grant Resident Scholarship to Legislative ... continue through adulthood, and the side effects can be more than cosmetic. Repeated nail biting can make ...

  8. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Scholarship to Legislative Conference Skin Care for Developing Countries Grant State Advocacy Grant Strauss and Katz Scholarship ... like biting your nails, try playing with a stress ball or silly putty instead. This will help ...

  9. Human bite as a weapon of assault

    African Journals Online (AJOL)

    resulted more in bites involving females than males. Contusion (47.6%) ... homicides, sexual assault and also in attempted suicide1. It may be found in ... original work is properly cited. ... deployed for determining tests of statistical significance;.

  10. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... and Lectureship Clarence S. Livingood Award and Lectureship Marion B. Sulzberger Award and Lectureship Master Dermatologist Award Members ... care Nail care Nail biting "); (function () { var a = "", b = [ "adid=aad-aad-1", "site=ehs.con.aad. ...

  11. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Center Meetings and events Make a difference Career planning AAD apps Academy meeting Chronic urticaria—for members ... as boredom, stress, or anxiety. By figuring out what causes you to bite your nails, you can ...

  12. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Part 2: Origin Part 3: Function Textbook Study notes Image library 3-D animated image library Board ... gradually stop biting your nails: Some doctors recommend taking a gradual approach to break the habit. Try ...

  13. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Mohs AUC MyDermPath+ Psoriasis Patient education resources Practice Management Center Coding and reimbursement Coding MACRA Fee schedule ... your nails: Some doctors recommend taking a gradual approach to break the habit. Try to stop biting ...

  14. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Injured skin Nail care Artificial nails Healthy nails Child nail care Manicure safety Nail biting Nail changes ... c Explore the Academy Member resources Practice Tools Education Meetings & events Advocacy Public & patients Academy resources for: ...

  15. Spiders do have melanin after all.

    Science.gov (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

    2015-11-01

    Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

  16. Open bite treatment using clear aligners.

    Science.gov (United States)

    Guarneri, Maria Paola; Oliverio, Teresa; Silvestre, Ivana; Lombardo, Luca; Siciliani, Giuseppe

    2013-09-01

    A 35-year-old female patient with dentoalveolar open bite of 4 mm, molar Class I malocclusion, centered midlines, moderate crowding, and labial inclination of the lower incisor was treated with clear aligners to reduce protrusion and close the anterior open bite. The result showed that clear aligners were an effective method with which to correct this malocclusion. The treatment was complete after 18 months. The patient was satisfied with her new appearance and function.

  17. Anterior open bite treatment with magnets.

    Science.gov (United States)

    Kiliaridis, S; Egermark, I; Thilander, B

    1990-11-01

    The aim of this study was to examine the effects of repelling magnets on the treatment of anterior open bite and compare them with the effects of acrylic posterior bite-blocks. Twenty patients, aged 9-16 years with skeletal anterior open bite, were randomly divided into two groups. In one group the patients wore posterior repelling magnet splints and in the other they wore acrylic posterior bite-blocks of the same thickness as the magnet splints. The patients were instructed to use their appliance as much as possible (the minimum accepted being 18 hours daily) during a 6-month period. Dental casts, intra-oral photos, and lateral cephalograms were taken before and after treatment, and the patients were also examined regularly to identify the development of any craniomandibular disorders. In the first group, the dental and skeletal vertical relation responded quickly to the magnet treatment. The open bite was generally closed in just under 4 months, especially in patients in early mixed dentition. Spacing in the labial segments decreased in some cases, while slight crowding was induced in others. Transverse problems, i.e. unilateral cross-bite, sometimes followed by scissor-bite on the opposite side, was observed in those patients who were in the early mixed dentition and had used the magnets intensively. The patients who wore acrylic posterior bite-blocks also showed improvement in the dental and skeletal vertical relationships, especially during the first months. This was followed by a 'plateau' period. No transverse problems were found in these patients.

  18. Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

    NARCIS (Netherlands)

    Heuts, B.; Brunt, T.

    2009-01-01

    We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

  19. Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

    Science.gov (United States)

    Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

    2011-10-01

    Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

  20. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    Kindt, M.; Brosschot, J.F.

    1999-01-01

    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

  1. Microbiology of Animal Bite Wound Infections

    Science.gov (United States)

    Abrahamian, Fredrick M.; Goldstein, Ellie J. C.

    2011-01-01

    Summary: The microbiology of animal bite wound infections in humans is often polymicrobial, with a broad mixture of aerobic and anaerobic microorganisms. Bacteria recovered from infected bite wounds are most often reflective of the oral flora of the biting animal, which can also be influenced by the microbiome of their ingested prey and other foods. Bacteria may also originate from the victim's own skin or the physical environment at the time of injury. Our review has focused on bite wound infections in humans from dogs, cats, and a variety of other animals such as monkeys, bears, pigs, ferrets, horses, sheep, Tasmanian devils, snakes, Komodo dragons, monitor lizards, iguanas, alligators/crocodiles, rats, guinea pigs, hamsters, prairie dogs, swans, and sharks. The medical literature in this area has been made up mostly of small case series or case reports. Very few studies have been systematic and are often limited to dog or cat bite injuries. Limitations of studies include a lack of established or inconsistent criteria for an infected wound and a failure to utilize optimal techniques in pathogen isolation, especially for anaerobic organisms. There is also a lack of an understanding of the pathogenic significance of all cultured organisms. Gathering information and conducting research in a more systematic and methodical fashion through an organized research network, including zoos, veterinary practices, and rural clinics and hospitals, are needed to better define the microbiology of animal bite wound infections in humans. PMID:21482724

  2. Moving from reclusion to partial freedom: the experience of family caregivers for disabled elderly persons assisted in a day care center.

    Science.gov (United States)

    Bocchi, Silvia Cristina Mangini; Cano, Karen Cristina Urtado; Baltieri, Lilian; Godoy, Daniele Cristina; Spiri, Wilza Carla; Juliani, Carmen Maria Casquel Monti

    2010-09-01

    This study aimed at understanding the interactional experience between family caregivers and disabled elderly persons supported in a Day Care Center according to the caregiver's perspective. It also aimed at developing a representative theoretical model for the events experienced by such caregiver. The Grounded Theory was used as methodological framework whereas Interactional Symbolism served as the theoretical framework. Observation and interviews were used for data collection. The following phenomenon arose from the results: feeling of support by the Day Care Center, by the strength of the bond with the elderly and by spirituality in order to continue playing the challenging role of a family caregiver for a disabled elderly person. The study made possible to understand that, among these three supporting cornerstones for coping with the burden generated by the family caregiver role, the care model promoted by the Day Care Center was the intervenient variable in the process of improving the quality of life of the family caregiver-disabled elderly person binomial. This allowed the identification of the main category--moving from reclusion to partial freedom: the experience of family caregivers for disabled elderly persons assisted in a Day Care Center.

  3. Case Report of a Newborn Injured By Human Bite

    Directory of Open Access Journals (Sweden)

    Emel Ataoğlu

    2015-03-01

    Full Text Available Bite is a type of wound received from the teeth of an animal, including humans. Human bites are third leading cause of all bites after dog and cat bites. Human bites are severe wounds due to the risk of contamination with mix oral flora and rapid tissue destruction. Bite wounds created by humans are seen in variety of circumstances including aggression, rape, murder, and child abuse. Oral cavity contains beta-hemolytic streptococci, anaerobes and other microorganisms. There have been reported cases of septicemia, severe necrotizing fasciitis, HIV infection, and death caused by human bites. Early reporting and treatment of bite wounds decrease the number and severity of wound infection. Here, we present the case of human bite in a nine-day-old girl and discuss the treatment approaches in the light of the relevant literature.

  4. The relationship between oral tori and bite force.

    Science.gov (United States)

    Jeong, Chan-Woo; Kim, Kyung-Ho; Jang, Hyo-Won; Kim, Hye-Sun; Huh, Jong-Ki

    2018-01-12

    Objective The relationship between bite force and torus palatinus or mandibularis remains to be explained. The major aim of this study was to determine the correlation between bite force and oral tori. Methods The bite force of 345 patients was measured with a bite force recorder; impressions of the shape and size of the oral tori were taken on plaster models prior to orthodontic treatments. Subsequently, the relationship between oral tori and bite force was analyzed. Results The size, shape, and incidence of torus palatinus was not significantly correlated with bite force. However, the size of torus mandibularis increased significantly in proportion to the bite force (p = 0.020). The occurrence of different types of oral tori was not correlated with the bite force. Discussion The size of torus mandibularis provides information about bite force and can thus be used to clinically assess occlusal stress.

  5. prevalence of biting and non-biting flies in relation to species

    African Journals Online (AJOL)

    USER

    support high abundance of biting flies due to the favourable conditions within the forest for breeding, refuge and easy migration of adult females to animal cages to seek for blood meal. Table 1: Abundance of Biting Flies in Relation to Species in the Jos Museum. Zoological Garden. Site. Stomoxys calcitrans. Haematopota.

  6. Energetics, scaling and sexual size dimorphism of spiders.

    Science.gov (United States)

    Grossi, B; Canals, M

    2015-03-01

    The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

  7. Spider diffraction: a comparison of curved and straight legs

    International Nuclear Information System (INIS)

    Richter, J.L.

    1984-01-01

    It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

  8. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Science.gov (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

    2014-01-01

    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  9. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

    Science.gov (United States)

    Uma, Divya B; Weiss, Martha R

    2012-12-01

    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  10. Fish predation by semi-aquatic spiders: a global pattern.

    Directory of Open Access Journals (Sweden)

    Martin Nyffeler

    Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  11. Fish predation by semi-aquatic spiders: a global pattern.

    Science.gov (United States)

    Nyffeler, Martin; Pusey, Bradley J

    2014-01-01

    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  12. Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

    DEFF Research Database (Denmark)

    Bilde, T.; Maklakov, A.A.; Schilling, Nadia

    2007-01-01

    avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

  13. Optically probing torsional superelasticity in spider silks

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

    2013-11-11

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

  14. SPIDER: A Framework for Understanding Driver Distraction.

    Science.gov (United States)

    Strayer, David L; Fisher, Donald L

    2016-02-01

    The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

  15. Optically probing torsional superelasticity in spider silks

    International Nuclear Information System (INIS)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

    2013-01-01

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

  16. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth

    2002-05-01

    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  17. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... var c = 0; c Tips to prevent and treat bug bites Although most bug bites are harmless, some can spread dangerous diseases like Zika virus, dengue, Lyme disease, and malaria. Particularly if you’re ...

  18. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... bites Although most bug bites are harmless, some can spread dangerous diseases like Zika virus, dengue, Lyme ... and tuck your shirt into your pants. You can also pre-treat outer layers of clothing with ...

  19. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... a dermatologist Why see a board-certified dermatologist? Home Public and patients Skin, hair, and nail care ... bites and stings can be safely treated at home. To treat bug bites and stings at home, ...

  20. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

    2011-05-15

    Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  1. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    International Nuclear Information System (INIS)

    Akamatsu, Fumikazu; Toda, Hideshige

    2011-01-01

    Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  2. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

    2014-01-01

    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  3. Uncovering the structure-function relationship in spider silk

    Science.gov (United States)

    Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

    2018-03-01

    All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

  4. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen

    2012-03-01

    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  5. Recombinant DNA production of spider silk proteins.

    Science.gov (United States)

    Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

    2013-11-01

    Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

  6. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff

    2006-01-01

    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  7. Bacteremia with Bacteroides pyogenes after a cat bite

    DEFF Research Database (Denmark)

    Madsen, Ida Ringsborg; Justesen, Ulrik Stenz

    2011-01-01

    Animal bite wounds are often infected with bacteria from the animal's oral flora. We report what we believe to be the first case of bacteremia with Bacteroides pyogenes resulting from an infected cat bite.......Animal bite wounds are often infected with bacteria from the animal's oral flora. We report what we believe to be the first case of bacteremia with Bacteroides pyogenes resulting from an infected cat bite....

  8. Scrotal dog bite: unusual case and review of pediatric literature.

    Science.gov (United States)

    Bertozzi, M; Prestipino, M; Nardi, N; Falcone, F; Appignani, A

    2009-09-01

    Animal bites to human external genitalia are rare. Only a few cases of scrotal dog bite in children have been reported. We present an additional specific case of a scrotal dog bite in a child because the lesion and its repair have not been previously reported in published pediatric studies. A traumatic resection of the right testicular vas deferens was repaired by microsurgical vasoepididymal anastomosis. A review of the published data was also performed to analyze the management of scrotal dog bite lesions.

  9. Cheek-biting disorder: another stereotypic movement disorder?

    Science.gov (United States)

    Sarkhel, Sujit; Praharaj, Samir Kumar; Akhtar, Sayeed

    2011-12-01

    Recurrent cheek biting, a form of self-injurious behavior is a rare entity which presents mostly to dentists and dermatologists. We report a case of recurrent severe cheek biting in an adult male leading to mucosal ulceration. The stereotypic pattern of cheek biting and associated behavior bears striking resemblance to other impulse control disorders. Copyright © 2011 Elsevier Ltd. All rights reserved.

  10. Vine snake (Thelotornis capensis bite in a dog : clinical communication

    Directory of Open Access Journals (Sweden)

    J. Otto

    2003-06-01

    Full Text Available A vine snake bite in a dog is reported. There was continued minor bleeding from the assumed nose bite site for 4 days. Currently manufactured snakebite antivenom is not effective against vine snake bites and treatment is supportive.

  11. Moving from reclusion to partial freedom: the experience of family caregivers for disabled elderly persons assisted in a day care center Movendo-se da reclusão à liberdade parcial: a experiência do cuidador familiar de idoso dependente assistido num centro-dia

    Directory of Open Access Journals (Sweden)

    Silvia Cristina Mangini Bocchi

    2010-09-01

    Full Text Available This study aimed at understanding the interactional experience between family caregivers and disabled elderly persons supported in a Day Care Center according to the caregiver's perspective. It also aimed at developing a representative theoretical model for the events experienced by such caregiver. The Grounded Theory was used as methodological framework whereas Interactional Symbolism served as the theoretical framework. Observation and interviews were used for data collection. The following phenomenon arose from the results: feeling of support by the Day Care Center, by the strength of the bond with the elderly and by spirituality in order to continue playing the challenging role of a family caregiver for a disabled elderly person. The study made possible to understand that, among these three supporting cornerstones for coping with the burden generated by the family caregiver role, the care model promoted by the Day Care Center was the intervenient variable in the process of improving the quality of life of the family caregiver-disabled elderly person binomial. This allowed the identification of the main category - moving from reclusion to partial freedom: the experience of family caregivers for disabled elderly persons assisted in a Day Care Center.O estudo teve como objetivos: compreender a experiência interacional cuidador familiar-idoso dependente apoiada por um Centro-Dia (CD, segundo a perspectiva do cuidador familiar, e desenvolver um modelo teórico representativo da experiência vivida por ele. Utilizou-se como referencial metodológico a Grounded Theory e como referencial teórico o Interacionismo Simbólico. As estratégias para a obtenção dos dados foram a observação e a entrevista. Dos resultados emergiu o fenômeno: sentindo-se apoiado pelo CD, pela força do vínculo com o idoso e pela espiritualidade para continuar desempenhando o papel desafiante de cuidador familiar de idoso dependente. O trabalho permitiu

  12. prevalence of biting and non-biting flies in relation to species

    African Journals Online (AJOL)

    USER

    The biting effects on resident animals and ... and second largest tourist destination in Nigeria will require concerted efforts to put in proper ... hosts from pool of available susceptible hosts (Okoth ..... communities of the lower Cross River Basin.

  13. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... biting "); (function () { var a = "", b = [ "adid=aad-aad-1", "site=ehs.con.aad.aad", "size=160x600", "vpos=t", "hpos=l", "zone=public", "mcat1=de12", ]; for (var c = 0; c "); (function () { var a = "", b = [ "adid=aad-aad- ...

  14. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Mohs AUC MyDermPath+ Psoriasis Patient education resources Practice Management Center Coding and reimbursement Coding MACRA Fee schedule ... Child nail care Manicure safety Nail biting Nail changes a dermatologist should examine Anti-aging skin care ...

  15. Non-biting Muscidae and control methods

    DEFF Research Database (Denmark)

    Thomas, G.; Jespersen, Jørgen B.

    1994-01-01

    Many non-biting muscids (filth flies) are characterised by the habit of visiting manure or rotting organic material to Seed and/or oviposit. As these flies also often have close associations with human beings, as well as human habitations and domestic animals, they are potentially both a nuisance...

  16. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... and nail care Nail care Nail biting "); (function () { var a = "", b = [ "adid=aad-aad-1", "site=ehs. ... t", "hpos=l", "zone=public", "mcat1=de12", ]; for (var c = 0; c "); (function () { var a = "", b = [ "adid= ...

  17. How to Stop Biting Your Nails

    Medline Plus

    Full Text Available ... Private payer Medicare physician payment MACRA implementation Alternative payment models Fee schedule State policy State policy and action ... a dermatologist Why see a board-certified dermatologist? Home Public and patients Skin, hair, and nail care Nail care Nail biting "); (function () { var a = "", b = [ " ...

  18. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Walton, L.A.

    1980-01-01

    A description is given of an improved design of burnable poison rods and their associated spiders used in the fuel assemblies of pressurized water power reactor cores which allows the rods to be installed and removed more quickly, simply and gently than in previously described systems. (U.K.)

  19. Silk Spinning in Silkworms and Spiders.

    Science.gov (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna

    2016-08-09

    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  20. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  1. SPiDer: Smart Pill Dispenser

    OpenAIRE

    Moreno Vázquez, Jonatan

    2013-01-01

    Aquest projecte proposa el sistema SPiDer el qual te l'objectiu d'assistir a la gent gran en el procés de medicar-se evitant els problemes associats amb la baixa adherència existent actualment amb els calendaris farmacològics receptats pels doctors.

  2. Snake-bite-induced Acute Kidney Injury

    International Nuclear Information System (INIS)

    Naqvi, R.

    2016-01-01

    Objective: To describe the clinical spectrum and outcome of patients presenting to a tertiary care kidney center, developing acute kidney injury (AKI) after snake-bite. Study Design: An observational study. Place and Duration of Study: Nephrology Department, Sindh Institute of Urology and Transplantation (SIUT), Karachi, from January 1990 to December 2014. Methodology: All patients coming to SIUT identified as having AKI after snake-bite during the study period were included. AKI was defined according to RIFLE criteria with sudden rise in creatinine or decline in urine output or both. Demographics, clinical presentation, laboratory profile, and final outcome was noted. Result: During the studied period, 115 cases of AKI, secondary to snake-bite, were registered at this institution. Median age of patients was 35.92 ±15.04 (range: 6 - 70) years and male to female ratio was 1.6:1. Time from bite and referral to this hospital ranged from 2 to 28 days (mean: 8.77 ±5.58 days). Oligo-anuria was the most common presentation, being found in 98 (93.90 percentage) patients. Bleeding diathesis was reported in 75 (65.21 percentage) patients on presentation. All patients had normal sized, non-obstructed kidneys on ultrasonography, with no previous comorbids. Renal replacement therapy (RRT) was required in 106 (92.17 percentage) patients. Complete recovery was seen in 59 (51.30 percentage), while 15 (13.04 percentage) patients expired during acute phase of illness, 4 (3.47 percentage) developed CKD, 11 (9.56 percentage) required dialysis beyond 90 days, and 26 (22.60 percentage) were lost to long-term follow-up. Conclusion: Snake-bite, leading to multiple complications including renal failure and death, is a major health issue in tropical countries. Late referral of these patients to specialized centres Result in undesirable outcome. (author)

  3. Status of the CNESM diagnostic for SPIDER

    International Nuclear Information System (INIS)

    Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

    2015-01-01

    Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

  4. Bite marks on skin and clay: A comparative analysis

    Directory of Open Access Journals (Sweden)

    R.K. Gorea

    2014-12-01

    Full Text Available Bite marks are always unique because teeth are distinctive. Bite marks are often observed at the crime scene in sexual and in physical assault cases on the skin of the victims and sometimes on edible leftovers in burglary cases. This piece of evidence is often ignored, but if properly harvested and investigated, bite marks may prove useful in apprehending and successfully prosecuting the criminals. Due to the importance of bite marks, we conducted a progressive randomised experimental study conducted on volunteers. A total of 188 bite marks on clay were studied. Based on these findings, 93.34% of the volunteers could be identified from the bite marks on the clay. In addition, 201 impressions on skin were studied, and out of these cases, 41.01% of the same volunteers could be identified based on the bite mark impressions on the skin.

  5. Establishment of the Brown Widow Spider (Araneae: Theridiidae) and Infestation of its Egg Sacs by a Parasitoid, Philolema latrodecti (Hymenoptera: Eurytomidae), in French Polynesia and the Cook Islands.

    Science.gov (United States)

    Marie, Jérôme; Vetter, Richard S

    2015-11-01

    This paper presents two newly established species for French Polynesia: the invasive brown widow spider, Latrodectus geometricus C. L. Koch, and its potential biocontrol agent, the parasitoid wasp, Philolema latrodecti (Fullaway). The brown widow spider was recorded from the island of Moorea in 2006 and, since that discovery, the occurrence of this species has expanded to two of the five archipelagos of French Polynesia including the main island of Tahiti and four of the Cook Islands. Although the tropical climate contributes to the establishment of L. geometricus, a biotic factor, P. latrodecti, may restrain population from demographic explosion. This eurytomid wasp is present in French Polynesia and is a parasitoid that has been used in biological control of the southern black widow Latrodectus mactans (F.) in Hawaii. This wasp could become a significant limiting factor for L. geometricus distribution on these islands, as it was found in 31% of the Tahitian brown widow spider egg sacs that were dissected. However, thus far, the wasp was only found on Tahiti in association with the brown widow spider. Although the brown widow is generally considered to be less toxic than its black widow relatives, it remains of medical concern in French Polynesia because reactions to its bites can, at times, be severe. The spider remains of public concern because it is a novel species; it has the word widow in its name and dark morphs are mistaken as black widows. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  7. Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

    Science.gov (United States)

    Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

    2009-06-01

    Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

  8. What you fear will appear: detection of schematic spiders in spider fear.

    Science.gov (United States)

    Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

    2010-01-01

    Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

  9. Learning to avoid spiders: fear predicts performance, not competence.

    Science.gov (United States)

    Luo, Xijia; Becker, Eni S; Rinck, Mike

    2018-01-05

    We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

  10. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  11. Second-order nonlinear optical microscopy of spider silk

    Science.gov (United States)

    Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

    2017-06-01

    Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

  12. The influence of bubbles on the perception carbonation bite.

    Directory of Open Access Journals (Sweden)

    Paul M Wise

    Full Text Available Although many people naively assume that the bite of carbonation is due to tactile stimulation of the oral cavity by bubbles, it has become increasingly clear that carbonation bite comes mainly from formation of carbonic acid in the oral mucosa. In Experiment 1, we asked whether bubbles were in fact required to perceive carbonation bite. Subjects rated oral pungency from several concentrations of carbonated water both at normal atmospheric pressure (at which bubbles could form and at 2.0 atmospheres pressure (at which bubbles did not form. Ratings of carbonation bite under the two pressure conditions were essentially identical, indicating that bubbles are not required for pungency. In Experiment 2, we created controlled streams of air bubbles around the tongue in mildly pungent CO2 solutions to determine how tactile stimulation from bubbles affects carbonation bite. Since innocuous sensations like light touch and cooling often suppress pain, we predicted that bubbles might reduce rated bite. Contrary to prediction, air bubbles flowing around the tongue significantly enhanced rated bite, without inducing perceived bite in blank (un-carbonated solutions. Accordingly, though bubbles are clearly not required for carbonation bite, they may well modulate perceived bite. More generally, the results show that innocuous tactile stimulation can enhance chemogenic pain. Possible physiological mechanisms are discussed.

  13. Effects of bruxism on the maximum bite force

    Directory of Open Access Journals (Sweden)

    Todić Jelena T.

    2017-01-01

    Full Text Available Background/Aim. Bruxism is a parafunctional activity of the masticatory system, which is characterized by clenching or grinding of teeth. The purpose of this study was to determine whether the presence of bruxism has impact on maximum bite force, with particular reference to the potential impact of gender on bite force values. Methods. This study included two groups of subjects: without and with bruxism. The presence of bruxism in the subjects was registered using a specific clinical questionnaire on bruxism and physical examination. The subjects from both groups were submitted to the procedure of measuring the maximum bite pressure and occlusal contact area using a single-sheet pressure-sensitive films (Fuji Prescale MS and HS Film. Maximal bite force was obtained by multiplying maximal bite pressure and occlusal contact area values. Results. The average values of maximal bite force were significantly higher in the subjects with bruxism compared to those without bruxism (p 0.01. Maximal bite force was significantly higher in the males compared to the females in all segments of the research. Conclusion. The presence of bruxism influences the increase in the maximum bite force as shown in this study. Gender is a significant determinant of bite force. Registration of maximum bite force can be used in diagnosing and analysing pathophysiological events during bruxism.

  14. Bite Forces and Their Measurement in Dogs and Cats

    Directory of Open Access Journals (Sweden)

    Se Eun Kim

    2018-04-01

    Full Text Available Bite force is generated by the interaction of the masticatory muscles, the mandibles and maxillae, the temporomandibular joints (TMJs, and the teeth. Several methods to measure bite forces in dogs and cats have been described. Direct in vivo measurement of a bite in dogs has been done; however, bite forces were highly variable due to animal volition, situation, or specific measurement technique. Bite force has been measured in vivo from anesthetized dogs by electrical stimulation of jaw adductor muscles, but this may not be reflective of volitional bite force during natural activity. In vitro bite forces have been estimated by calculation of the force produced using mechanical equations representing the jaw adductor muscles and of the mandible and skull structure Bite force can be estimated in silico using finite element analysis (FEA of the computed model of the anatomical structures. FEA can estimate bite force in extinct species; however, estimates may be lower than the measurements in live animals and would have to be validated specifically in domestic dogs and cats to be reliable. The main factors affecting the bite forces in dogs and cats are body weight and the skull’s morphology and size. Other factors such as oral pain, TMJ disorders, masticatory muscle atrophy, and malocclusion may also affect bite force. Knowledge of bite forces in dogs and cats is essential for various clinical and research fields such as the development of implants, materials, and surgical techniques as well as for forensic medicine. This paper is a summary of current knowledge of bite forces in dogs and cats, including the effect of measurement methods and of other factors.

  15. Annual incidence of snake bite in rural bangladesh.

    Directory of Open Access Journals (Sweden)

    Ridwanur Rahman

    Full Text Available BACKGROUND: Snake bite is a neglected public health problem in the world and one of the major causes of mortality and morbidity in many areas, particularly in the rural tropics. It also poses substantial economic burdens on the snake bite victims due to treatment related expenditure and loss of productivity. An accurate estimate of the risk of snake bite is largely unknown for most countries in the developing world, especially South-East Asia. METHODOLOGY/PRINCIPAL FINDINGS: We undertook a national epidemiological survey to determine the annual incidence density of snake bite among the rural Bangladeshi population. Information on frequency of snake bite and individuals' length of stay in selected households over the preceding twelve months was rigorously collected from the respondents through an interviewer administered questionnaire. Point estimates and confidence intervals of the incidence density of snake bite, weighted and adjusted for the multi-stage cluster sampling design, were obtained. Out of 18,857 study participants, over one year a total of 98 snake bites, including one death were reported in rural Bangladesh. The estimated incidence density of snake bite is 623.4/100,000 person years (95% C I 513.4-789.2/100,000 person years. Biting occurs mostly when individuals are at work. The majority of the victims (71% receive snake bites to their lower extremities. Eighty-six percent of the victims received some form of management within two hours of snake bite, although only three percent of the victims went directly to either a medical doctor or a hospital. CONCLUSIONS/SIGNIFICANCE: Incidence density of snake bite in rural Bangladesh is substantially higher than previously estimated. This is likely due to better ascertainment of the incidence through a population based survey. Poor access to health services increases snake bite related morbidity and mortality; therefore, effective public health actions are warranted.

  16. Bite Forces and Their Measurement in Dogs and Cats.

    Science.gov (United States)

    Kim, Se Eun; Arzi, Boaz; Garcia, Tanya C; Verstraete, Frank J M

    2018-01-01

    Bite force is generated by the interaction of the masticatory muscles, the mandibles and maxillae, the temporomandibular joints (TMJs), and the teeth. Several methods to measure bite forces in dogs and cats have been described. Direct in vivo measurement of a bite in dogs has been done; however, bite forces were highly variable due to animal volition, situation, or specific measurement technique. Bite force has been measured in vivo from anesthetized dogs by electrical stimulation of jaw adductor muscles, but this may not be reflective of volitional bite force during natural activity. In vitro bite forces have been estimated by calculation of the force produced using mechanical equations representing the jaw adductor muscles and of the mandible and skull structure Bite force can be estimated in silico using finite element analysis (FEA) of the computed model of the anatomical structures. FEA can estimate bite force in extinct species; however, estimates may be lower than the measurements in live animals and would have to be validated specifically in domestic dogs and cats to be reliable. The main factors affecting the bite forces in dogs and cats are body weight and the skull's morphology and size. Other factors such as oral pain, TMJ disorders, masticatory muscle atrophy, and malocclusion may also affect bite force. Knowledge of bite forces in dogs and cats is essential for various clinical and research fields such as the development of implants, materials, and surgical techniques as well as for forensic medicine. This paper is a summary of current knowledge of bite forces in dogs and cats, including the effect of measurement methods and of other factors.

  17. Evaluation of Snake Bites with Bedside Ultrasonography

    Directory of Open Access Journals (Sweden)

    Josef E Jolissaint

    2018-04-01

    Full Text Available History of present illness: While watering his lawn, a 36-year-old man felt two sharp bites to his bilateral ankles. He reports that he then saw a light brown, 2-foot snake slither away from him. He came to the emergency department because of pain and swelling in his ankles and inability to bear weight. Physical examination revealed bilateral ankle swelling and puncture marks on his left lateral heel and medial right ankle. Palpation, passive flexion and extension elicited severe pain bilaterally. Blood work including prothrombin time (PT, partial thromboplastin time (PTT, international normalized ratio (INR, and fibrinogen were within normal limits. Consultation with Poison Control indicated the snake was likely a copperhead, which is a venomous snake whose bites rarely require antivenin. Significant findings: In this case, ultrasonography of the lateral surface of the left foot revealed soft tissue edema (red arrow and fluid collection (white asterisk adjacent to the extensor tendon (white arrow. The edematous area resembles cobblestones, with hypoechoic areas of fluid spanning relatively hyperechoic fat lobules. The tendon is surrounded by anechoic fluid, expanding the potential space in the sheath. No hyperechoic foreign objects were noted. Discussion: The patient was diagnosed with soft tissue injury and extensor tenosynovitis after a snake envenomation. Snake venom contains metalloproteinases and other enzymatic proteins that cause local tissue edema and necrosis.1 After a snake bite, ultrasound can be used to assess for retained fangs, soft tissue edema, tendon sheath fluid, muscle fasciculation, and injury to deeper musculature that may not be readily apparent on physical exam.2,3 Most patients with tenosynovitis will recover with immobilization of the joint and non-steroidal anti-inflammatory medications.4 Rarely, the tendon may become infected requiring antibiotics and surgical intervention.4 Topics: Ultrasound, snake envenomation

  18. [Surgical management of animal bites in children].

    Science.gov (United States)

    Touzet-Roumazeille, S; Jayyosi, L; Plenier, Y; Guyot, E; Guillard, T; François, C

    2016-10-01

    Children represent a population at risk, because of their short size, their naivety and their attraction to animals. The face and hands are the most specific locations in young children. Wounds are often multiple. In more than half the cases, the child knows the animal, which are dogs and cats by frequency argument. The bite episode occurs mostly when the child is alone with the pet without direct supervision, while playing or stroking the animal. As in all bites, pediatric lesions are infectious, functional and aesthetic emergencies, but the goal of this work was primarily to make a point on principles of surgical management of animal bites in children, highlighting pediatric specificities. Animal bites require psychological, anesthetic and surgical treatment, adapted to the child, in a specialized structure. Hospitalization and general anesthesia are more frequent in children. Any suspicion of mistreatment (and/or abuse) should lead to the child's hospitalization, even if wounds do not justify monitoring in a surgical environment. Emergency surgery is essential to limit functional and aesthetic consequences. The healing capacities of the child and the frequent lack of co-morbidity allow a conservative surgical treatment with suture, repositioning skin flaps and controlled healing in the first place. Immobilization, drainage, and antibiotics will complete the surgery. The healing process, however, leads to a specific management during scar remodeling phase and growth. Psychological care of the child and parents should not be forgotten, and has to start at the same time as surgical treatment at in acute phase. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  19. Araneae Sloveniae: a national spider species checklist.

    Science.gov (United States)

    Kostanjšek, Rok; Kuntner, Matjaž

    2015-01-01

    The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  20. Logic circuits based on molecular spider systems.

    Science.gov (United States)

    Mo, Dandan; Lakin, Matthew R; Stefanovic, Darko

    2016-08-01

    Spatial locality brings the advantages of computation speed-up and sequence reuse to molecular computing. In particular, molecular walkers that undergo localized reactions are of interest for implementing logic computations at the nanoscale. We use molecular spider walkers to implement logic circuits. We develop an extended multi-spider model with a dynamic environment wherein signal transmission is triggered via localized reactions, and use this model to implement three basic gates (AND, OR, NOT) and a cascading mechanism. We develop an algorithm to automatically generate the layout of the circuit. We use a kinetic Monte Carlo algorithm to simulate circuit computations, and we analyze circuit complexity: our design scales linearly with formula size and has a logarithmic time complexity. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  1. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek

    2015-01-01

    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  2. Biting back: BiTE antibodies as a promising therapy for acute myeloid leukemia.

    Science.gov (United States)

    Walter, Roland B

    2014-06-01

    The experience with gemtuzumab ozogamicin has highlighted both the potential value and limitations of antibodies in acute myeloid leukemia (AML). Recently, bispecific T-cell engager (BiTE) antibodies have emerged as a means to harness polyclonal cytotoxic T-cells and cause highly efficient lysis of targeted tumor cells. Promising early results have been obtained with the CD19-directed BiTE antibody, blinatumomab, in patients with acute lymphoblastic leukemia. A first candidate for AML is the CD33/CD3 molecule, AMG 330, for which several recent preclinical studies demonstrated high potency and efficacy in destroying CD33(+) human AML cells. Many questions remain to be addressed, but BiTE antibodies may offer an exciting new tool in a disease for which the outcomes in many patients remain unsatisfactory.

  3. First Pediatric Case of Tularemia after a Coyote Bite

    Directory of Open Access Journals (Sweden)

    Bruno B. Chomel

    2016-01-01

    Full Text Available Bite-transmitted tularemia is a rare event in humans and most of the cases have been associated with cat bites. We report the first pediatric case of tularemia caused by a coyote (Canis latrans bite. Coyotes can be healthy carriers of Francisella tularensis and transmit this infectious agent through a bite. Pediatricians should be aware of this risk after a carnivore bite and implement appropriate antibiotic therapy, as amoxicillin/clavulanate potassium (Augmentin may have prolonged the typical two to three days’ incubation period commonly observed for tularemia after an animal bite and was not effective in preventing clinical signs in this child. Finally, it emphasizes again the importance of early and late serum samples for appropriate serodiagnostic.

  4. Nanofibre production in spiders without electric charge.

    Science.gov (United States)

    Joel, Anna-Christin; Baumgartner, Werner

    2017-06-15

    Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

  5. Progress on development of SPIDER diagnostics

    Science.gov (United States)

    Pasqualotto, R.; Agostini, M.; Barbisan, M.; Bernardi, M.; Brombin, M.; Cavazzana, R.; Croci, G.; Palma, M. Dalla; Delogu, R. S.; Gorini, G.; Lotto, L.; Muraro, A.; Peruzzo, S.; Pimazzoni, A.; Pomaro, N.; Rizzolo, A.; Serianni, G.; Spolaore, M.; Tardocchi, M.; Zaniol, B.; Zaupa, M.

    2017-08-01

    SPIDER experiment, the full size prototype of the beam source for the ITER heating neutral beam injector, has to demonstrate extraction and acceleration to 100 kV of a large negative ion hydrogen or deuterium beam with co-extracted electron fraction e-/D- SPIDER plant systems are being installed, the different diagnostic systems are in the procurement phase. Their final design is described here with a focus on some key solutions and most original and cost effective implementations. Thermocouples used to measure the power load distribution in the source and over the beam dump front surface will be efficiently fixed with proven technique and acquired through commercial and custom electronics. Spectroscopy needs to use well collimated lines of sight and will employ novel design spectrometers with higher efficiency and resolution and filtered detectors with custom built amplifiers. The electrostatic probes will be operated through electronics specifically developed to cope with the challenging environment of the RF source. The instrumented calorimeter STRIKE will use new CFC tiles, still under development. Two linear cameras, one built in house, have been tested as suitable for optical beam tomography. Some diagnostic components are off the shelf, others are custom developed: some of these are being prototyped or are under test before final production and installation, which will be completed before start of SPIDER operation.

  6. Open Fracture of the Forearm Bones due to Horse Bite

    OpenAIRE

    Santoshi, John Ashutosh; Leshem, Lall

    2014-01-01

    Introduction: Fractures have been described mainly following falling accidents in horse-related injuries. Horse bites are uncommon accidents. We present a case of open fracture of the forearm due to horse bite. Case Report: A 35-year-old male farm-worker presented to the emergency room with alleged history of horse bite to the right forearm about 2 hours prior to presentation while feeding the horse. There was deformity of the forearm with multiple puncture wounds, deep abrasions and small...

  7. Bite force measurement based on fiber Bragg grating sensor

    Science.gov (United States)

    Padma, Srivani; Umesh, Sharath; Asokan, Sundarrajan; Srinivas, Talabattula

    2017-10-01

    The maximum level of voluntary bite force, which results from the combined action of muscle of mastication, joints, and teeth, i.e., craniomandibular structure, is considered as one of the major indicators for the functional state of the masticatory system. Measurement of voluntary bite force provides useful data for the jaw muscle function and activity along with assessment of prosthetics. This study proposes an in vivo methodology for the dynamic measurement of bite force employing a fiber Bragg grating (FBG) sensor known as bite force measurement device (BFMD). The BFMD developed is a noninvasive intraoral device, which transduces the bite force exerted at the occlusal surface into strain variations on a metal plate. These strain variations are acquired by the FBG sensor bonded over it. The BFMD developed facilitates adjustment of the distance between the biting platform, which is essential to capture the maximum voluntary bite force at three different positions of teeth, namely incisor, premolar, and molar sites. The clinically relevant bite forces are measured at incisor, molar, and premolar position and have been compared against each other. Furthermore, the bite forces measured with all subjects are segregated according to gender and also compared against each other.

  8. Management of Poisonous Snake Bites in Southern Taiwan

    Directory of Open Access Journals (Sweden)

    Kao-Ping Chang

    2007-10-01

    Full Text Available Snake bite envenomation is not uncommon in Taiwan. This study focuses on the pattern of poisonous snake bites and their management in southern Taiwan over a 5-year period. The case histories of 37 patients with poisonous snake bites admitted to the Kaohsiung Medical University Hospital between June 2001 and July 2005 were analyzed retrospectively. Three patients, bitten by unknown species of venomous snakes, were excluded from this study. The frequency of snake bites from each species of snake, the local and systemic manifestations of snake bite, treatment of complications and final outcomes were analyzed. Of the remaining 34 patients, 11 (32.4% were bitten by bamboo vipers, 10 (29.4% by Russell's pit vipers, 8 (23.5% by Taiwan cobras and 5 (14.7% by Taiwan Habu. The majority of snake bites (28 occurred between May and November. Those affected were mainly outdoor hikers (14 and workers (9. The antivenin requirements for treatment in the emergency room were in accordance with standard procedures. No mortality was noted among those envenomed by poisonous snakes. Although poisonous snake bite is not a common life-threatening emergency in the study area, we observed both an environmental risk and a seasonal incidence of snake bite. Keeping the varied clinical manifestations of snake bite in mind is important for effective management. Ready availability and appropriate use of antivenin, close monitoring of patients, institution of ventilatory support and early referral to a larger hospital when required, all help reduce mortality.

  9. A Novel Hyaluronidase from Brown Spider (Loxosceles intermedia) Venom (Dietrich's Hyaluronidase): From Cloning to Functional Characterization

    Science.gov (United States)

    Ferrer, Valéria Pereira; de Mari, Thiago Lopes; Gremski, Luiza Helena; Trevisan Silva, Dilza; da Silveira, Rafael Bertoni; Gremski, Waldemiro; Chaim, Olga Meiri; Senff-Ribeiro, Andrea; Nader, Helena Bonciani; Veiga, Silvio Sanches

    2013-01-01

    Loxoscelism is the designation given to clinical symptoms evoked by Loxosceles spider's bites. Clinical manifestations include skin necrosis with gravitational spreading and systemic disturbs. The venom contains several enzymatic toxins. Herein, we describe the cloning, expression, refolding and biological evaluation of a novel brown spider protein characterized as a hyaluronidase. Employing a venom gland cDNA library, we cloned a hyaluronidase (1200 bp cDNA) that encodes for a signal peptide and a mature protein. Amino acid alignment revealed a structural relationship with members of hyaluronidase family, such as scorpion and snake species. Recombinant hyaluronidase was expressed as N-terminal His-tag fusion protein (∼45 kDa) in inclusion bodies and activity was achieved using refolding. Immunoblot analysis showed that antibodies that recognize the recombinant protein cross-reacted with hyaluronidase from whole venom as well as an anti-venom serum reacted with recombinant protein. Recombinant hyaluronidase was able to degrade purified hyaluronic acid (HA) and chondroitin sulfate (CS), while dermatan sulfate (DS) and heparan sulfate (HS) were not affected. Zymograph experiments resulted in ∼45 kDa lytic zones in hyaluronic acid (HA) and chondroitin sulfate (CS) substrates. Through in vivo experiments of dermonecrosis using rabbit skin, the recombinant hyaluronidase was shown to increase the dermonecrotic effect produced by recombinant dermonecrotic toxin from L. intermedia venom (LiRecDT1). These data support the hypothesis that hyaluronidase is a “spreading factor”. Recombinant hyaluronidase provides a useful tool for biotechnological ends. We propose the name Dietrich's Hyaluronidase for this enzyme, in honor of Professor Carl Peter von Dietrich, who dedicated his life to studying proteoglycans and glycosaminoglycans. PMID:23658852

  10. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

    2014-01-01

    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  11. Who is afraid of a black Spider(-Man)?

    OpenAIRE

    Ora C. McWilliams

    2013-01-01

    An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  12. Who is afraid of a black Spider(-Man?

    Directory of Open Access Journals (Sweden)

    Ora C. McWilliams

    2013-06-01

    Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  13. Spider diversity in relation to habitat heterogeneity and an altitudinal ...

    African Journals Online (AJOL)

    Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

  14. Time-dependent motor properties of multipedal molecular spiders.

    Science.gov (United States)

    Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

    2011-09-01

    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  15. Evidence for competition between carnivorous plants and spiders.

    Science.gov (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

    2010-10-07

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

  16. Are temperate canopy spiders tree-species specific?

    Science.gov (United States)

    Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

    2014-01-01

    Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

  17. Camel spider (Solifugae) use of prairie dog colonies

    Science.gov (United States)

    Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

  18. Brain systems underlying encounter expectancy bias in spider phobia.

    Science.gov (United States)

    Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

    2015-06-01

    Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

  19. Spider mite control and resistance management: does a genome help?

    NARCIS (Netherlands)

    Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

    2012-01-01

    The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

  20. Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

    Directory of Open Access Journals (Sweden)

    Sue Yeon Lee

    2018-03-01

    Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

  1. A qualitative investigation of the perceptions of female dog-bite victims and implications for the prevention of dog bites

    OpenAIRE

    Westgarth, Carri; Watkins, Francine

    2015-01-01

    Preventing dog bites is an increasingly important public health and political issue with implications for both human and animal health and welfare. Expert opinion is that most bites are preventable. Intervention materials have been designed to educate people on how to assess the body language of dogs, evaluate risk, and take appropriate action. The effectiveness of this approach is rarely evaluated and the incidence of dog bites is thought to be increasing. Is the traditional approach to dog ...

  2. SPIDER: CMB Polarimetry from the Edge of Space

    Energy Technology Data Exchange (ETDEWEB)

    Gualtieri, R.; et al.

    2017-11-28

    SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

  3. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren

    2011-01-01

    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

  4. Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh

    2015-12-01

    Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

  5. Genome-wide association study of insect bite hypersensitivity in two horse populations in the Netherlands

    NARCIS (Netherlands)

    Schurink, A.; Wolc, A.; Ducro, B.J.; Frankena, K.; Garrick, D.J.; Dekkers, J.C.M.; Arendonk, van J.A.M.

    2012-01-01

    Background: Insect bite hypersensitivity is a common allergic disease in horse populations worldwide. Insect bite hypersensitivity is affected by both environmental and genetic factors. However, little is known about genes contributing to the genetic variance associated with insect bite

  6. Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

    NARCIS (Netherlands)

    Huijdlng, J; de Jong, PJ; Huijding, J.

    This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

  7. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

    Science.gov (United States)

    LoBue, Vanessa

    2010-01-01

    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  8. [Case report: Snake bite - an odd case].

    Science.gov (United States)

    Evers, Bettina; Muth, Claus-Martin; Georgieff, Michael; Dinse-Lambracht, Alexander

    2015-10-01

    Emergency medical service is called by a 54-year-old man bitten by his rattlesnake. Upon initial survey we find the patient in a cardiopulmonary stable condition. He has bite marks and pain on his rapidly swelling middle finger of his right hand. Our initial treatment is immobilization of the patient. The snake raiser has already called the poison control center in Munich. By the help of this institution we bring him to a hospital having the right antivenom on hand. © Georg Thieme Verlag Stuttgart · New York.

  9. Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

    Science.gov (United States)

    Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

    2017-06-01

    This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

  10. Three-dimensional analyses of human bite-force magnitude and moment.

    Science.gov (United States)

    van Eijden, T M

    1991-01-01

    The effect of the three-dimensional orientation of occlusal force on maximal bite-force magnitude was examined in seven human subjects at three different unilateral anteroposterior bite positions (canine, second premolar and second molar). At each position, bite-force magnitude was registered in 17 precisely defined directions using a three-component force transducer and a feedback method. In addition, to assess the efficiency of transfer of muscle to bite force, for bites produced in the sagittal plane, moment-arm length was determined and the produced bite-force moment calculated. The results showed that the largest possible bite force was not always produced in a direction perpendicular to the occlusal plane. Generally, maximal bite force in medial and posterior directions was larger than that in, respectively, corresponding lateral and anterior directions. In each direction the produced force was larger at the posterior bite point than at the anterior bite point. The combined moment produced by the jaw muscles was largest for vertical bites, smallest for posteriorly directed bites and intermediate for anteriorly directed bites. In the case of vertically and anteriorly directed bites the produced moment did not vary significantly with the bite position. Hence, for these bite positions the jaw closing moment of the muscles must have kept constant. In the case of posteriorly directed bites the produced moment decreased when bite position changed from the anterior to the posterior side of the dentition. This indicated that jaw muscle activity had declined.

  11. Bullous reactions to bed bug bites reflect cutaneous vasculitis

    Science.gov (United States)

    This study evaluates bullous cutaneous reactions and sequential histopathology in an individual sensitized to bed bug bites in an effort to better understand the allergic response and histology associated with these bites. There was a progression of the inflammatory response across time ranging from...

  12. Retrospective study of dog bite cases reported to ECWA Veterinary ...

    African Journals Online (AJOL)

    A retrospective study of dog bite cases reported to ECWA Veterinary Clinic Bukuru was carried out in Plateau State, Nigeria to understand the pattern of occurrence in this region. A total of two hundred and forty seven (247) dog bite cases were reported between May, 2009 and June, 2010. The dogs profile showed that ...

  13. Dog bite as a public health concern in Addis Ababa

    African Journals Online (AJOL)

    Bernt Lindtjørn

    Dog bite as a public health concern in Addis Ababa. Fasil Mengistu1, Kedir Hussen1, Abraham Ali1, Goroma Getahun1, Dessalegn Sifer1. Abstract. Introduction: Animal bites and scratches represent the most important public health issue related to dogs and cats because of the risk of rabies transmission associated with ...

  14. Human Bites of the Face with Tissue Losses in Cosmopolitan ...

    African Journals Online (AJOL)

    Dr. Milaki Asuku

    A retrospective series of thirty-six cases of human bites to the face with tissue losses requiring reconstruction ..... bite wounds when compared to other forms of trauma in our regional ... References. 1. Liston PN, Tong DC, Firth NA, Kieser JA.

  15. Factors Associated with Rabies Awareness and Attitude to Dog Bite ...

    African Journals Online (AJOL)

    Preponderance of stray dogs at the study site necessitated assessment of awareness on rabies and associated factors, attitude to dog bite and knowledge on rabies among students and staff members in a University community. We reviewed hospital records for dog bite cases from 2005 to 2010 and administered structured ...

  16. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... correct dose. For bites that itch , apply an ice pack or an over-the-counter anti-itch cream, such as hydrocortisone. Another option is to take an over-the-counter oral antihistamine. To reduce swelling , apply an ice pack to the bite. If you experience any ...

  17. Individual piglets' contribution to the development of tail biting

    NARCIS (Netherlands)

    Zonderland, J.J.; Kemp, B.; Bracke, M.B.M.; Hartog, den L.A.; Spoolder, H.A.M.

    2011-01-01

    Conflicting hypotheses exist about the contribution of individual pigs to the development of a tail-biting outbreak, but there is limited quantitative information to support or dismiss them. This study aims to quantify the development of tail-biting behaviour at pen and individual piglet level,

  18. Ward Round - Crocodile bites in Malawi: microbiology and surgical ...

    African Journals Online (AJOL)

    We present a case series of 5 patients admitted over 5 months to Queen Elizabeth Central Hospital who had sustained injuries from a crocodile bite. Three patients required amputation of a limb. The severe soft tissue injury associated with a crocodile bite and the unusual normal oral flora of the crocodile create challenges ...

  19. Management of common animal bites in the emergency centre

    African Journals Online (AJOL)

    Professor Engelbrecht's current fields of interest are bites, stings and poisonous plants. Correspondence to: ... Cross War Memorial Children's Hospital in. Cape Town ... infections. Wound infection with Pasteurella multocida usually occurs early (within 12 ..... Dog bite prevention: an assessment of child knowledge. J Pediatr ...

  20. Are bruxism and the bite causally related?

    Science.gov (United States)

    Lobbezoo, F; Ahlberg, J; Manfredini, D; Winocur, E

    2012-07-01

    In the dental profession, the belief that bruxism and dental (mal-)occlusion ('the bite') are causally related is widespread. The aim of this review was to critically assess the available literature on this topic. A PubMed search of the English-language literature, using the query 'Bruxism [Majr] AND (Dental Occlusion [Majr] OR Malocclusion [Majr])', yielded 93 articles, of which 46 papers were finally included in the present review*. Part of the included publications dealt with the possible associations between bruxism and aspects of occlusion, from which it was concluded that neither for occlusal interferences nor for factors related to the anatomy of the oro-facial skeleton, there is any evidence available that they are involved in the aetiology of bruxism. Instead, there is a growing awareness of other factors (viz. psychosocial and behavioural ones) being important in the aetiology of bruxism. Another part of the included papers assessed the possible mediating role of occlusion between bruxism and its purported consequences (e.g. tooth wear, loss of periodontal tissues, and temporomandibular pain and dysfunction). Even though most dentists agree that bruxism may have several adverse effects on the masticatory system, for none of these purported adverse effects, evidence for a mediating role of occlusion and articulation has been found to date. Hence, based on this review, it should be concluded that to date, there is no evidence whatsoever for a causal relationship between bruxism and the bite. © 2012 Blackwell Publishing Ltd.

  1. The Transmission Line for the SPIDER experiment

    International Nuclear Information System (INIS)

    Boldrin, Marco; De Lorenzi, Antonio; Recchia, Mauro; Toigo, Vanni; Bonicelli, Tullio; Simon, Muriel

    2011-01-01

    The 100 keV Ion Source Test facility - Source for the Production of Ions of Deuterium Extracted from RF plasma (SPIDER) - is aimed to test the full scale prototype of the Ion Source for the ITER 1 MeV Neutral Beam Injector (NBI). The SPIDER facility requires the construction of a High Voltage Deck (HVD) and of a High Voltage Transmission Line (TL) respectively to host the Ion Source Power Supplies system polarized at 100 kV and to carry the power and signal conductors to the beam accelerator. In already existing NBI systems with beam energy above 100 keV, the TL is realized with the SF 6 Gas Insulated Line technology. In the SPIDER TL case, the presence of a large inner conductor (half meter diameter), would make the pressurized TL a complex and costly component; therefore a free air insulated solution has been proposed. The paper focuses on the design of this TL, which has to host inside the complex high potential (100 kV) inner electrode a number of power and measuring conductors and has to minimize the Electro Magnetic Interferences (EMI) produced by the frequent grids breakdowns. Finite Element (FE) analyses have been performed to verify the configuration from the electrostatic point of view, to evaluate EMI screening effectiveness and to assess the impact of the relatively high thermal dissipation of power conductors located inside the high potential electrode. Moreover, an experimental test campaign has been carried out on a TL mockup to validate the TL electrostatic configuration under DC voltage. Finally, the paper reports on the status of procurement activities for the Transmission Line.

  2. Bite force and occlusal stress production in hominin evolution.

    Science.gov (United States)

    Eng, Carolyn M; Lieberman, Daniel E; Zink, Katherine D; Peters, Michael A

    2013-08-01

    Maximum bite force affects craniofacial morphology and an organism's ability to break down foods with different material properties. Humans are generally believed to produce low bite forces and spend less time chewing compared with other apes because advances in mechanical and thermal food processing techniques alter food material properties in such a way as to reduce overall masticatory effort. However, when hominins began regularly consuming mechanically processed or cooked diets is not known. Here, we apply a model for estimating maximum bite forces and stresses at the second molar in modern human, nonhuman primate, and hominin skulls that incorporates skeletal data along with species-specific estimates of jaw muscle architecture. The model, which reliably estimates bite forces, shows a significant relationship between second molar bite force and second molar area across species but does not confirm our hypothesis of isometry. Specimens in the genus Homo fall below the regression line describing the relationship between bite force and molar area for nonhuman anthropoids and australopiths. These results suggest that Homo species generate maximum bite forces below those predicted based on scaling among australopiths and nonhuman primates. Because this decline occurred before evidence for cooking, we hypothesize that selection for lower bite force production was likely made possible by an increased reliance on nonthermal food processing. However, given substantial variability among in vivo bite force magnitudes measured in humans, environmental effects, especially variations in food mechanical properties, may also be a factor. The results also suggest that australopiths had ape-like bite force capabilities. Copyright © 2013 Wiley Periodicals, Inc.

  3. Assassin bug uses aggressive mimicry to lure spider prey.

    Science.gov (United States)

    Wignall, Anne E; Taylor, Phillip W

    2011-05-07

    Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

  4. Cuticular antifungals in spiders: density- and condition dependence.

    Directory of Open Access Journals (Sweden)

    Daniel González-Tokman

    Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  5. Silk elasticity as a potential constraint on spider body size.

    Science.gov (United States)

    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

    2010-10-07

    Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

  6. Cuticular antifungals in spiders: density- and condition dependence.

    Science.gov (United States)

    González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

    2014-01-01

    Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  7. Structure-function-property-design interplay in biopolymers: spider silk.

    Science.gov (United States)

    Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

    2014-04-01

    Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  8. Inhibition of the spider heartbeat by gravity and vibration

    Science.gov (United States)

    Finck, A.

    1984-01-01

    The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

  9. Spider silk reinforced by graphene or carbon nanotubes

    Science.gov (United States)

    Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

    2017-09-01

    Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

  10. Colonization of subterranean habitats by spiders in Central Europe

    Directory of Open Access Journals (Sweden)

    Vlastimil Růžička

    2013-05-01

    Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

  11. Management of vascular trauma from dog bites.

    Science.gov (United States)

    Akingba, A George; Robinson, Eric A; Jester, Andrea L; Rapp, Brian M; Tsai, Anthony; Motaganahalli, Raghu L; Dalsing, Michael C; Murphy, Michael P

    2013-11-01

    Vascular trauma from large-dog bites present with a combination of crush and lacerating injuries to the vessel, as well as significant adjacent soft tissue injury and a high potential for wound complications. This retrospective case series evaluates our 15 years of experience in managing this uncommonly seen injury into suggested treatment recommendations. From our database, 371 adult patients presented with dog bites between July 1997 and June 2012. Twenty (5.4%) of those patients had vascular injuries requiring surgical intervention. Patient demographics, anatomic location of injury, clinical presentation, imaging modality, method of repair, and complication rates were reviewed to assess efficacy in preserving limb function. Pediatric patients were managed at the regional children's hospital and, therefore, not included in this study. Among the 20 surgically treated vascular injuries, there were 13 arterial-only injuries, two venous-only injuries, and five combination arterial and venous injuries. Seventeen patients (85%) had upper extremity injuries; three patients had lower extremity injuries (15%). The axillobrachial artery was the most commonly injured single vessel (n = 9/20; 45%), followed by the radial artery (n = 4/20; 20%). Surgical repair of vascular injuries consisted of resection and primary anastomosis (four), interposition bypass of artery with autogenous vein (13), and ligation (two), with (one) being a combination of bypass and ligation. All patients had debridement of devitalized tissue combined with pulse lavage irrigation and perioperative antibiotics. Associated injuries requiring repair included muscle and skin (n = 10/20; 50%), bone (n = 1/20; 5%), nerve (n = 1/20; 5%), and combinations of the three (n = 5/20; 25%). Postoperative antibiotic therapy was administered for 14.7 ± 8.2 days in all 20 patients. Four patients (20%) developed postoperative wound infections, although this did not compromise their vascular repair. Of the patients

  12. Free amino acids in spider hemolymph.

    Science.gov (United States)

    Tillinghast, Edward K; Townley, Mark A

    2008-11-01

    We examined the free amino acid composition of hemolymph from representatives of five spider families with an interest in knowing if the amino acid profile in the hemolymph of orb-web-building spiders reflects the high demands for small organic compounds in the sticky droplets of their webs. In nearly all analyses, on both orb and non-orb builders, glutamine was the most abundant free amino acid. Glycine, taurine, proline, histidine, and alanine also tended to be well-represented in orb and non-orb builders. While indications of taxon-specific differences in amino acid composition were observed, it was not apparent that two presumptive precursors (glutamine, taurine) of orb web sticky droplet compounds were uniquely enriched in araneids (orb builders). However, total amino acid concentrations were invariably highest in the araneids and especially so in overwintering juveniles, even as several of the essential amino acids declined during this winter diapause. Comparing the data from this study with those from earlier studies revealed a number of discrepancies. The possible origins of these differences are discussed.

  13. Intracellular recording from a spider vibration receptor.

    Science.gov (United States)

    Gingl, Ewald; Burger, Anna-M; Barth, Friedrich G

    2006-05-01

    The present study introduces a new preparation of a spider vibration receptor that allows intracellular recording of responses to natural mechanical or electrical stimulation of the associated mechanoreceptor cells. The spider vibration receptor is a lyriform slit sense organ made up of 21 cuticular slits located on the distal end of the metatarsus of each walking leg. The organ is stimulated when the tarsus receives substrate vibrations, which it transmits to the organ's cuticular structures, reducing the displacement to about one tenth due to geometrical reasons. Current clamp recording was used to record action potentials generated by electrical or mechanical stimuli. Square pulse stimulation identified two groups of sensory cells, the first being single-spike cells which generated only one or two action potentials and the second being multi-spike cells which produced bursts of action potentials. When the more natural mechanical sinusoidal stimulation was applied, differences in adaptation rate between the two cell types remained. In agreement with prior extracellular recordings, both cell types showed a decrease in the threshold tarsus deflection with increasing stimulus frequency. Off-responses to mechanical stimuli have also been seen in the metatarsal organ for the first time.

  14. Spectral sensitivity of a colour changing spider.

    Science.gov (United States)

    Defrize, Jérémy; Lazzari, Claudio R; Warrant, Eric J; Casas, Jérôme

    2011-04-01

    Vision plays a paramount role in some spider families such as the Salticidae, Lycosidae and Thomisidae, as it is involved in prey hunting, orientation or choice of substrate. In the thomisid Misumena vatia, for which the substrate colour affects the body colour, vision seems to mediate morphological colour changes. However, nothing is known about which component of visual signals from the substrate might be perceived, nor whether M. vatia possesses the physiological basis for colour vision. The aim of this study is thus to investigate the vision of this spider species by measuring the spectral sensitivities of the different pairs of eyes using electrophysiological methods. Extra- and intracellular electrophysiological recordings combined with selective adaptation revealed the presence of two classes of photoreceptor cells, one sensitive in the UV region of the spectrum (around 340 nm) and one sensitive in the green (around 520 nm) regions in the four pairs of eyes. We conclude that M. vatia possesses the physiological potential to perceive both chromatic and achromatic components of the environment. Copyright © 2011 Elsevier Ltd. All rights reserved.

  15. Treatment of hyperdivergent growth pattern and anterior open bite with posterior metallic bite planes.

    Science.gov (United States)

    Ciavarella, Domenico; Lo Russo, Lucio; Nichelini, Jeffrey; Mastrovincenzo, Mario; Barbato, Ersilia; Laurenziello, Michele; Montaruli, Graziano; Lo Muzio, Lorenzo

    2017-12-01

    In the present paper, the authors analyze the effect of the "Swallowing Occlusal Contact Intercept Appliance" (SOCIA) in treatment of children with hyperdivergent Class II malocclusion. This functional appliance has no intra-oral anchorage, but induces a continuous periodontal, muscular, and articular stimulation. Twenty-six patients with hyperdivergent growth and class II malocclusion were selected and treated with SOCIA appliance. Cephalometric analysis was performed before treatment (T1) and immediately after the treatment (T2). After 24 months treatment authors observed a modification of maxillary growth with a reduction of the divergence with an increase of the posterior facial height, a modification of condylar inclination and forward position of the a hyoid. No modifications was observed about the ANB angle. After treatment the open bite was resolved with a reduction of the inclination of the upper incisors. SOCIA is a reliable functional appliance in growing age patients with a hyperdivergent pattern growth, anterior open bite and class II molar malocclusion.

  16. Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

    Science.gov (United States)

    Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

    2014-11-01

    Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

  17. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

    Science.gov (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

    2014-08-04

    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Animal Bites in Borujerd: An Overview of Animal Bites in Iran

    Directory of Open Access Journals (Sweden)

    Sabouri Ghannad

    2014-04-01

    Full Text Available Background Rabies has been reported as the most important endemic zoonotic disease in Iran and still remains as a major public health problem. Objectives The main objective of the current research was to study the epidemiology of animal bites in Borujerd County in Iran and to compare its prevalence to other parts of Iran from April 2006 to September 2011. Patients and Methods The data were recorded in questionnaires and analyzed by SPSS version 16. Chi-square test was performed to evaluate the relationship among variables and P value was set as 0.05. Results Dog bites were the most common (69.8%, followed by cat (17.2%, fox and wolf (1.4%, sheep and cow (2.8%, monkey and donkey (5%, mouse and squirrel (2.2% and other animals (1.6%. Leg was the most common bite site forming 46.6% of cases, followed by hands (41.8%, buttocks (4.6%, head (4% and body (2.9%. Most of the subjects belonged to the age group < 10 (175.2 per 100000 populations. The injury location was associated significantly with sex and the residential status. Conclusions This study strongly highlights a high priority goal for health authorities to develop educational programs, recommended for the general population to inform them about the benefits of continuing the medication. Vaccination of domestic dogs and also eradication of stray ones, in addition to educational programs should be prioritized by health authorities.

  19. Biting rates and developmental substrates for biting midges (Diptera: Ceratopogonidae) in Iquitos, Peru.

    Science.gov (United States)

    Mercer, David R; Spinelli, Gustavo R; Watts, Douglas M; Tesh, Robert B

    2003-11-01

    Biting midges (Diptera: Ceratopogonidae) were collected at 16 periurban and rural sites around Iquitos, Peru, between 17 October 1996 and 26 May 1997. Culicoides paraensis (Goeldi), the principal vector of Oropouche virus, was the most commonly collected species (9,086 flies) with Culicoides insinuatus Wirth & Blanton second (7,229 flies). Although both species were collected at all sampling sites (linear (distance surveyed approximately 25 km), C. paraensis dominated at northern collection sites (> 90%), whereas C. insinuatus prevailed at southern collection sites (> 60%). C. paraensis were collected from human sentinels at a constant rate throughout daylight hours, at similar rates during wet and dry months, and regardless of rainfall. Larval developmental substrates for C. paraensis included decaying platano (Musa x paradisiaca L. [Musaceae]) stems, stumps, flowers, fruits, and debris beneath platano trees as well as from soil beneath a fruiting mamay (Syzygium malaccense Merr. & Perry [Myrtaceae] ) tree and organic-rich mud along a lake shoreline. C. insinuatus adults likewise emerged from decaying platano and organic-rich mud along a lake shoreline, but also from debris accumulated in the axils of aguaje (Mauritia flexuosa L. [Palmae]) fronds and decaying citrus fruit. Despite high numbers of biting adults near putative substrates, adults of neither species emerged from other decomposing plant material, soil, phytotelmata, or artificial containers. Because both species of biting midges emerged in high numbers from all parts of platano (ubiquitous in Iquitos), it will be challenging to control them through sanitation.

  20. Human behavior preceding dog bites to the face.

    Science.gov (United States)

    Rezac, P; Rezac, K; Slama, P

    2015-12-01

    Facial injuries caused by dog bites pose a serious problem. The aims of this study were to determine human behavior immediately preceding a dog bite to the face and to assess the effects of victim age and gender and dog sex and size on the location of the bite to the face and the need for medical treatment. Complete data on 132 incidents of bites to the face were analysed. A human bending over a dog, putting the face close to the dog's face, and gazing between victim and dog closely preceded a dog bite to the face in 76%, 19% and 5% of cases, respectively. More than half of the bites were directed towards the central area of the victim's face (nose, lips). More than two thirds of the victims were children, none of the victims was an adult dog owner and only adult dogs bit the face. Victim's age and gender and dog's sex and size did not affect the location of the bite on the face. People who were bitten by large dogs sought medical treatment more often than people who were bitten by small dogs (P face close to the dog's face and gazing between human and dog should be avoided, and children should be carefully and constantly supervised when in the presence of dogs. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Texas coral snake (Micrurus tener) bites.

    Science.gov (United States)

    Morgan, David L; Borys, Douglas J; Stanford, Rhandi; Kjar, Dean; Tobleman, William

    2007-02-01

    The clinical features of bites from Texas coral snakes (Micrurus tener) have not been well studied. Our goal was to review the largest number of victims of Texas coral snakebites to determine their characteristics, effects, treatment, and outcome. Retrospective case series of Micrurus tener exposures reported to the Texas Poison Center Network from 2000 to 2004. Eighty-two patients were included in the analysis. Most (57.3%) were 18 to 49-year-old men. Almost 90% had local swelling, pain, erythema, or paresthesias. Only 7.3% had systemic effects, and none of these were severe. Over half received coral snake antivenin, and 15.9% were given opioids for pain. No patient died and no patient required mechanical ventilation due to hypoventilation from the snakebite. There were more local findings and less severe systemic effects than previously reported. Antivenin is not needed for most of these patients, and opioids may be administered safely.

  2. Afibrinogenemia following snake bite (Crotalus durissus terrificus

    Directory of Open Access Journals (Sweden)

    C. F. S. Amaral

    1988-08-01

    Full Text Available This paper reports two cases of afibrinogenemia with normal platelet count following Crotalus durissus terrificus, snake bite Both patients presented high output acute renal failure and case two also had increased blood levels of CPK and LDH compatible with the diagnosis of rhabdomyolysis. Case one was given an unknown amount of antivenom and was treated with epsilonaminocaproic acid and a fresh whole blood transfusion and showed recovery of the coagulation disturbance 40 hours following these measures. Case two was given an adequate amount of crotalide antivenom and the coagulation tests performed 12 hours later showed a normal partial thromboplastin time and fibrinogen 86 mg/100ml. Case one presented no haemorrhagic disturbances. Case two presented persistent bleeding following venopuncture and after removal of impetigo crust in the legs. Acute renal failure was treated conservatively and both patients were discharged from the hospital with recovery of the renal function.

  3. Primary lymph node responses to mosquito bites.

    Science.gov (United States)

    Mellink, J J; Vos, B J

    1977-03-29

    Post-auricular lymph node responses and changes in fresh weight of thymus and spleen of hamsters and mice at 4 and 8 days after primary exposure of both ears to 20 bites by the mosquito Aedes aegypti were studied quantitatively. In both hosts lymph node changes characteristic of the development of cell-mediated immune responses and those which are believed to lead to antibody production occurred, with the emphasis on the latter phenomena. No reactions of thymus and spleen were observed. The responses recorded are considered to be immunologically specific. In hamsters, but not in mice, the responses related to humoral sensitization coincided in time to a large extent with those of the cell-mediated immune processes. The stronger humoral responses in mice were probably in the first place the result of the relatively higher dosages applied.

  4. A qualitative investigation of the perceptions of female dog-bite victims and implications for the prevention of dog bites.

    Science.gov (United States)

    Westgarth, Carri; Watkins, Francine

    2015-01-01

    Preventing dog bites is an increasingly important public health and political issue with implications for both human and animal health and welfare. Expert opinion is that most bites are preventable. Intervention materials have been designed to educate people on how to assess the body language of dogs, evaluate risk, and take appropriate action. The effectiveness of this approach is rarely evaluated and the incidence of dog bites is thought to be increasing. Is the traditional approach to dog bite prevention working as well as it should? In this novel, small scale qualitative study, the perceptions of victims regarding their dog bite experience were explored in-depth. The study recruited 8 female participants who had been bitten by a dog in the past 5 years. In-depth, one-to-one interviews were conducted, transcribed, and analyzed using thematic analysis. The findings indicate that dog bites may not be as easily preventable as previously presumed, and that education about dog body language may not prevent some types of dog bites. The reasons participants were bitten were multifaceted and complex. In some cases, there was no interaction with the dog before the bite so there was no opportunity to assess the situation and modify behavior around the dog accordingly. Identifying who was to blame, and had responsibility for preventing the bite, was straightforward for the participants in hindsight. Those bitten blamed themselves and/or the dog owner, but not the dog. Most participants already felt they had a theoretical knowledge that would allow them to recognize dog aggression before the dog bite, yet participants, especially those who worked regularly with dogs, routinely believed, "it would not happen to me." We also identified an attitude that bites were "just one of those things," which could also be a barrier prevention initiatives. Rather than being special to the human-canine relationship, the attitudes discovered mirror those found in other areas of injury

  5. An Analytical Study of Mammalian Bite Wounds Requiring Inpatient Management

    Directory of Open Access Journals (Sweden)

    Young-Geun Lee

    2013-11-01

    Full Text Available BackgroundMammalian bite injuries create a public health problem because of their frequency, potential severity, and increasing number. Some researchers have performed fragmentary analyses of bite wounds caused by certain mammalian species. However, little practical information is available concerning serious mammalian bite wounds that require hospitalization and intensive wound management. Therefore, the purpose of this study was to perform a general review of serious mammalian bite wounds.MethodsWe performed a retrospective review of the medical charts of 68 patients who were referred to our plastic surgery department for the treatment of bite wounds between January 2003 and October 2012. The cases were analyzed according to the species, patient demographics, environmental factors, injury characteristics, and clinical course.ResultsAmong the 68 cases of mammalian bite injury, 58 (85% were caused by dogs, 8 by humans, and 2 by cats. Most of those bitten by a human and both of those bitten by cats were male. Only one-third of all the patients were children or adolescents. The most frequent site of injury was the face, with 40 cases, followed by the hand, with 16 cases. Of the 68 patients, 7 were treated with secondary intention healing. Sixty-one patients underwent delayed procedures, including delayed direct closure, skin graft, composite graft, and local flap.ConclusionsBased on overall findings from our review of the 68 cases of mammalian bites, we suggest practical guidelines for the management of mammalian bite injuries, which could be useful in the treatment of serious mammalian bite wounds.

  6. Estimation of Dog-Bite Risk and Related Morbidity Among Personnel Working With Military Dogs.

    Science.gov (United States)

    Schermann, H; Eiges, N; Sabag, A; Kazum, E; Albagli, A; Salai, M; Shlaifer, A

    Soldiers serving in the Israel Defense Force Military Working Dogs (MWD) Unit spend many hours taming dogs' special skills, taking them on combat missions, and performing various dogkeeping activities. During this intensive work with the aggressive military dogs, bites are common, and some of them result in permanent disability. However, this phenomenon has not been quantified or reported as an occupational hazard. This was a retrospective cohort study based on self-administered questionnaires. Information was collected about soldiers' baseline demographics, duration of the experience of working with dogs, total number of bites they had, circumstances of bite events, and complications and medical treatment of each bite. Bite risk was quantified by incidence, mean time to first bite, and a Cox proportional hazards model. Rates of complications and the medical burden of bites were compared between combat soldiers and noncombat dogkeepers. Bite locations were presented graphically. Seventy-eight soldiers participated and reported on 139 bites. Mean time of working with dogs was 16 months (standard deviation, ±9.4 months). Overall bite incidence was 11 bites per 100 person-months; the mean time to first bite event was 6.3 months. The Cox proportional hazards model showed that none of baseline characteristics significantly increased bite hazard. About 90% of bites occurred during routine activities, and 3.3% occurred on combat missions. Only in 9% of bite events did soldiers observed the safety precautions code. Bite complications included fractures, need for intravenous antibiotic treatment and surgical repair, prominent scarring, diminished sensation, and stiffness of proximal joints. Bite complications were similar between combat soldiers and dogkeepers. Most bites (57%) were located on hands and arms. MWD bites are an occupational hazard resulting in significant medical burden. Hands and arms were most common bite locations. Observance of safety precautions may be

  7. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

    2008-01-01

    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

  8. 46 SPIDER WEBS AS INDICATORS OF COBALT AND LEAD ...

    African Journals Online (AJOL)

    Spider webs were collected from the indoor and outdoor of 120 sampling sites of 10 zones of Kano ... diet, cobalt containing ceramic is administered into ... significant human and environmental health risk. ..... Evaluation of Health Workers.

  9. Genetic diversity analysis of various red spider mite- resistant ...

    African Journals Online (AJOL)

    User

    2011-05-02

    May 2, 2011 ... 3Key Laboratory of Plant Breeding and Genetics, Sichuan Agricultural University, Ya'an, 625014, P. R. ... Random amplified polymorphic DNA (RAPD) is a DNA ..... spider mite-resistant, bumper, high-quality and disease-.

  10. Optical surface profiling of orb-web spider capture silks

    Energy Technology Data Exchange (ETDEWEB)

    Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

    2010-09-15

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  11. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

  12. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    NARCIS (Netherlands)

    Yang, Liang; Hedhammar, My; Blom, Tobias; Leifer, Klaus; Johansson, Jan; Habibovic, Pamela; van Blitterswijk, Clemens

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently,

  13. Peculiar torsion dynamical response of spider dragline silk

    Science.gov (United States)

    Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

    2017-07-01

    The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

  14. Optical surface profiling of orb-web spider capture silks

    International Nuclear Information System (INIS)

    Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

    2010-01-01

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  15. SPIDER: Probing the dawn of time from above the clouds

    Science.gov (United States)

    Moncelsi, Lorenzo; Spider Collaboration

    2017-11-01

    SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

  16. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

    Science.gov (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

    2012-03-01

    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

  17. Thin Film Assembly of Spider Silk-like Block Copolymers

    Science.gov (United States)

    2011-01-01

    Shipley, N. H.; Lewis, R. V. Int. J. Biol.Macromol. 1999, 24, 271. (c) Thiel, B. L.; Guess, K. B.; Viney, C. Biopolymers 1997, 41, 703. (13) Silk ...Film Assembly of Spider Silk -like Block Copolymers Sreevidhya T. Krishnaji,†,‡ Wenwen Huang,§ Olena Rabotyagova,†,‡ Eugenia Kharlampieva, ) Ikjun Choi...Received November 26, 2010 We report the self-assembly of monolayers of spider silk -like block copolymers. Langmuir isotherms were obtained for a series of

  18. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  19. Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

    Science.gov (United States)

    Shao, Lili; Li, Shuqiang

    2018-05-24

    The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

  20. Impact of prescribed burning on a heathland inhabiting spider community

    Directory of Open Access Journals (Sweden)

    Krause, Rolf Harald

    2016-04-01

    Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

  1. Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

    Science.gov (United States)

    Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

    2014-01-01

    Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

  2. Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

    Science.gov (United States)

    Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

    2009-03-04

    The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

  3. Atomistic model of the spider silk nanostructure

    Science.gov (United States)

    Keten, Sinan; Buehler, Markus J.

    2010-04-01

    Spider silk is an ultrastrong and extensible self-assembling biopolymer that outperforms the mechanical characteristics of many synthetic materials including steel. Here we report atomic-level structures that represent aggregates of MaSp1 proteins from the N. Clavipes silk sequence based on a bottom-up computational approach using replica exchange molecular dynamics. We discover that poly-alanine regions predominantly form distinct and orderly beta-sheet crystal domains while disorderly structures are formed by poly-glycine repeats, resembling 31-helices. These could be the molecular source of the large semicrystalline fraction observed in silks, and also form the basis of the so-called "prestretched" molecular configuration. Our structures are validated against experimental data based on dihedral angle pair calculations presented in Ramachandran plots, alpha-carbon atomic distances, as well as secondary structure content.

  4. Insect Repellents: Protect Your Child from Insect Bites

    Science.gov (United States)

    ... Español Text Size Email Print Share Choosing an Insect Repellent for Your Child Page Content Mosquitoes, biting ... sunscreen needs to be reapplied often. Reactions to Insect Repellents If you suspect that your child is ...

  5. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... hair, and nail care Skin care Hair care / hair loss Injured skin Nail care Anti-aging skin care ... hair, and nail care Skin care Hair care / hair loss Injured skin Blisters Bug bites and stings How ...

  6. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Part 1: Structure Part 2: Origin Part 3: Function Textbook Study notes Image library 3-D animated ... nail care Injured skin Bug bites and stings "); (function () { var a = "", b = [ "adid=aad-aad-1", "site= ...

  7. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Excellence in Dermatopathology™ Excellence in Pediatric Dermatology™ Donate Search Menu Donate Member resources and programs Member benefits ... to bites and stings FIND A DERMATOLOGIST Advanced Search "); (function () { var a = "", b = [ "adid=aad-aad-6", " ...

  8. Venomous Snake Bite Injuries at Kitui District Hospital

    African Journals Online (AJOL)

    were school going children who lived in houses mostly made of .... Children and students accounted for 60% of all victims. Farmers 40%. ... family member. Table 1. .... due to its dry and hot climate. .... snake bite and treatment-seeking behavior.

  9. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Choosing Wisely Education Online Learning Center MOC Recognized Credit Basic Derm Curriculum Teaching and learning guides Suggested ... it’s important to take steps to reduce your risk. To help prevent bug bites, dermatologists recommend the ...

  10. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... your head About nails: More important than you think Questions lots of kids ask about their skin, ... bites are harmless, some can spread dangerous diseases like Zika virus, dengue, Lyme disease, and malaria. Particularly ...

  11. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... aging skin care Kids’ zone About skin: Your body's largest organ About hair: Not just on your ... bug bite, such as a rash, fever, or body aches, see your doctor or a board-certified ...

  12. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... to remove a tick How to treat a bee sting When to see a dermatologist Burns Frostbite ... following tips: For painful bites , such as a bee sting, take an over-the-counter painkiller, such ...

  13. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... and treatments Acne and rosacea Bumps and growths Color problems Contagious skin diseases Cosmetic treatments Dry / sweaty ... prevent bug bites, dermatologists recommend the following tips: Use insect repellent. To protect against mosquitoes, ticks and ...

  14. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... and Lectureship Clarence S. Livingood Award and Lectureship Marion B. Sulzberger Award and Lectureship Master Dermatologist Award Members ... skin Bug bites and stings "); (function () { var a = "", b = [ "adid=aad-aad-1", "site=ehs.con.aad. ...

  15. Rat-bite fever presenting with rash and septic arthritis.

    Science.gov (United States)

    Kanechorn Na Ayuthaya, Rajyani; Niumpradit, Nucha

    2005-11-01

    Rat-bite fever is an uncommon disease known for its endemicity to occur worldwide. Although most patients tend to develop mild symptoms with improvement from conventional antibiotics, it can progress with severe complications with a mortality rate as high as 13% without proper treatment. The authors report a complicated case of rat bite-fever involving a 61-year old woman who presented with fever petechial rash, and septic arthritis following a rat bite. Initially, multiple antibiotics were administered but were not effective. As a consequence, invasive procedures such as arthrotomy and joint debridement were done and prolonged antibiotic was administered until clinical resolution. Since many cases do not have a history of rat bite and may present with fever, rashes, and arthritis it is essential to distinguish it from other diseases. Here, the authors will provide details on the etiology, clinical manifestations, diagnosis, and management to aid prompt detection and treatment of the disease.

  16. etiology and pathogenesis of anterior open bite: a review

    African Journals Online (AJOL)

    2010-11-11

    Nov 11, 2010 ... bite is essential in the diagnosis, prevention and management of this malocclusion. ... Dental malocclusion may be congenital or develop as the child grows. .... uncommon in maxillofacial patients who present with. Le forte 1 ...

  17. The phylogeny of fossil whip spiders.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A

    2017-04-21

    Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

  18. Deep bite malocclusion: exploration of the skeletal and dental factors

    International Nuclear Information System (INIS)

    Bhateja, N.K.; Fida, M.; Shaikh, A.

    2016-01-01

    Correction of deep bite is crucial for maintenance of dental hard and soft tissue structures and for prevention of temporomandibular joint disorders. Exploration of underlying skeletal and dental factors is essential for efficient and individualized treatment planning. To date etiological factors of dental and skeletal deep bite have not been explored in Pakistani orthodontic patients. The objectives of this study were to explore frequencies of dental and skeletal etiological factors in deep bite patients and to determine correlations amongst dental and skeletal etiological factors of deep bite. Methods: The study included a total of 113 subjects (males=35; females=78) with no craniofacial syndromes or prior orthodontic treatment. Pre-treatment orthodontic records were used to evaluate various dental and skeletal parameters. Descriptive statistics of each parameter were calculated. The various study parameters were correlated using Pearson's Correlation. Results: Deep curve of Spee was most frequently seen factor of dental deep bite (72.6%), followed by increased coronal length of upper incisors (28.3%), retroclined upper incisors (17.7%), retroclined lower incisors (8%) and increased coronal length of lower incisors (5.3%). Decreased gonial angle was most commonly found factor of skeletal deep bite (43.4%), followed by decreased mandibular plane angle (27.4%) and maxillary plane's clockwise rotation (26.5%). Frankfort mandibular plane angle and gonial angle showed a strong positive correlation (r=0.66, p=0.000). Conclusions: Reduced gonial angle is most frequently seen skeletal factor, signifying the importance of angulation and growth of ramus in development of deep bite. Deep curve of Spee is most frequently seen dental etiological component in deep bite subjects, hence signifying the importance of intruding the lower anterior teeth. (author)

  19. Habitual biting of oral mucosa: A conservative treatment approach

    Directory of Open Access Journals (Sweden)

    Sarabjot Kaur Bhatia

    2013-01-01

    Full Text Available Chronic biting of oral mucosa is an innocuous self inflicted injury, commonly seen in children suffering from developmental and psychological problems and has rarely been reported in normal unaffected individuals. The management strategies vary from counseling, prescription of sedatives to different prosthetic shields. The paper highlights the efficacy of a simple approach using soft mouth guard in the management of self inflicted lesions due to habitual biting of oral mucosa in two normal healthy children.

  20. The management of animal bites in the United kingdom.

    Science.gov (United States)

    Evgeniou, E; Markeson, D; Iyer, S; Armstrong, A

    2013-01-01

    Animal bites represent a significant global health issue. The evidence in the literature regarding their management in many areas is conflicting and unclear. This project attempts to identify current evidence in the literature on the management of animal bites and assess if current practice in the United Kingdom is evidence based. A literature review on the management of animal bites was performed, and a national UK survey was contacted using a questionnaire based on the available evidence in the literature. The results from this survey show that 98% of plastic surgery units routinely use prophylactic antibiotics in all animal bite wounds; 58% close low-risk injuries primarily after initial washout, and there are conflicting opinions regarding the management of associated fractures and soft tissue injuries. The available data in the literature suggest that appropriate wound management is the most important factor for prevention of infection in animal bites. Antibiotic prophylaxis should only be given in high-risk wounds and primary closure should be performed in low-risk wounds. The management protocols of many plastic surgery units often diverge from the available evidence within the literature. On the basis of a thorough literature review, a guideline for the management of animal bites is presented. Future studies should investigate the management of associated fractures and soft tissue injuries.

  1. The impact of snake bite on household economy in Bangladesh.

    Science.gov (United States)

    Hasan, S M K; Basher, A; Molla, A A; Sultana, N K; Faiz, M A

    2012-01-01

    The present study aims to assess the different types of costs for treatment of snake bite patients, to quantify household economic impact and to understand the coping mechanisms required to cover the costs for snake bite patients in Bangladesh. The patients admitted to four tertiary level hospitals in Bangladesh were interviewed using structured questionnaires including health-care-related expenditures and the way in which the expenditures were covered. Of the snakes which bit the patients, 54.2% were non-venomous, 45.8% were venomous and 42.2% of the patients were given polyvalent antivenom. The total expenditure related to snake bite varies from US$4 (US$1 = Taka 72) to US$2294 with a mean of US$124 and the mean income loss was US$93. Expenditure for venomous snake bite was US$231, which is about seven times higher than non-venomous snake bite (US$34). The treatment imposes a major economic burden on affected families, especially in venomous snake bite cases.

  2. Sensitivity to bites by the bedbug, Cimex lectularius.

    Science.gov (United States)

    Reinhardt, K; Kempke, D; Naylor, R A; Siva-Jothy, M T

    2009-06-01

    Bedbugs are a public health problem and can cause significant economic losses, but little is known about the effects of bites on humans. We reviewed case reports and published papers on bedbug bites to assess the empirical basis of the commonly cited figure that only approximately 80% of the population are sensitive to bedbug bites. We found the sensitivity estimate to be based on only one study carried out 80 years ago. However, this study did not account for the now well-established fact that only repeated exposure to external allergens leads to skin reactions. In our sample, 18 of 19 persons showed a skin reaction after bedbug exposure, but in most cases only after repeated controlled exposure. With repeated exposure, the latency between bite and skin reactions decreased from approximately 10 days to a few seconds. Our results are relevant for the hospitality industry, where apparently increasing infestation rates are likely to lead to an increase in the number of tourists and hotel employees exposed to bedbugs. Medical and public health professionals may expect to see an increase in the prevalence of people with bedbug bite sensitivity. The significance of the delayed reaction time of skin to bites may also have implications in litigation cases where people seek compensation.

  3. Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

    Science.gov (United States)

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

  4. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    OpenAIRE

    Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

    2018-01-01

    Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

  5. Science 101: Why Don't Spiders Stick to Their Own Webs?

    Science.gov (United States)

    Robertson, Bill

    2011-01-01

    This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

  6. Ineffective crypsis in a crab spider: a prey community perspective.

    Science.gov (United States)

    Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

    2010-03-07

    Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

  7. Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

    Science.gov (United States)

    Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

    2017-08-01

    Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

  8. Salticid predation as one potential driving force of ant mimicry in jumping spiders

    Science.gov (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

    2011-01-01

    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  9. High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

    2010-01-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

  10. [Infections after bite wounds : For example rat bite fever due to Streptobacillus moniliformis].

    Science.gov (United States)

    Hof, Herbert; Binder, Rudolf; Schäfer, Christian; Stuber, Madeleine; Licht, Andreas; Bozenhardt-Stavrakidis, Iris; Bode, Konrad

    2018-04-11

    Rat bite fever due to Streptobacillus moniliformis induces typical but not pathognomonic clinical signs, such as local purulent wound infection followed by maculopapular exanthema, myalgia as well as purulent joint infections. Severe complications, such as osteomyelitis and endocarditis are possible. it seems that this infection is rarely diagnosed but this infection could be much more common because the final diagnostic proof is difficult to achieve. Firstly, the culture of these bacteria is critical because the bacteria are fastidious and secondly the exact differentiation of the isolates is hardly possible by standard laboratory methods. Modern techniques such as mass spectroscopy (MALDI-TOF) and molecular biology allow a precise clarification. Surgical cleansing of infection sites in combination with a rational antibiotic therapy, for example with beta-lactam antibiotics, are generally able to cure the infection if treatment is started early enough. In addition, vaccinations, for example against tetanus and rabies have to be considered in this situation as for all other bite wound infections.

  11. SPIDER: Probing the Early Universe with a Suborbital Polarimeter

    Science.gov (United States)

    Fraisse, Aurélien A.; SPIDER Collaboration

    2012-01-01

    SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

  12. Spider Silk as Guiding Biomaterial for Human Model Neurons

    Directory of Open Access Journals (Sweden)

    Frank Roloff

    2014-01-01

    Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

  13. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    Energy Technology Data Exchange (ETDEWEB)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

    2010-08-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  14. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    International Nuclear Information System (INIS)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  15. Arachnid aloft: directed aerial descent in neotropical canopy spiders.

    Science.gov (United States)

    Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

    2015-09-06

    The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

  16. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

    Science.gov (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

    2015-11-01

    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  17. Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

    Directory of Open Access Journals (Sweden)

    Komposch, Christian

    2011-01-01

    Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

  18. Radiation Safety System for SPIDER Neutral Beam Accelerator

    International Nuclear Information System (INIS)

    Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

    2011-01-01

    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  19. Use of clear aligners in open bite cases: an unexpected treatment option.

    Science.gov (United States)

    Giancotti, Aldo; Garino, Francesco; Mampieri, Gianluca

    2017-06-01

    In open bite case treatments, a proper diagnostic differentiation is essential in determining the appropriate corrective procedures. Dental open bites are generally more responsive to treatment with orthodontics alone, whereas skeletal open bites often require a combination of orthodontics and orthognathic surgery. Patient selection and treatment principles for non-surgical open bite treatment routinely include fixed appliances both labial or lingual. However, removable clear aligners have gained a consistent popularity in the treatment of complex cases including open bite malocclusions. In this article, the authors describe three different clinical cases in which open bite cases had been satisfactorily treated by using clear aligners.

  20. Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

    Science.gov (United States)

    Norberg, Joakim; Wiens, Stefan

    2013-11-09

    When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

  1. Epidemiological study of insect bite reactions from Central India

    Directory of Open Access Journals (Sweden)

    Sumit Kar

    2013-01-01

    Full Text Available Introduction: The physical effects of the arthropod bites on human skin receive less attention, especially in the rural areas where the per capita income is less. Ours is a rural-based hospital, the vicinity having more of plants, trees, and forests; we undertook the study to find out the relation of insect bite dermatitis in a rural area. Materials and Methods: The study was carried out in the Dermatology outpatient department of our institute on 100 subjects of insect bite dermatitis who were questioned retrospectively about the sequence of events besides their environmental and living conditions. They were examined thoroughly and the relevant clinical findings were noted, also taking into account the prior treatment taken by them, if any. Results and Conclusions: It was found that insect bite dermatitis has no age or gender preponderance, and the protective factors for the same are use of full sleeve clothes and keeping the doors and windows closed at night. On the contrary, the risk factors are residence in areas of heavy insect infestation, use of perfumes and colognes, warm weather in spring and summer and the lack of protective measures. However, there was no direct association of atopy with increased risk of developing insect bite dermatitis.

  2. Facial dog bite injuries in children: A case report

    Directory of Open Access Journals (Sweden)

    Alessandro Leite Cavalcanti

    Full Text Available Introduction: Dog bites are common and can affect victims of different ages, from children to the elderly. Injuries are usually located in different body regions, including head and face. The treatment of choice for injuries is the suture of the lesion, accompanied by antibiotic therapy and tetanus and anti-rabies vaccination. Presentation of case: An 11-year-old male black patient was admitted to the Surgery and Maxillo-Facial Traumatology Service, on an urgent basis, victim of domestic animal aggression (dog biting. The child had multiple and extensive lesions on the face, trauma with laceration with loss of substance, involving the left genic region, lower and upper lip, and lower gingival-labial sulcus. Discussion: Smaller children are especially vulnerable to injuries in the craniofacial region due their low stature, propensity to crawl/play on the ground and exploratory behavior. The primary treatment of bites is by means of direct suture, grafting or local flaps, depending on the type of wound and the surgeon's decision, regardless of time elapsed from the attack. Conclusion: This case shows a case of a child patient victim of animal bite, with lesions limited to the region of the face. The patient was followed up for a month and showed good wound healing without any complications. Keywords: Wounds and injuries, Bites and stings, Maxillofacial injuries, Dogs

  3. Efficacy of topical permethrin as repellent against Aedes aegypti's bites.

    Science.gov (United States)

    Miot, Hélio Amante; Ferreira, Daniela Pinho; Mendes, Fabiana Guandalini; Carrenho, Flávia Roberta Hernandes; de Oliveira Amui, Isabela; Carneiro, Carlos Augusto Sá; Madeira, Newton Goulart

    2008-07-15

    Mosquitoes are the most important vectors of infectious diseases and their bites are related to several adverse skin reactions. Permethrin impregnated clothes are an efficient strategy against arthropods' bites; however, its topical efficacy as a repellent has not been well established. We studied the response to permethrin lotion 5 percent and N,N-Diethyl-meta-toluamide (DEET) spray 50 percent applied to the unprotected forearms of 10 volunteers. Each arm was exposed to 20 female mosquitoes of Aedes aegypti. We performed 71 bilateral comparative measurements evaluating the timing for the first bites. The average times for the arm without the product, with permethrin 5 percent, and with DEET 50 percent were: 7.9 seconds, 336.2 seconds and 7512.1 seconds. The results showed a significant difference between repellency times between either product and unprotected controls. In addition, there was a significant difference in time to first bite between permethrin and DEET treated arms (pAedes aegypti bites in this experimental setting. However, permethrin's profile of repellency was significantly inferior to that of DEET.

  4. Mosquito bite anaphylaxis: immunotherapy with whole body extracts.

    Science.gov (United States)

    McCormack, D R; Salata, K F; Hershey, J N; Carpenter, G B; Engler, R J

    1995-01-01

    Adverse reactions to mosquito bites have been recognized for some time. These usually consist of large local swellings and redness, generalized urticaria, angioedema and less easily definable responses such as nausea, dizziness, headaches, and lethargy. We report two patients who experienced systemic anaphylaxis from mosquito bites. Both were skin tested and given immunotherapy using whole body mosquito extracts. Skin testing using whole body mosquito extracts was positive to Aedes aegypti at 1/1,000 weight/volume (wt/vol) in one patient and to Aedes aegypti at 1/100,000 wt/vol, and Culex pipiens at 1/10,000 wt/vol in the other. Skin testing of ten volunteers without a history of adverse reactions to mosquito bites was negative. Immunotherapy using these extracts resulted in resolution of adverse reactions to mosquito bites in one patient and a decrease in reactions in the other. Immunotherapy with whole body mosquito extracts is a viable treatment option that can play a role in patients with mosquito bite-induced anaphylaxis. It may also result in severe side effects and one must determine the benefit versus risks for each individual patient.

  5. Kissing Bug ( spp. Intrusion into Homes: Troublesome Bites and Domiciliation

    Directory of Open Access Journals (Sweden)

    Stephen A. Klotz

    2016-01-01

    Full Text Available Kissing bugs ( Triatoma spp. frequently enter homes and bite human and pet occupants. Bites may lead to severe allergic reactions and, in some cases, death. Kissing bugs are also vectors of Trypanosoma cruzi , the cause of Chagas disease. In general, modern houses in the United States are not conducive to domiciliation of kissing bugs (bugs living out their entire life within the home with the presence of eggs, nymphs, adults, and exuviae. Construction features such as concrete foundations, solid walls and ceilings, window screens, tight thresholds for doors and windows, and other measures impede bug entry into homes, and air conditioning reduces the need for open doors and windows. Where Chagas disease is endemic in Mexico and Central and South America, homes often have thatch roofs, adobe walls, and open doors and windows. We investigated numerous instances of kissing bug intrusions into homes in Southern Arizona, California, and Louisiana and documented the reactions to kissing bug bites. Our work confirms the importance of modern home construction in limiting kissing bug intrusions. Older homes, especially those lacking modern screening, caulking, and weather stripping to reduce air leakage, may be subject to kissing bug intrusions and domiciliation. We describe a community in Southern Arizona where domiciliation of homes by Triatoma recurva is common. We also provide recent data regarding kissing bug bites and allergic reactions to the bites.

  6. Possible transmission of HIV Infection due to human bite

    Directory of Open Access Journals (Sweden)

    Bandivdekar Atmaram H

    2011-03-01

    Full Text Available Abstract The potential risk of HIV-1 infection following human bite although epidemiologically insignificant, but it is biologically possible. There are anecdotal reports of HIV transmission by human bites particularly if saliva is mixed with blood. The oral tissues support HIV replication and may serve as a previously unrecognized HIV reservoir. The HIV infected individuals have more viruses in blood than saliva, possibly due to the potent HIV-inhibitory properties of saliva. The case presented here is of a primary HIV infections following a human bite where in the saliva was not blood stained but it got smeared on a raw nail bed of a recipient. The blood and saliva of the source and blood of the recipient showed a detectable viral load with 91% sequence homology of C2-V3 region of HIV gp120 between the two individuals. The recipient did not receive PEP [post exposure prophylaxis] as his family physician was unaware of salivary transmission. The family physician should have taken PEP decision after proper evaluation of the severe and bleeding bite. Hence it is necessary to treat the HIV infected human bites with post exposure prophylaxis.

  7. [Prevalence of cross-bite in Mexican children].

    Science.gov (United States)

    Ojeda León, S; De la Teja Angeles, E

    1990-10-01

    As observed, the problem of lining and accommodation of teeth in the child population is increasingly larger. This fact prompted the authors to attempt determining the prevalence of cross-bite in a sample of Mexican children. A total of 306 patients, aged between two and 17 and attending the Stomatology service of the National Institute of Pediatrics, were evaluated, from which all pertinent data regarding age, sex, molar-temporal relationship (terminal, rectus, distal, messial and exaggerated messial planes), permanent molar status (Angle I, II, III), cross-bite, type of dentition affected (primary, mixed or permanent), cross-bite classification (anterior, posterior or mixed), whether unilateral, bilateral, dental or skeletal, right or left, and number of teeth affected, were duly recorded. Out of 306 evaluated patients (160 males, 146 female), 112 evidenced cross-bite (36.6%), 56 of each sex; in 69.6% the teeth were anterior, in 17.8% they were posterior, and in 15.5% their position was mixed. Their average age was 8 years, and malocclusion was Angle class I. From this experience, it is to be concluded that early detection and correction of any dental occlusion abnormality will permit correcting defects in dentofacial development; it is thus necessary to ascertain the frequency of cross-bite.

  8. Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

    DEFF Research Database (Denmark)

    Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

    2012-01-01

    Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

  9. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

    Science.gov (United States)

    Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

    2015-09-24

    A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

  10. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan

    2015-10-01

    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  11. Multivariable control of a rolling spider drone

    Science.gov (United States)

    Lyu, Haifeng

    The research and application of Unmanned Aerial Vehicles (UAVs) has been a hot topic recently. A UAV is dened as an aircraft which is designed not to carry a human pilot or operated with remote electronic input by the flight controller. In this thesis, the design of a control system for a quadcopter named Rolling Spider Drone is conducted. The thesis work presents the design of two kinds of controllers that can control the Drone to keep it balanced and track different kinds of input trajectories. The nonlinear mathematical model for the Drone is derived by the Newton-Euler method. The rotational subsystem and translational system are derived to describe the attitude and position motion of Drone. Techniques from linear control theory are employed to linearize the highly coupled and nonlinear quadcopter plant around equilibrium points and apply the linear feedback controller to stabilize the system. The controller is a digital tracking system that deploys LQR for system stability design. Fixed gain and adaptive gain scheduled controllers are developed and compared with different LQR weights. Step references and reference trajectories involving signicant variation for the yaw angle in the xy-plane and three-dimensional spaces are tracked in the simulation. The physical implementation and an output feedback controller are considered for future work.

  12. Efficient Journaling for the Spider Storage System

    Energy Technology Data Exchange (ETDEWEB)

    Oral, H Sarp [ORNL; Wang, Feiyi [ORNL; Shipman, Galen M [ORNL; Dillow, David A [ORNL; Miller, Ross G [ORNL; Drokin, Oleg [ORNL

    2003-01-01

    Journaling is a widely used technique to increase file system robustness against meta data and/or data corruptions. While the overhead of journaling can be negligible for small-scale file systems, we found that two aspects of local back-end file system journaling significantly lower the overall performance of a large-scale parallel file system such as Lustre: extra head seeks and serialization of incoming client requests. Journal transactions reside on a separate area of the disk that the file data, and each commit of the journal requires a head seek. Incoming client requests become serialized and take a latency hit by waiting for a commit to occur before the reply is sent. In this paper we present two different approaches to increase the local back-end file system journaling efficiency, thus increasing the overall aggregate parallel file system efficiency. First, we present a hardware-based solution where a solid-state device is used as an external journaling device to minimize the disk head seek. Second, we introduce a software-based optimization to allow asynchronously commit multiple journal transactions on the local back-end file system to minimize the penalty of serialization. Both our solutions are experimentally tested on Oak Ridge National Laboratory's large-scale Spider storage system and our tests show that both methods nearly double the overall parallel write performance.

  13. Factors Associated with Tick Bite Preventive Practices among Farmworkers in Malaysia

    Science.gov (United States)

    Wong, Li Ping; Tay, Sun Tee; Bulgiba, Awang; Zandi, Keivan; Kho, Kai Ling; Koh, Fui Xian; Ong, Bee Lee; Jaafar, Tariq; Hassan Nizam, Quaza Nizamuddin

    2016-01-01

    Background Farmworkers are at high-risk for tick bites, which potentially transmit various tick-borne diseases. Previous studies show that personal prevention against tick bites is key, and certain factors namely, knowledge, experience of tick bites, and health beliefs influence compliance with tick bites preventive behaviour. This study aimed to assess these factors and their associations with tick bite preventive practices among Malaysian farmworkers. Methods A total of eight cattle, goat and sheep farms in six states in Peninsular Malaysia participated in a cross-sectional survey between August and October 2013 Results A total of 151 (72.2%) out of 209 farmworkers answered the questionnaire. More than half of the farmworkers (n = 91) reported an experience of tick bites. Farms with monthly acaricide treatment had significantly (P<0.05) a low report of tick bites. Tick bite exposure rates did not differ significantly among field workers and administrative workers. The mean total knowledge score of ticks for the overall farmworkers was 13.6 (SD±3.2) from 20. The mean total tick bite preventive practices score for all farmworkers was 8.3 (SD±3.1) from 15. Fixed effect model showed the effects of four factors on tick bite prevention: (1) farms, (2) job categories (administrative workers vs. field workers), (3) perceived severity of tick bites, and (4) perceived barriers to tick bite prevention. Conclusions A high proportion of farmworkers, including administrative workers, reported an experience of tick bites. The effectiveness of monthly acaricide treatment was declared by low reports of tick bites on these farms. Tick bite preventive practices were insufficient, particularly in certain farms and for administrative workers. Our findings emphasise the need to have education programmes for all farmworkers and targeting farms with low prevention practices. Education and health programmes should increase the perception of the risk of tick bites and remove perceived

  14. Recombinant Spider Silks—Biopolymers with Potential for Future Applications

    Directory of Open Access Journals (Sweden)

    Thomas Scheibel

    2011-03-01

    Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

  15. Synthetic Adhesive Attachment Discs based on Spider Pyriform Silk Architecture

    Science.gov (United States)

    Jain, Dharamdeep; Sahni, Vasav; Dhinojwala, Ali

    2014-03-01

    Among the variety of silks produced by spiders, pyriform silk is used in conjunction with the dragline silk to attach webs to different surfaces. Cob weaver spiders employ different architectural patterns to utilize the pyriform silk and form attachment joints with each pattern having a characteristic adhesive performance. The staple pin architecture is a one of the strongest attachment designs employed by spiders to attach their webs. Here we use a synthetic approach to create the a similar patterned architecture attachment discs on aluminum substrate using thermoplastic polyurethane. Measurable pull off forces are generated when the synthetic discs are peeled off a surface. This innovative adhesive strategy can be a source of design in various biomedical applications. Financial Support from National Science Foundation.

  16. Final design of thermal diagnostic system in SPIDER ion source

    Energy Technology Data Exchange (ETDEWEB)

    Brombin, M., E-mail: matteo.brombin@igi.cnr.it; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N. [Consorzio RFX, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2016-11-15

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H{sup −} production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  17. Small Molecules from Spiders Used as Chemical Probes

    DEFF Research Database (Denmark)

    Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

    2011-01-01

    Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

  18. Spider Silk Processing for Spidroin Recovery from Crossopriza Lyoni Web

    Science.gov (United States)

    Mohtar, J. A.; Ooi, W. L.; Yusuf, F.

    2018-03-01

    Spider silk is a potential biomaterial that can be used in various applications for its outstanding physicomechanical properties attributed by the spidroin composition. Efforts for commercializing spider silks have been mainly focused on the characterization of spidroins from the Entelegyne spiders for exceptional fibre construction. Hence, studies on silk proteins from the Haplogyne species remain neglected. The aim of this study is to isolate spidroin from Crossopriza lyoni web. Silk processing involved the pretreatment of fibres for the shell layer removal from the surface. A screening study was conducted to analyze the effect of temperature, incubation time and agitation speed on spidroin extraction using Ajisawa’s reagent by OFAT analysis followed by statistical optimization of the extraction process via RSM for maximal protein recovery. All parameters exerted significant effect on spidroin recovery (pspider silk to meet the demand for a variety of silk-based products in the near future.

  19. Final design of thermal diagnostic system in SPIDER ion source

    International Nuclear Information System (INIS)

    Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.

    2016-01-01

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H"− production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  20. Analysis for the brazing deformation of AFA3G spider

    International Nuclear Information System (INIS)

    Lin Feng

    2015-01-01

    Spider, the key component of the AFA3G cluster control assemblies (RCCA), is brazed with body, vanes and fingers. Vacuum brazing is crucial in the spider process and it is directly relevant to the final product quality. This paper analyze the deformation of the AFA3G spider in vacuum brazing procedure based on a large amount of data. The results indicate that the parallelism of the finger is most affected by the brazing and its deformation has obvious regularity. Deformation is mainly caused by the different contraction directions of components along with the interactions among them during cooling process. An optimized design of the brazing fixture based on the regularity and the value of the deformation greatly improves the parallelism of the fingers. Besides, the vacuum brazing procedure also affects the hole diameter of the finger, however, we could reduce the deformation by using columnar pin on the brazing fixture. (author)

  1. Cause, setting and ownership analysis of dog bites in Bay County, Florida from 2009 to 2010.

    Science.gov (United States)

    Matthias, J; Templin, M; Jordan, M M; Stanek, D

    2015-02-01

    Emergency room and hospital discharge data have been used to describe the risk factors and public health impact of dog bites. These data sets are based on financial charges for severe bites and underestimates dog bite burdens within communities. This study expands both the source of information and risk factor data collected to provide demographic analysis of dog bite injury risk factors reported in Bay County, Florida in 2009-2010. Extended data for dog bites reported by various sources from January 1, 2009 to December 31, 2010 were collected by Florida Department of Health in Bay County. Data collected included bite victim's age and gender, primary reported cause of bite, setting, dog's restraint status and relationship between the victim and the dog. A total of 799 bites were reported. Most bites (55%) were reported first by healthcare practitioners, particularly bites involving childrenmanagement was the most common cause of bites (26%), followed by protective behaviour (24%). Bites of unknown cause were 2.5 times more likely in childrenrisks by age group or gender provides an opportunity to implement targeted interventions to prevent dog bites. © 2014 Blackwell Verlag GmbH.

  2. Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

    Science.gov (United States)

    Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

    2013-02-01

    Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

  3. Kawasaki Disease with Retropharyngeal Edema following a Blackfly Bite

    Directory of Open Access Journals (Sweden)

    Toru Watanabe

    2014-01-01

    Full Text Available We describe a patient with Kawasaki disease (KD and retropharyngeal edema following a blackfly bite. An 8-year-old boy was referred to our hospital because of a 3-day-history of fever and left neck swelling and redness after a blackfly bite. Computed tomography of the neck revealed left cervical lymph nodes swelling with edema, increased density of the adjacent subcutaneous tissue layer, and low density of the retropharyngeum. The patient was initially presumed to have cervical cellulitis, lymphadenitis, and retropharyngeal abscess. He was administered antibiotics intravenously, which did not improve his condition. The patient subsequently exhibited other signs of KD and was diagnosed with KD and retropharyngeal edema. Intravenous immunoglobulin therapy and oral flurbiprofen completely resolved the symptoms and signs. A blackfly bite sometimes incites a systemic reaction in humans due to a hypersensitive reaction to salivary secretions, which may have contributed to the development of KD in our patient.

  4. Hypersensitivity to mosquito bite manifested as Skeeter syndrome

    Directory of Open Access Journals (Sweden)

    Rafael Pérez-Vanzzini

    2015-02-01

    Full Text Available The reactions to mosquito bites are immunological reactions with involvement of IgE, IgG and T cells mediated hypersensitivity. These reactions are common and range from small local reactions, large local reactions to systemic allergic reactions. Skeeter syndrome is defined as a large local induced inflammatory reaction to mosquito bite and sometimes accompanied by systemic symptoms such as fever and vomiting. Diagnosis is based on clinical history and physical examination, supported by the identification of specific IgE by skin testing. Treatment includes prevention, antihistamines and steroids in some cases. Specific immunotherapy still requires further study. This paper reports two cases of patients with hypersensitivity reactions to mosquito bites, which were evaluated in our center presenting positive skin tests.

  5. Animal bite injuries to the face : A Case Report.

    Science.gov (United States)

    Simao, Niverso Rodrigues; Borba, Alexandre Meireles; da Silva, Andre Luis Fernandes; Vieira, Evanice Menezes Marcal; Carvalhosa, Artur Aburad; Bandeca, Matheus Coelho; Borges, Alvaro Henrique

    2013-08-01

    Traumatic lacerations to the skin are problems frequently seen and treated by emergency centers around the world. Among all wounds, dog and cat bites are commonly seen. As in many mammals, different species of microorganisms are found in dog and cat mouths with a potential pathological effect to humans, as represented by rabies. The injuries have disfiguration effect with possible psychological repercussion to the patient. This article aimed presenting up to date considerations regarding the management of animal bite injuries to the face, exemplified by a case report that should be the interest of all professions that deal with facial tissues, as dentists do. How to cite this article: Simao NR, Borba AM, da Silva ALF, Vieira EMM, Carvalhosa AA, Bandeca MC, Borges AH. Animal bite injuries to the face: A Case Report. J Int Oral Health 2013; 5(4):68-72.

  6. An image filtering technique for SPIDER visible tomography

    Energy Technology Data Exchange (ETDEWEB)

    Fonnesu, N., E-mail: nicola.fonnesu@igi.cnr.it; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G. [Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2014-02-15

    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported.

  7. An image filtering technique for SPIDER visible tomography

    International Nuclear Information System (INIS)

    Fonnesu, N.; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G.

    2014-01-01

    The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported

  8. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

    2013-01-01

    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  9. Open bite as a risk factor for orthodontic root resorption.

    Science.gov (United States)

    Motokawa, Masahide; Terao, Akiko; Kaku, Masato; Kawata, Toshitsugu; Gonzales, Carmen; Darendeliler, M Ali; Tanne, Kazuo

    2013-12-01

    The purpose of the present study was to clarify the prevalence and degree of root resorption induced by orthodontic treatment in patients with and without open bite. One hundred and eleven patients treated with multibracket appliances were retrospectively selected from the patients and divided into non-open bite (NOB) and open bite (OB) groups. The severity of root resorption and the root shape were classified into five groups on periapical radiographs before and after treatment. Moreover, only in the OB group, all teeth were sub-divided into functional and hypofunctional ones that are occluding and non-occluding. As the results of multiple linear regression analysis of patient characteristics and clinical variables with the number of overall root resorption, the independent variables that were found to contribute significantly to root resorption were bite and abnormal root shape. The prevalences of root resorption evaluated in the number of patients were significantly higher in OB group than in NOB group, and those in the number of teeth were significantly higher in OB group than in NOB group, in particular anterior and premolar teeth. The prevalence of resorbed teeth with abnormal root shapes was also significantly higher in OB group than in NOB group. On the other hand, in OB group, the prevalences of root resorption and teeth with abnormal root shape were significantly greater in hypofunctional teeth than in normal functional teeth. There are more teeth with root resorption and abnormal root shape in open bite cases than in normal bite cases, and more teeth with abnormal root shapes and root resorption in hypofunctional teeth than in functional teeth.

  10. Medicinal plants used to treat Snake bite by Fulani Herdsmen in ...

    African Journals Online (AJOL)

    Dr. Ameen

    the use of village surrounding medicinal plants for the treatment of the snake bite. Recent efforts on ... treatment of snake bites. Information .... Snake venoms are complex mixture of enzymatic and .... treated, mode of diagnosis and medicinal.

  11. Feeding biomechanics and theoretical calculations of bite force in bull sharks (Carcharhinus leucas) during ontogeny.

    Science.gov (United States)

    Habegger, Maria L; Motta, Philip J; Huber, Daniel R; Dean, Mason N

    2012-12-01

    Evaluations of bite force, either measured directly or calculated theoretically, have been used to investigate the maximum feeding performance of a wide variety of vertebrates. However, bite force studies of fishes have focused primarily on small species due to the intractable nature of large apex predators. More massive muscles can generate higher forces and many of these fishes attain immense sizes; it is unclear how much of their biting performance is driven purely by dramatic ontogenetic increases in body size versus size-specific selection for enhanced feeding performance. In this study, we investigated biting performance and feeding biomechanics of immature and mature individuals from an ontogenetic series of an apex predator, the bull shark, Carcharhinus leucas (73-285cm total length). Theoretical bite force ranged from 36 to 2128N at the most anterior bite point, and 170 to 5914N at the most posterior bite point over the ontogenetic series. Scaling patterns differed among the two age groups investigated; immature bull shark bite force scaled with positive allometry, whereas adult bite force scaled isometrically. When the bite force of C. leucas was compared to those of 12 other cartilaginous fishes, bull sharks presented the highest mass-specific bite force, greater than that of the white shark or the great hammerhead shark. A phylogenetic independent contrast analysis of anatomical and dietary variables as determinants of bite force in these 13 species indicated that the evolution of large adult bite forces in cartilaginous fishes is linked predominantly to the evolution of large body size. Multiple regressions based on mass-specific standardized contrasts suggest that the evolution of high bite forces in Chondrichthyes is further correlated with hypertrophication of the jaw adductors, increased leverage for anterior biting, and widening of the head. Lastly, we discuss the ecological significance of positive allometry in bite force as a possible

  12. Mass awareness regarding snake bite induced early morning neuroparalysis can prevent many deaths in North India

    OpenAIRE

    Sharma, Rupinder; Dogra, Varundeep; Sharma, Gurudutt; Chauhan, Vivek

    2016-01-01

    Introduction: In North India snake bite deaths are predominantly seen with neurotoxic envenomations (NEs) whereas in South India the hemotoxic envenomation (HE) is more common. Krait is responsible for most deaths in North India. It bites people sleeping on the floors, mostly at night. We describe the profile of venomous snake bites over 1 year in 2013. Materials and Methods: The study was conducted in a rural tertiary care hospital in North India. Demographics, circumstances of bite, envenom...

  13. Streptococcus oralis cerebral abscess following monkey bite in a 2-month-old infant.

    Science.gov (United States)

    Thiagarajan, Srinivasan; Krishnamurthy, Sriram; Raghavan, Renitha; Mahadevan, Subramanian; Madhugiri, Venkatesh S; Sistla, Sujatha

    2016-05-01

    Although cerebral abscesses caused by animal bites have been reported, they are extremely rare in infants and have not been described following monkey bite. A 55-day-old male infant presented with a multi-loculated Streptococcus oralis cerebral abscess following a monkey bite on the scalp. There was a clinical response to antibiotic therapy and repeated surgical aspiration followed by a ventriculoperitoneal shunt. This is the first report of a patient with a brain abscess following a monkey bite.

  14. The management of dog bite injuries of genitalia in paediatric age ...

    African Journals Online (AJOL)

    Dog bite injuries are common in children and represent an important health-care problem. Most dog bite injuries involve the face or an extremity. Victims tend to seek medical care quickly. Dog bites to the external genitalia are rarely reported, but they potentially result in morbidity if improperly managed. Morbidity is also ...

  15. Age-related changes in the propensity of dogs to bite.

    Science.gov (United States)

    Messam, L L McV; Kass, P H; Chomel, B B; Hart, L A

    2013-08-01

    This retrospective cohort study was aimed at describing the effects of age at acquisition, age, and duration of ownership of dogs on the risk of (1) bites during play and (2) non-play bites to humans. Data were collected on 110 dogs that had bitten during play with a person, 161 dogs that had bitten outside of play and 951 non-biting dogs from veterinary clients in Kingston (KGN), Jamaica and San Francisco (SF), USA. Modified Poisson regression was employed to model the relationships of both types of bites to each variable separately. Effects of the variables on dog bite risk (1) during and (2) outside of play with the dog, differed from each other and by type of bite. Effects varied with the dog's age and age-related associations were strongest in dogs younger than 1 year old. Ages at acquisition of dogs at highest risk for bites during play were substantially lower than those at risk for non-play bites. Ages and durations of ownership of dogs at highest risk for bites during play were also lower than those of dogs at highest risk for non-play bites. The propensity of a dog to bite changes as it ages and relationships between dog bites occurring during and outside of play and the dog's age at acquisition, current age, and duration of ownership, differ from each other. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. A retrospective review of snake bite victims admitted in a tertiary ...

    African Journals Online (AJOL)

    Objective: Snake bite remains major public health problem worldwide. We present our experience with cases of snake bites managed in our tertiary care teaching center of South India. Materials and Methods: The details of all patients with snake bite admitted to a tertiary teaching care hospital from 2010 to 2012 were ...

  17. A placebo controlled clinical trial investigating the efficacy of a homeopathic after-bite gel in reducing mosquito bite induced erythema.

    Science.gov (United States)

    Hill, N; Stam, C; Tuinder, S; van Haselen, R A

    1995-01-01

    A randomised, placebo controlled clinical trial was conducted to examine the efficacy of a homeopathic after-bite gel in the symptomatic relief of mosquito bites. Sixty eight healthy volunteers were bitten under laboratory conditions by Aedes aegypti mosquitoes at three spots, on the ventral aspect of the forearm. One bite was treated with the homeopathic after-bite gel, another bite with a placebo gel which was identical in appearance and smell to the homeopathic after-bite gel, and the third bite remained untreated. Immediately after the bites and 1, 3, 6, 26 and 31 hours post-bite, the length and width of the erythema were measured with a calliper, and photographs were taken of the bite sites from which the size of the erythema was subsequently determined. This was followed by assessment of the extent of itching with a verbal analogue scale, and finally treatment took place. For each spot the total erythema was calculated as the area under the plotted curve of the erythema at different time points (mm2*h) and the total sum of the itch scores was determined. For the bites treated with the homeopathic after-bite gel the median total erythema was 10.500 mm2*h. For the spots treated with the placebo gel and the untreated spots the median total erythema was 12.900 mm2*h and 13.300 mm2*h, respectively. The difference between the spots treated with the homeopathic after-bite gel and the untreated spots came close to significance (two-tailed P = 0.06), which was not the case for the difference between the spots treated with the homeopathic after-bite gel and the spots treated with placebo gel (P = 0.13). After pooling the data of a very similar previous pilot study and the present study (ntotal = 83), the homeopathic after-bite gel was significantly superior to no treatment (two-tailed P = 0.003) as well as to placebo gel (two-tailed P = 0.03). Comparing itching after the three treatments, no significant differences could be demonstrated. The extent of itching was

  18. variability in condensed tannins and bitterness in spider plant ...

    African Journals Online (AJOL)

    ACSS

    Spider plant (Cleome gynandra L.) contributes considerably to the nutrition and medicines of communities in southern Africa. However, its utilisation is limited by its bitterness caused by condensed tannins. Unfortunately, processing options that reduce the bitterness also remove nutritionally and medicinally useful ...

  19. Crab spiders (Araeneae: Philodromidae, Thomisidae) of Ramsey County, Minnesota.

    Science.gov (United States)

    Daniel. T. Jennings; Bruce Cutler

    1996-01-01

    Crab spiders of 2 families, 10 genera, and 35 species were collected over a 31-year period in Ramsey County, Minnesota. Rarely collected species included Philodromus keyserlingi, Xysticus pellax, X. chippewa, X. banksi and X. alboniger. Identification source(s), season and collection frequency, and biology are summarized for each species.

  20. Biological control of fruit-tree red spider mite

    NARCIS (Netherlands)

    Rabbinge, R.

    1976-01-01

    During the last decade, integrated pest control systems have been developed for several crops. One of the main fields of research in integrated control has been the control of orchard pests. Experience with modified spraying programmes in apple orchards, the increasing resistance of spider

  1. Effects of Packaging and Storage Conditions on Quality of Spider ...

    African Journals Online (AJOL)

    African Journal of Food, Agriculture, Nutrition and Development ... However, quality of spider plant seed is affected by one or more factors that cause negative ... The purpose of this research was to increase insight into how the seed quality of ...

  2. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...

  3. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.

    1999-01-01

    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus

  4. Competition between introduced and native spiders (Araneae: Linyphiidae)

    Science.gov (United States)

    Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2014-01-01

    The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

  5. Determination of PCDDs in spider webs: preliminary studies

    Science.gov (United States)

    Rybak, Justyna; Rutkowski, Radosław

    2018-01-01

    The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

  6. The ITER Neutral Beam Test Facility towards SPIDER operation

    Science.gov (United States)

    Toigo, V.; Dal Bello, S.; Gaio, E.; Luchetta, A.; Pasqualotto, R.; Zaccaria, P.; Bigi, M.; Chitarin, G.; Marcuzzi, D.; Pomaro, N.; Serianni, G.; Agostinetti, P.; Agostini, M.; Antoni, V.; Aprile, D.; Baltador, C.; Barbisan, M.; Battistella, M.; Boldrin, M.; Brombin, M.; Dalla Palma, M.; De Lorenzi, A.; Delogu, R.; De Muri, M.; Fellin, F.; Ferro, A.; Gambetta, G.; Grando, L.; Jain, P.; Maistrello, A.; Manduchi, G.; Marconato, N.; Pavei, M.; Peruzzo, S.; Pilan, N.; Pimazzoni, A.; Piovan, R.; Recchia, M.; Rizzolo, A.; Sartori, E.; Siragusa, M.; Spada, E.; Spagnolo, S.; Spolaore, M.; Taliercio, C.; Valente, M.; Veltri, P.; Zamengo, A.; Zaniol, B.; Zanotto, L.; Zaupa, M.; Boilson, D.; Graceffa, J.; Svensson, L.; Schunke, B.; Decamps, H.; Urbani, M.; Kushwah, M.; Chareyre, J.; Singh, M.; Bonicelli, T.; Agarici, G.; Garbuglia, A.; Masiello, A.; Paolucci, F.; Simon, M.; Bailly-Maitre, L.; Bragulat, E.; Gomez, G.; Gutierrez, D.; Mico, G.; Moreno, J.-F.; Pilard, V.; Chakraborty, A.; Baruah, U.; Rotti, C.; Patel, H.; Nagaraju, M. V.; Singh, N. P.; Patel, A.; Dhola, H.; Raval, B.; Fantz, U.; Fröschle, M.; Heinemann, B.; Kraus, W.; Nocentini, R.; Riedl, R.; Schiesko, L.; Wimmer, C.; Wünderlich, D.; Cavenago, M.; Croci, G.; Gorini, G.; Rebai, M.; Muraro, A.; Tardocchi, M.; Hemsworth, R.

    2017-08-01

    SPIDER is one of two projects of the ITER Neutral Beam Test Facility under construction in Padova, Italy, at the Consorzio RFX premises. It will have a 100 keV beam source with a full-size prototype of the radiofrequency ion source for the ITER neutral beam injector (NBI) and also, similar to the ITER diagnostic neutral beam, it is designed to operate with a pulse length of up to 3600 s, featuring an ITER-like magnetic filter field configuration (for high extraction of negative ions) and caesium oven (for high production of negative ions) layout as well as a wide set of diagnostics. These features will allow a reproduction of the ion source operation in ITER, which cannot be done in any other existing test facility. SPIDER realization is well advanced and the first operation is expected at the beginning of 2018, with the mission of achieving the ITER heating and diagnostic NBI ion source requirements and of improving its performance in terms of reliability and availability. This paper mainly focuses on the preparation of the first SPIDER operations—integration and testing of SPIDER components, completion and implementation of diagnostics and control and formulation of operation and research plan, based on a staged strategy.

  7. Remote monitoring of vibrational information in spider webs

    Science.gov (United States)

    Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

    2018-06-01

    Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

  8. Multiple origins of subsociality in crab spiders (Thomisidae).

    Science.gov (United States)

    Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi

    2015-01-01

    Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

  9. Preservice Teachers' Conceptions about Animals and Particularly about Spiders

    Science.gov (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel

    2010-01-01

    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  10. Untangling the web...spiders in Arizona fields

    Science.gov (United States)

    Many kinds of arthropod natural enemies (predators and parasitoids) inhabit crop fields in Arizona and can have a large negative impact on several pest insect species that also infest these crops. Many different species of spiders are common in cotton, alfalfa and other crops in Arizona. Among the ...

  11. The sejugal furrow in camel spiders and acariform mites

    Directory of Open Access Journals (Sweden)

    Dunlop, Jason A.

    2012-07-01

    Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

  12. Taxonomic revision of the spider family Penestomidae (Araneae, Entelegynae)

    NARCIS (Netherlands)

    Miller, J.A.; Griswold, C.E.; Haddad, C.R.

    2010-01-01

    Conflicting character evidence and a scarcity of male specimens has historically made placement of the spider subfamily Penestominae Simon problematic. The Penestominae was recently removed from the family Eresidae and promoted to family rank based on the results of a molecular phylogenetic study; a

  13. SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

    International Nuclear Information System (INIS)

    O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

    2011-01-01

    SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

  14. Czech Republic – the type material of spiders (Araneae)

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Kůrka, A.; Buchar, J.; Řezáč, M.

    2005-01-01

    Roč. 174, 1-4 (2005), s. 13-64 ISSN 0139-9543 R&D Projects: GA AV ČR(CZ) IAA6007401 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * type material * Czech Republic Subject RIV: EG - Zoology

  15. On the Colours of Spider Orb-Webs

    Science.gov (United States)

    Suhr, Wilfried; Schlichting, H. Joachim

    2011-01-01

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

  16. Central European habitats inhabited by spiders with disjunctive distributions

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil

    2011-01-01

    Roč. 59, č. 2 (2011), s. 367-380 ISSN 1505-2249 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * glacial relicts * boreomontane species Subject RIV: EH - Ecology, Behaviour Impact factor: 0.506, year: 2011

  17. Ballooning behavior in the golden orbweb spider Nephilapilipes (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    Vanessa M.J. Lee

    2015-01-01

    Full Text Available Ballooning, a mode of aerial dispersal in spiders, is an innate behavior that requires appropriate physiological and meteorological conditions. Although only rarely reported in the golden orbweb spiders, family Nephilidae, the large geographic distributions of most nephilids—in particular of Nephila species—would imply that these spiders likely routinely disperse by ballooning in spite of giant female sizes. Here we study ballooning behavior in the golden orbweb spider Nephila pilipes (Fabricius, 1793. Specifically, we test for the propensity of spiderlings to deploy ballooning as a dispersal mechanism. We subjected a total of 59 first-instar spiderlings to a wind experiment at two wind speeds (2.17 ± 0.02 m s-1 and 3.17 ± 0.02 m s-1 under laboratory conditions. Under an average wind speed of 3.17 m s-1, none of the spiderlings exhibited pre-ballooning or ballooning behavior. However, at an average wind speed of 2.17 m s-1, 53 (89.8% spiderlings showed pre-ballooning behavior, and 17 (32.1% of the pre-ballooners ultimately ballooned. Our results concur with prior reports on spiderlings of other families that pre-ballooning behavior is a requirement for ballooning to occur. Furthermore, although we cannot rule out other dispersal mechanisms such as synanthropic spread, our findings suggest that the widespread N. pilipes uses ballooning to colonize remote oceanic islands.

  18. Mating duration and sperm precedence in the spider Linyphia triangularis

    DEFF Research Database (Denmark)

    Weldingh, Ditte L.; Toft, Søren; Larsen, Ole Næsbye

    2011-01-01

    , especially the males, are able to influence the outcome of mating for their own benefit. We studied the linyphiid spider Linyphia triangularis in which mating follows a strict sequence during which the male inducts two droplets of sperm and transfers them to the female. We performed sperm competition...

  19. Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

    Science.gov (United States)

    Marín, Linda; Perfecto, Ivette

    2013-04-01

    Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

  20. Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Khan Perveen

    2015-12-01

    Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

  1. Bite Block Vowel Production in Apraxia of Speech

    Science.gov (United States)

    Jacks, Adam

    2008-01-01

    Purpose: This study explored vowel production and adaptation to articulatory constraints in adults with acquired apraxia of speech (AOS) plus aphasia. Method: Five adults with acquired AOS plus aphasia and 5 healthy control participants produced the vowels [iota], [epsilon], and [ash] in four word-length conditions in unconstrained and bite block…

  2. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Particularly if you’re visiting areas with known insect-borne diseases, it’s important to take steps to ... bug bites, dermatologists recommend the following tips: Use insect repellent. To protect against mosquitoes, ticks and other ...

  3. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... 0; c public SPOT Skin Cancer™ Diseases and treatments Skin, hair, and nail care Skin care Hair care / hair loss Injured skin Blisters Bug bites and stings How to remove a tick How to treat a bee sting When to see a dermatologist Burns Frostbite Splinters Treating sunburn Wound care Nail care ...

  4. Innovation in prediction planning for anterior open bite correction.

    Science.gov (United States)

    Almuzian, Mohammed; Almukhtar, Anas; O'Neil, Michael; Benington, Philip; Al Anezi, Thamer; Ayoub, Ashraf

    2015-05-01

    This study applies recent advances in 3D virtual imaging for application in the prediction planning of dentofacial deformities. Stereo-photogrammetry has been used to create virtual and physical models, which are creatively combined in planning the surgical correction of anterior open bite. The application of these novel methods is demonstrated through the surgical correction of a case.

  5. Reconstruction of massive facial avulsive injury, secondary to animal bite.

    Science.gov (United States)

    Motamed, Sadrollah; Niazi, Feizollah; Moosavizadeh, Seyed Mehdi; Gholizade Pasha, Abdolhamid; Motamed, Ali

    2014-02-01

    Management of facial soft tissue trauma requires complex reconstruction surgery. Animal bite on face is a common cause of facial tissue trauma with severe destruction. Evaluation of unit involvement is the first effort, followed by designation of reconstruction. In this case, we performed multiple reconstruction options.

  6. Extreme skeletal open bite correction with vertical elastics.

    Science.gov (United States)

    Cruz-Escalante, Marco Antonio; Aliaga-Del Castillo, Aron; Soldevilla, Luciano; Janson, Guilherme; Yatabe, Marilia; Zuazola, Ricardo Voss

    2017-11-01

    Severe skeletal open bites may be ideally treated with a combined surgical-orthodontic approach. Alternatively, compensations may be planned to camouflage the malocclusion with orthodontics alone. This case report describes the treatment of an 18-year-old man who presented with a severe open bite involving the anterior and posterior teeth up to the first molars, increased vertical dimension, bilateral Class III molar relationship, bilateral posterior crossbite, dental midline deviation, and absence of the maxillary right canine and the mandibular left first premolar. A treatment plan including the extraction of the mandibular right first premolar and based on uprighting and vertical control of the posterior teeth, combined with extrusion of the anterior teeth using multiloop edgewise archwire mechanics and elastics was chosen. After 6 months of alignment and 2 months of multiloop edgewise archwire mechanics, the open bite was significantly reduced. After 24 months of treatment, anterior teeth extrusion, posterior teeth intrusion, and counterclockwise mandibular rotation were accomplished. Satisfactory improvement of the overbite, overjet, sagittal malocclusion, and facial appearance were achieved. The mechanics used in this clinical case demonstrated good and stable results for open-bite correction at the 2-year posttreatment follow-up.

  7. Biting-density and microfilariae infection of Simulium damnosum ...

    African Journals Online (AJOL)

    Investigations on the biting-density and microfilariae infection rate of S. damnosumsl population caught around the Mada River was conducted between May 2013 to April 2014. Captured flies were morphologically identified and dissected for parity and infectivity rate. A total of 308 adult female S. damnosum sl were caught, ...

  8. Bite weight prediction from acoustic recognition of chewing

    NARCIS (Netherlands)

    Amft, O.D.; Kusserow, M.; Tröster, G.

    2009-01-01

    Automatic dietary monitoring (ADM) offers new perspectives to reduce the self-reporting burden for participants in diet coaching programs. This paper presents an approach to predict weight of individual bites taken. We utilize a pattern recognition procedure to spot chewing cycles and food type in

  9. Treatment and outcome of unusual animal bite injuries in young ...

    African Journals Online (AJOL)

    In Philadelphia and New York City, USA, the highest incidences were found .... Mouse. Other. Monkey. 64.8%. 10.1%. 8.8%. 8.2%. 3.8%. 3.1% 1.3%. Fig. 1. Mammalian bite .... development of preventive strategies that target the population at ...

  10. Takotsubo cardiomyopathy in a snake bite victim: a case report ...

    African Journals Online (AJOL)

    Takotsubo cardiomyopathy occurs in patients with severe emotional or physiologic stress. The prognosis is usually favorable, and the left ventricular wall motion dyskinesis normalizes within days to weeks. In this paper we report a case of snake bite complicated by takotsubo cardiomyopathy. We advise physicians to ...

  11. Epidemiology of Snake Bites among Selected Communities in the ...

    African Journals Online (AJOL)

    Snake is one of the major group of games feared by people in many localities because of their venoms, yet snakes are equally afraid of human beings. This balance of terror apart from affecting both man and snakes has also led to their deaths. Epidemiology of snake bites among selected communities in the enclave of ...

  12. Convicted by a bite mark, Ted Bundy (1946-1989).

    Science.gov (United States)

    Riaud, Xavier

    2014-01-01

    The identification of a murderer and the eventual conviction was largely due to forensic dentistry and in particular the use of bite marks on the victim compared with casts of the teeth of the accused. The Bundy case has become notorious in American legal circles.

  13. Tick Talk: Block Tick Bites and Lyme Disease

    Science.gov (United States)

    ... this issue Tick Talk Block Tick Bites and Lyme Disease En español Send us your comments When warm ... mainly in the mid-Atlantic and southern states. Lyme disease is the most common tick-borne illness. It’s ...

  14. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... care Injured skin Bug bites and stings "); (function () { var a = "", b = [ "adid=aad-aad-1", "site=ehs. ... t", "hpos=l", "zone=public", "mcat1=de12", ]; for (var c = 0; c "); (function () { var a = "", b = [ "adid= ...

  15. Stability of anterior open-bite treatment with occlusal adjustment.

    Science.gov (United States)

    Janson, Guilherme; Crepaldi, Marcus Vinicius; Freitas, Karina Maria Salvatore; de Freitas, Marcos Roberto; Janson, Waldyr

    2010-07-01

    In this study, we aimed to evaluate the long-term stability of anterior open-bite treatment with occlusal adjustment and the dentinal sensitivity caused by this procedure in the long term. The sample comprised 17 open-bite patients who experienced relapse of the negative vertical overbite after orthodontic treatment and were retreated with occlusal adjustment. The cephalometric changes were evaluated on lateral cephalograms obtained before and after the occlusal adjustment and in the long term (mean, 3.4 years after occlusal adjustment). Dentinal sensitivity was also evaluated before the occlusal adjustment, and 1.35 months, 4.61 months, and 3.4 years later. The cephalometric statuses between the 3 evaluations were compared with analysis of variance (ANOVA) and Tukey tests. The percentages of clinically significant relapse were calculated. To compare dentinal sensitivity at the several stages, nonparametric Friedman and Wilcoxon tests were performed. Statistically significant relapse of anterior open bite occurred in 33.3% of the patients. Those who had the procedure before 21 years of age were most likely to experience relapse. Dentinal sensitivity remained within the normal range in the long term. Despite the statistically significant relapse of anterior open bite, clinically significant stability was found in 66.7% of the patients. Copyright (c) 2010 American Association of Orthodontists. Published by Mosby, Inc. All rights reserved.

  16. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... dress appropriately to prevent bug bites. Cover exposed skin as much as possible by wearing long-sleeved shirts, pants, socks and closed shoes instead of sandals. For additional protection, pull your socks up over your pants and ...

  17. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Mohs AUC MyDermPath+ Psoriasis Patient education resources Practice Management Center Coding and reimbursement Coding MACRA Fee schedule ... it’s important to take steps to reduce your risk. To help prevent bug bites, dermatologists recommend the ...

  18. Neurological manifestations in speech after snake bite: A rare case ...

    African Journals Online (AJOL)

    Neurological manifestations in speech after snake bite: A rare case. D Vir, D Gupta, M Modi, N Panda. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/pamj.v4i1.53597 · AJOL African Journals Online. HOW TO ...

  19. Bug bites and stings: When to see a dermatologist

    Medline Plus

    Full Text Available ... Private payer Medicare physician payment MACRA implementation Alternative payment models Fee schedule State policy State policy and action ... a dermatologist Why see a board-certified dermatologist? Home Public and patients Skin, hair, and nail care Injured skin Bug bites and stings "); (function () { var ...

  20. Interactive relationship between the mechanical properties of food and the human response during the first bite.

    Science.gov (United States)

    Dan, Haruka; Kohyama, Kaoru

    2007-05-01

    Biting is an action that results from interplay between food properties and the masticatory system. The mechanical factors of food that cause biting adaptation and the recursive effects of modified biting on the mechanical phenomena of food are largely unknown. We examined the complex interaction between the bite system and the mechanical properties. Nine subjects were each given a cheese sample and instructed to bite it once with their molar teeth. An intra-oral bite force-time profile was measured using a tactile pressure-measurement system with a sheet sensor inserted between the molars. Time, force, and impulse for the first peak were specified as intra-oral parameters of the sample fracture. Mechanical properties of the samples were also examined using a universal testing machine at various test speeds. Besides fracture parameters, initial slope was also determined as a mechanical property possibly sensed shortly after bite onset. The bite profile was then examined based on the mechanical parameters. Sample-specific bite velocities were identified as characteristic responses of a human bite. A negative correlation was found between bite velocity and initial slope of the sample, suggesting that the initial slope is the mechanical factor that modifies the consequent bite velocity. The sample-specific bite velocity had recursive effects on the following fracture event, such that a slow velocity induced a low bite force and high impulse for the intra-oral fracture event. We demonstrated that examination of the physiological and mechanical factors during the first bite can provide valuable information about the food-oral interaction.

  1. Synthetic Spider Silk Production on a Laboratory Scale

    Science.gov (United States)

    Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

    2012-01-01

    As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

  2. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro

    2011-03-01

    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  3. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

  4. SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

    Directory of Open Access Journals (Sweden)

    Alexander V. Ponomarev

    2015-01-01

    Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

  5. The management of dog bite injuries of genitalia in paediatric age

    Directory of Open Access Journals (Sweden)

    Mirko Bertozzi

    2013-01-01

    Full Text Available Dog bite injuries are common in children and represent an important health-care problem. Most dog bite injuries involve the face or an extremity. Victims tend to seek medical care quickly. Dog bites to the external genitalia are rarely reported, but they potentially result in morbidity if improperly managed. Morbidity is also directly related to the severity of initial wound. Guidelines for the management of dog bites include irrigation, dιbridment, antibiotic therapy, consideration of tetanus and rabies immunisation and suture of wounds or surgical reconstruction. Literature review was conducted and focused to analyze the management of dog bite lesions involving external genitalia.

  6. Open Fracture of the Forearm Bones due to Horse Bite

    Directory of Open Access Journals (Sweden)

    John Ashutosh Santoshi

    2014-01-01

    Full Text Available Introduction: Fractures have been described mainly following falling accidents in horse-related injuries. Horse bites are uncommon accidents. We present a case of open fracture of the forearm due to horse bite. Case Report: A 35-year-old male farm-worker presented to the emergency room with alleged history of horse bite to the right forearm about 2 hours prior to presentation while feeding the horse. There was deformity of the forearm with multiple puncture wounds, deep abrasions and small lacerations on the distal-third of the forearm. Copious irrigation with normal saline was done and he was administered anti-tetanus and post-exposure rabies prophylaxis. Prophylactic antibiotic therapy was commenced. Radiographs revealed fracture of radius and ulna in the mid-shaft region. He underwent emergency wound debridement, and the ulna was stabilised with an intra-medullary square nail. Seventy-two hours later, he underwent re-debridement and conversion osteosynthesis. He had an uneventful recovery and at three-month follow-up, the fractures had healed radiographically in anatomic alignment. At two-year follow-up, he is doing well, is pain free and has a normal range of motion compared to the contralateral side. Conclusion: Horse bites behave as compound fractures however rabies prophylaxis will be needed and careful observation is needed. Early radical debridement, preliminary skeletal stabilisation, re-debridement and conversion osteosynthesis to plate, and antibiotic prophylaxis were the key to the successful management of our patient. Keywords: Horse; animal bite; forearm; open fracture

  7. Bite force evaluation in subjects with cleft lip and palate

    Directory of Open Access Journals (Sweden)

    Carla Renata Sipert

    2009-04-01

    Full Text Available The purpose of this study was to evaluate the masticatory function of subjects with cleft lip and palate by analyzing the bite force developed by these individuals. Bite force was evaluated in a group of 27 individuals with repaired unilateral cleft lip and palate (14 males and 13 females - aged 18-26 years and compared to the data achieved from a group of 20 noncleft subjects (10 males and 10 females - aged 18-26 years. Measurement was achieved on three positions within the dental arch (incisors, right molars and left molars, three times at each position considering the highest value for each one. Statistical analysis was performed by ANOVA and Mann-Whitney test ( α = 5%. There was a significant deficit in bite force in male individuals with cleft lip and palate compared to the male control group (p=0.02, p=0.004, p=0.003 for incisors, right and left molars, respectively. For the female group, the difference was not statistically significant (p=0.79, p=0.06, p=0.47. In the group of individuals with clefts, 92.6% were under orthodontic treatment, which could be a reason for the present findings, since it can decrease the bite force more remarkably in males than in females. In conclusion, the bite force is significantly reduced in men when comparing the cleft group to the noncleft group. In females, this reduction was not significant in the same way. However, the main reason for this reduction and for the different behavior between genders should be further investigated.

  8. Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

    Science.gov (United States)

    Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2010-01-01

    There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

  9. Invited review current progress and limitations of spider silk for biomedical applications.

    Science.gov (United States)

    Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

    2012-06-01

    Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

  10. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Jun Wang

    2018-01-01

    Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

  11. Plastic material investment in load-bearing silk attachments in spiders.

    Science.gov (United States)

    Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

    2018-05-17

    The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

  12. Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

    Science.gov (United States)

    Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

    2013-10-01

    This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

  13. Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

    Science.gov (United States)

    Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

    2015-11-01

    The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

    Science.gov (United States)

    Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

    2003-12-01

    Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

  15. [Comparison of bite marks and teeth features using 2D and 3D methods].

    Science.gov (United States)

    Lorkiewicz-Muszyńska, Dorota; Glapiński, Mariusz; Zaba, Czesław; Łabecka, Marzena

    2011-01-01

    The nature of bite marks is complex. They are found at the scene of crime on different materials and surfaces - not only on human body and corpse, but also on food products and material objects. Human bites on skin are sometimes difficult to interpret and to analyze because of the specific character of skin--elastic and distortable--and because different areas of human body have different surfaces and curvatures. A bite mark left at the scene of crime can be a highly helpful way to lead investigators to criminals. The study was performed to establish: 1) whether bite marks exhibit variations in the accuracy of impressions on different materials, 2) whether it is possible to use the 3D method in the process of identifying an individual based on the comparison of bite marks revealed at the scene, and 3D scans of dental casts, 3) whether application of the 3D method allows for elimination of secondary photographic distortion of bite marks. The authors carried out experiments on simulated cases. Five volunteers bit various materials with different surfaces. Experimental bite marks were collected with emphasis on differentiations of materials. Subsequently, dental impressions were taken from five volunteers in order to prepare five sets of dental casts (the maxilla and mandible. The biting edges of teeth were impressed in wax to create an imprint. The samples of dental casts, corresponding wax bite impressions and bite marks from different materials were scanned with 2D and 3D scanners and photographs were taken. All of these were examined in detail and then compared using different methods (2D and 3D). 1) Bite marks exhibit variations in accuracy of impression on different materials. The most legible reproduction of bite marks was seen on cheese. 2) In comparison of bite marks, the 3D method and 3D scans of dental casts are highly accurate. 3) The 3D method helps to eliminate secondary photographic distortion of bite marks.

  16. Ontogenesis, gender, and molting influence the venom yield in the spider Coremiocnemis tropix (Araneae, Theraphosidae)

    OpenAIRE

    Herzig, Volker

    2010-01-01

    The demand for spider venom increases along with the growing popularity of venoms-based research. A deeper understanding of factors that influence the venom yield in spiders would therefore be of interest to both commercial venom suppliers and research facilities. The present study addresses the influence of several factors on the venom yield by systematically analyzing the data obtained from 1773 electrical milkings of the Australian theraphosid spider Coremiocnemis tropix. Gender and ontoge...

  17. Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    OpenAIRE

    Farzana Perveen; Numan Khan

    2015-01-01

    The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

  18. Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

    Science.gov (United States)

    Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

    2016-01-01

    Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

  19. Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Perveen

    2015-09-01

    Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

  20. Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape.

    Science.gov (United States)

    Hogg, Brian N; Daane, Kent M

    2011-03-01

    The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.

  1. The biting performance of Homo sapiens and Homo heidelbergensis.

    Science.gov (United States)

    Godinho, Ricardo Miguel; Fitton, Laura C; Toro-Ibacache, Viviana; Stringer, Chris B; Lacruz, Rodrigo S; Bromage, Timothy G; O'Higgins, Paul

    2018-05-01

    Modern humans have smaller faces relative to Middle and Late Pleistocene members of the genus Homo. While facial reduction and differences in shape have been shown to increase biting efficiency in Homo sapiens relative to these hominins, facial size reduction has also been said to decrease our ability to resist masticatory loads. This study compares crania of Homo heidelbergensis and H. sapiens with respect to mechanical advantages of masticatory muscles, force production efficiency, strains experienced by the cranium and modes of deformation during simulated biting. Analyses utilize X-ray computed tomography (CT) scan-based 3D models of a recent modern human and two H. heidelbergensis. While having muscles of similar cross-sectional area to H. heidelbergensis, our results confirm that the modern human masticatory system is more efficient at converting muscle forces into bite forces. Thus, it can produce higher bite forces than Broken Hill for equal muscle input forces. This difference is the result of alterations in relative in and out-lever arm lengths associated with well-known differences in midfacial prognathism. Apparently at odds with this increased efficiency is the finding that the modern human cranium deforms more, resulting in greater strain magnitudes than Broken Hill when biting at the equivalent tooth. Hence, the facial reduction that characterizes modern humans may not have evolved as a result of selection for force production efficiency. These findings provide further evidence for a degree of uncoupling between form and function in the masticatory system of modern humans. This may reflect the impact of food preparation technologies. These data also support previous suggestions that differences in bite force production efficiency can be considered a spandrel, primarily driven by the midfacial reduction in H. sapiens that occurred for other reasons. Midfacial reduction plausibly resulted in a number of other significant changes in morphology, such

  2. Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

    Science.gov (United States)

    Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

    2008-06-01

    The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

  3. Biased interpretation and memory in children with varying levels of spider fear.

    Science.gov (United States)

    Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

  4. Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)

    2005-09-01

    Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

  5. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1981-01-01

    A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

  6. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

    Science.gov (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

    2014-09-10

    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  7. Risk of spider predation alters food web structure and reduces local herbivory in the field.

    Science.gov (United States)

    Bucher, Roman; Menzel, Florian; Entling, Martin H

    2015-06-01

    Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

  8. Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution.

    Science.gov (United States)

    Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A

    2015-06-08

    The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  9. Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

    Science.gov (United States)

    Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

    2017-06-01

    Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  10. A comparison of spider communities in Bt and non-Bt rice fields.

    Science.gov (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

    2014-06-01

    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  11. Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

    Directory of Open Access Journals (Sweden)

    I WAYAN SUANA

    2009-03-01

    Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

  12. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds

    Science.gov (United States)

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell superfund site (Clemson, SC , USA). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upla...

  13. Biting behaviour of African malaria vectors: 1. where do the main vector species bite on the human body?

    Science.gov (United States)

    Braack, Leo; Hunt, Richard; Koekemoer, Lizette L; Gericke, Anton; Munhenga, Givemore; Haddow, Andrew D; Becker, Piet; Okia, Michael; Kimera, Isaac; Coetzee, Maureen

    2015-02-04

    Malaria control in Africa relies heavily on indoor vector management, primarily indoor residual spraying and insecticide treated bed nets. Little is known about outdoor biting behaviour or even the dynamics of indoor biting and infection risk of sleeping household occupants. In this paper we explore the preferred biting sites on the human body and some of the ramifications regarding infection risk and exposure management. We undertook whole-night human landing catches of Anopheles arabiensis in South Africa and Anopheles gambiae s.s. and Anopheles funestus in Uganda, for seated persons wearing short sleeve shirts, short pants, and bare legs, ankles and feet. Catches were kept separate for different body regions and capture sessions. All An. gambiae s.l. and An. funestus group individuals were identified to species level by PCR. Three of the main vectors of malaria in Africa (An. arabiensis, An. gambiae s.s. and An. funestus) all have a preference for feeding close to ground level, which is manifested as a strong propensity (77.3% - 100%) for biting on lower leg, ankles and feet of people seated either indoors or outdoors, but somewhat randomly along the lower edge of the body in contact with the surface when lying down. If the lower extremities of the legs (below mid-calf level) of seated people are protected and therefore exclude access to this body region, vector mosquitoes do not move higher up the body to feed at alternate body sites, instead resulting in a high (58.5% - 68.8%) reduction in biting intensity by these three species. Protecting the lower limbs of people outdoors at night can achieve a major reduction in biting intensity by malaria vector mosquitoes. Persons sleeping at floor level bear a disproportionate risk of being bitten at night because this is the preferred height for feeding by the primary vector species. Therefore it is critical to protect children sleeping at floor level (bednets; repellent-impregnated blankets or sheets, etc

  14. Impact of first aid training in management of snake bite victims in Madi valley.

    Science.gov (United States)

    Pandey, D P; Thapa, C L; Hamal, P K

    2010-04-01

    Tropical lowland on Nepal is at full of risk to snake bite. The snake bite mortality is due to lack of awareness about proper management of victims. The study aims to assess the change in the pattern of management of snake bite victims after first aid training. A retrospective study was done from October 2007 to October 2008 among 43 snake bite victims in rural Madi valley comprising of 4 village development committees where first aid training was conducted one year before. Only 26% of the snake bite victims approached traditional healer before arriving at the heath facility. The case fatality rate dropped to 22% after venomous snake bite. Pressure Immobilization bandaging and local compression pad immobilization technique was used by 56% who went to the health facility. Mean duration for reaching health facility was 61.51±33.55 minutes. Common places of bite were field 16 (37.2%), Indoor 6 (14%), while sleeping 6 (14%), and yard 6 (14%). Lower extremity bites were 32 (74.4%), upper extremity 8 (18.6%) and head 3 (7%). Bicycle was the commonest mode of transport 22 (51%) followed by ambulance 9(27.9%) and Motorcycle 6 (11%). First aid training changes the attitude of the people in management of snake bite victims and is one of the effective ways in decreasing mortality. Nationwide campaigning should be done especially at snake bite prone area about the proper first aid technique to improve the awareness level of the general population.

  15. A new bite block for panoramic radiographs of anterior edentulous patients: A technical report.

    Science.gov (United States)

    Park, Jong-Woong; Symkhampha, Khanthaly; Huh, Kyung-Hoe; Yi, Won-Jin; Heo, Min-Suk; Lee, Sam-Sun; Choi, Soon-Chul

    2015-06-01

    Panoramic radiographs taken using conventional chin-support devices have often presented problems with positioning accuracy and reproducibility. The aim of this report was to propose a new bite block for panoramic radiographs of anterior edentulous patients that better addresses these two issues. A new panoramic radiography bite block similar to the bite block for dentulous patients was developed to enable proper positioning stability for edentulous patients. The new bite block was designed and implemented in light of previous studies. The height of the new bite block was 18 mm and to compensate for the horizontal edentulous space, its horizontal width was 7 mm. The panoramic radiographs using the new bite block were compared with those using the conventional chin-support device. Panoramic radiographs taken with the new bite block showed better stability and bilateral symmetry than those taken with the conventional chin-support device. Patients also showed less movement and more stable positioning during panoramic radiography with the new bite block. Conventional errors in panoramic radiographs of edentulous patients could be caused by unreliability of the chin-support device. The newly proposed bite block for panoramic radiographs of edentulous patients showed better reliability. Further study is required to evaluate the image quality and reproducibility of images with the new bite block.

  16. Battre sa (super) coulpe : Spider-Man (1962)

    OpenAIRE

    Tomasovic, Dick

    2016-01-01

    L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

  17. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards

    2000-01-01

    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  18.  “Spiders and Webs in American Literature”

    Directory of Open Access Journals (Sweden)

    Vincent Dussol

    2012-05-01

    Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

  19. Gravity Reception and Cardiac Function in the Spider

    Science.gov (United States)

    Finck, A.

    1985-01-01

    The following features of the arachnid gravity system were studied. (1) the absolute threshold to hyper-gz is quite low indicating fine proprioreceptive properties of the lyriform organ, the Gz/vibration detector; (2) the neurogenic heart of the spider is a good dependent variable for assessing its behavior to Gz and other stimuli which produce mechanical effects on the exoskeleton; (3) Not only is the cardiac response useful but it is now understood to be an integral part of the system which compensates for the consequences of gravity in the spider (an hydraulic leg extension); and (4) a theoretical model was proposed in which a mechanical amplifier, the leg lever, converts a weak force (at the tarsus) to a strong force (at the patella), capable of compressing the exoskeleton and consequently the lyriform receptor.

  20. Environmental Engineering Approaches toward Sustainable Management of Spider Mites.

    Science.gov (United States)

    Suzuki, Takeshi

    2012-10-26

    Integrated pest management (IPM), which combines physical, biological, and chemical control measures to complementary effect, is one of the most important approaches to environmentally friendly sustainable agriculture. To expand IPM, we need to develop new pest control measures, reinforce existing measures, and investigate interactions between measures. Continued progress in the development of environmental control technologies and consequent price drops have facilitated their integration into plant production and pest control. Here I describe environmental control technologies for the IPM of spider mites through: (1) the disturbance of photoperiod-dependent diapause by artificial light, which may lead to death in seasonal environments; (2) the use of ultraviolet radiation to kill or repel mites; and (3) the use of water vapor control for the long-term cold storage of commercially available natural enemies. Such environmental control technologies have great potential for the efficient control of spider mites through direct physical effects and indirect effects via natural enemies.

  1. Prey capture by the crab spider Misumena calycina (Araneae: Thomisidae).

    Science.gov (United States)

    Morse, Douglass H

    1979-01-01

    Crab spiders Misumena calycina (L.) in pasture rose Rosa carolina flowers regularly attacked bumble bees, smaller bees, and syrphid flies that visited these flowers. Attacks reached a maximum rate of over 20/h during mid morning, but only 1.6% of the most important prey item, bumble bees, were captured. The next most important food source, the most frequently taken item, syrphid flies Toxomerus marginatus (Say), were captured in 39% of the attempts. Since these flies have a biomass only 1/60th that of bumble bees, they comprised a much less important food source than did bumble bees. Spiders would obtain over 7% more food by specializing on bumble bees than by attacking all insect visitors, and as much as 20% more food at certain times of the day. However, they did not show a tendency to specialize at any time.

  2. Spatial distribution of Madeira Island Laurisilva endemic spiders (Arachnida: Araneae)

    Science.gov (United States)

    2014-01-01

    Abstract Madeira island presents a unique spider diversity with a high number of endemic species, many of which are still poorly known. A recent biodiversity survey on the terrestrial arthropods of the native forest, Laurisilva, provided a large set of standardized samples from various patches throughout the island. Out of the fifty two species recorded, approximately 33.3% are Madeiran endemics, many of which had not been collected since their original description. Two new species to science are reported – Ceratinopsis n. sp. and Theridion n. sp. – and the first records of Poeciloneta variegata (Blackwall, 1841) and Tetragnatha intermedia Kulczynski, 1891 are reported for the first time for Madeira island. Considerations on species richness and abundance from different Laurisilva locations are presented, together with distribution maps for endemic species. These results contribute to a better understanding of spider diversity patterns and endemic species distribution in the native forest of Madeira island. PMID:24855443

  3. Structure to function: Spider silk and human collagen

    Science.gov (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  4. Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

    International Nuclear Information System (INIS)

    Doroshin, Anton V.

    2010-01-01

    This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

  5. VIPR III VADR SPIDER Structural Design and Analysis

    Science.gov (United States)

    Li, Wesley; Chen, Tony

    2016-01-01

    In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

  6. Sexual Dimorphism in Bite Performance Drives Morphological Variation in Chameleons

    Science.gov (United States)

    da Silva, Jessica M.; Herrel, Anthony; Measey, G. John; Tolley, Krystal A.

    2014-01-01

    Phenotypic performance in different environments is central to understanding the evolutionary and ecological processes that drive adaptive divergence and, ultimately, speciation. Because habitat structure can affect an animal’s foraging behaviour, anti-predator defences, and communication behaviour, it can influence both natural and sexual selection pressures. These selective pressures, in turn, act upon morphological traits to maximize an animal’s performance. For performance traits involved in both social and ecological activities, such as bite force, natural and sexual selection often interact in complex ways, providing an opportunity to understand the adaptive significance of morphological variation with respect to habitat. Dwarf chameleons within the Bradypodion melanocephalum-Bradypodion thamnobates species complex have multiple phenotypic forms, each with a specific head morphology that could reflect its use of either open- or closed-canopy habitats. To determine whether these morphological differences represent adaptations to their habitats, we tested for differences in both absolute and relative bite performance. Only absolute differences were found between forms, with the closed-canopy forms biting harder than their open-canopy counterparts. In contrast, sexual dimorphism was found for both absolute and relative bite force, but the relative differences were limited to the closed-canopy forms. These results indicate that both natural and sexual selection are acting within both habitat types, but to varying degrees. Sexual selection seems to be the predominant force within the closed-canopy habitats, which are more protected from aerial predators, enabling chameleons to invest more in ornamentation for communication. In contrast, natural selection is likely to be the predominant force in the open-canopy habitats, inhibiting the development of conspicuous secondary sexual characteristics and, ultimately, enforcing their overall diminutive body size and

  7. Human bite wounds: a swiss emergency department experience.

    Science.gov (United States)

    Tabbara, Malek; Hatzigianni, Panagiota; Fux, Christoph; Zimmermann, Heinz; Exadaktylos, Aristomenis K

    2012-04-01

     Human bites (HB) are the third most common bite wound diagnosed in emergency departments, after dog and cat bites. Management of HB can be challenging, given the high risk of infection associated with multiorganism-rich oral flora. Recognition and early aggressive treatment are essential steps in preventing infections and other associated complications. A retrospective, 10-year electronic chart review was performed, which identified 104 HB. Diagnosis, treatment, and outcome were noted for each case. Most of the patients were male, with a male:female ratio of 4:1. A majority of patients (n = 53, 51%) presented with finger and hand injuries. Only 13.8% were bitten on the head or neck, and 25% on the upper limbs. The remainder (35.2%) of patients sustained injuries to other body parts. Twelve operations were necessary and performed by plastic and hand surgeons. More than half of the patients (60.5%) received antibiotic therapy, and 84.6% of the patients had their tetanus prophylaxis administered or received a booster by the time of treatment. Only 40.4% of patients had a post-bite serology test to rule out bloodborne viral infections, none of whom tested positive. The viral status of the biter was known in two cases. The goals of HB management are to minimize infection risk and its complications, and to prevent the transmission of systemic infections, such as hepatitis B/C and HIV. Accurate documentation and a management algorithm should be instituted in emergency departments in order to achieve these goals. .

  8. SNAKE BITE WITH TOXIC DEMYELINATION – A CASE REPORT

    Directory of Open Access Journals (Sweden)

    Justin

    2016-02-01

    Full Text Available INTRODUCTION Snakebite is an important cause of mortality and morbidity in India. India has the highest number of deaths due to snake bite1 Neurotoxicity due to snakebite is well-known with varied presentation.2 Common cases of snakebites are of saw-scaled viper (Echis carinatus, Russell’s viper (a viperidae, krait (Bungarus caeruleus, common cobra (Naja naja king cobra (Ophiophagus hannah.3

  9. Stinging and biting insect allergy: an Australian experience.

    Science.gov (United States)

    Solley, Graham O

    2004-12-01

    Stings and bites from various insects are responsible for many anaphylactic events. To document the clinical features of specific forms of anaphylaxis and investigate clinical concerns regarding stinging and biting insect allergy. All patients presenting for evaluation of adverse reactions to insect stings or bites between December 1980 and December 1997 had the clinical details of their reactions recorded and their reactions classified. The spectrum of clinical symptoms and signs is similar to that seen in anaphylaxis from other sources; stings on the head or neck are not more likely to cause life-threatening reactions than stings elsewhere on the body; a lesser reaction will not necessarily lead to a more serious reaction from a future sting; asthmatic patients do appear to have an increased risk of asthma as a feature of their anaphylactic response; anaphylaxis is usually confined to a particular insect species for the individual patient; patients who have had multiple stings at one time may have experienced true anaphylaxis and not a "toxic" response; and patients who have had anaphylaxis from other sources are at no greater risk than that of the general population of reacting similarly to insect stings or bites. Anaphylactic events from insect stings show the same clinical features as those from other sources. Systemic reactions seem confined to a specific insect species. Patients who experience RXN3 reactions from multiple stings at one time should undergo specific venom testing, because many have experienced true anaphylaxis and not a toxic response. Future consideration should be given to the role of beta-adrenergic antagonists and ACE inhibitors in patients with systemic reactions.

  10. Sexual dimorphism in bite performance drives morphological variation in chameleons.

    Directory of Open Access Journals (Sweden)

    Jessica M da Silva

    Full Text Available Phenotypic performance in different environments is central to understanding the evolutionary and ecological processes that drive adaptive divergence and, ultimately, speciation. Because habitat structure can affect an animal's foraging behaviour, anti-predator defences, and communication behaviour, it can influence both natural and sexual selection pressures. These selective pressures, in turn, act upon morphological traits to maximize an animal's performance. For performance traits involved in both social and ecological activities, such as bite force, natural and sexual selection often interact in complex ways, providing an opportunity to understand the adaptive significance of morphological variation with respect to habitat. Dwarf chameleons within the Bradypodion melanocephalum-Bradypodion thamnobates species complex have multiple phenotypic forms, each with a specific head morphology that could reflect its use of either open- or closed-canopy habitats. To determine whether these morphological differences represent adaptations to their habitats, we tested for differences in both absolute and relative bite performance. Only absolute differences were found between forms, with the closed-canopy forms biting harder than their open-canopy counterparts. In contrast, sexual dimorphism was found for both absolute and relative bite force, but the relative differences were limited to the closed-canopy forms. These results indicate that both natural and sexual selection are acting within both habitat types, but to varying degrees. Sexual selection seems to be the predominant force within the closed-canopy habitats, which are more protected from aerial predators, enabling chameleons to invest more in ornamentation for communication. In contrast, natural selection is likely to be the predominant force in the open-canopy habitats, inhibiting the development of conspicuous secondary sexual characteristics and, ultimately, enforcing their overall diminutive

  11. Sexual dimorphism in bite performance drives morphological variation in chameleons.

    Science.gov (United States)

    da Silva, Jessica M; Herrel, Anthony; Measey, G John; Tolley, Krystal A

    2014-01-01

    Phenotypic performance in different environments is central to understanding the evolutionary and ecological processes that drive adaptive divergence and, ultimately, speciation. Because habitat structure can affect an animal's foraging behaviour, anti-predator defences, and communication behaviour, it can influence both natural and sexual selection pressures. These selective pressures, in turn, act upon morphological traits to maximize an animal's performance. For performance traits involved in both social and ecological activities, such as bite force, natural and sexual selection often interact in complex ways, providing an opportunity to understand the adaptive significance of morphological variation with respect to habitat. Dwarf chameleons within the Bradypodion melanocephalum-Bradypodion thamnobates species complex have multiple phenotypic forms, each with a specific head morphology that could reflect its use of either open- or closed-canopy habitats. To determine whether these morphological differences represent adaptations to their habitats, we tested for differences in both absolute and relative bite performance. Only absolute differences were found between forms, with the closed-canopy forms biting harder than their open-canopy counterparts. In contrast, sexual dimorphism was found for both absolute and relative bite force, but the relative differences were limited to the closed-canopy forms. These results indicate that both natural and sexual selection are acting within both habitat types, but to varying degrees. Sexual selection seems to be the predominant force within the closed-canopy habitats, which are more protected from aerial predators, enabling chameleons to invest more in ornamentation for communication. In contrast, natural selection is likely to be the predominant force in the open-canopy habitats, inhibiting the development of conspicuous secondary sexual characteristics and, ultimately, enforcing their overall diminutive body size and

  12. An Unusual Case of Bilateral Vitreous Haemorrhage following Snake Bite

    Directory of Open Access Journals (Sweden)

    Vipul Bhandari

    2013-01-01

    Full Text Available A-45-year-old man presented to us with diminution of vision in both eye following snake bite. On examination vision in the right eye (RE was 6/36 and vision in left eye (LE was hand movement positive and fundus examination revealed a subhyloid haemorrhage, left eye showed vitreous haemorrhage. Patient was advised bed rest, vitamin C tablets and oral steroids.

  13. [Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

    Science.gov (United States)

    Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

    1992-07-25

    We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

  14. A troglomorphic spider from Java (Araneae, Ctenidae, Amauropelma)

    Science.gov (United States)

    Miller, Jeremy; Rahmadi, Cahyo

    2012-01-01

    Abstract A new troglomorphic spider from caves in Central Java, Indonesia, is described and placed in the ctenid genus Amauropelma Raven, Stumkat & Gray, until now containing only species from Queensland, Australia. Only juveniles and mature females of the new species are known. We give our reasons for placing the new species in Amauropelma, discuss conflicting characters, and make predictions about the morphology of the as yet undiscovered male that will test our taxonomic hypothesis. The description includes DNA barcode sequence data. PMID:22303127

  15. Signal conflict in spider webs driven by predators and prey

    OpenAIRE

    Blackledge, T. A.

    1998-01-01

    Variation in the sensory physiologies of organisms can bias the receptions of signals, driving the direction of signal evolution. Sensory drive in the evolution of signals may be particularly important for organisms that confront trade-offs in signal design between the need for conspicuousness to allow effective transfer of information and the need for crypsis of the signal to unintended receivers. Several genera of orb-weaving spiders include conspicuous silk designs, stabilimenta, in the ce...

  16. On the colours of spider orb-webs

    Energy Technology Data Exchange (ETDEWEB)

    Suhr, Wilfried; Schlichting, H Joachim, E-mail: wilfried.suhr@uni-muenster.de, E-mail: schlichting@uni-muenster.de [Institut fuer Didaktik der Physik, University of Muenster, 48149 Muenster (Germany)

    2011-03-15

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

  17. The effect of age on encounters between male crab spiders

    OpenAIRE

    Helen H. Hu; Douglass H. Morse

    2004-01-01

    In males that compete aggressively for females, size and age may determine which males obtain access to these females. In the present study, we use the crab spider, Misumena vatia, a species with males that do not grow after becoming sexually mature adults, to test the hypothesis that age affects the success of males competing for access to females. M. vatia is an excellent species to test this hypothesis because it is possible to disentangle age from size, characters that typically vary toge...

  18. Antenna-coupled TES bolometers for the SPIDER experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, C.L. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States)]. E-mail: clkuo@astro.caltech.edu; Ade, P. [University of Wales, Cardiff, 5 The Parade, Cardiff, CF24 3YB, Wales (United Kingdom); Bock, J.J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Day, P. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Goldin, A.; Golwala, S.; Hristov, V.; Jones, W.C.; Lange, A.E.; Rossinot, P.; Vayonakis, A.; Wang, G. [California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States); Halpern, M. [University of British Columbia, 2329 West Mall, Vancouver, BC, V6T 1Z4 (Canada); Hilton, G.; Irwin, K. [National Institute of Standards and Technology, 325 Broadway, Boulder, CO (United States); Holmes, W.; Kenyon, M.; LeDuc, H.G. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); MacTavish, C. [University of Toronto, 60 St. George Street, Toronto, ON, M5S 1A7 (Canada); Montroy, T.; Ruhl, J. [Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Netterfield, C.B. [University of Toronto, 60 St. George Street, Toronto, ON, M5S 1A7 (Canada); Yun, M. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[University of Pittsburgh, 348 Benedum Engineering Hall, Pittsburgh, PA 15261 (United States); Zmuidzinas, J. [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States)]|[California Institute of Technology, 1200 E California Boulevard, Pasadena, CA 91125 (United States)

    2006-04-15

    SPIDER is a proposed balloon-borne experiment designed to search for the imprints of gravity waves on the polarization of the cosmic microwave background radiation. The required wide frequency coverage, large number of sensitive detectors, and the stringent power constraints on a balloon are made possible by antenna-coupled TES bolometers. Several prototype devices have been fabricated and optically characterized. Their spectral and angular responses agree well with the theoretical expectations.

  19. Innate pattern recognition and categorization in a jumping spider.

    Directory of Open Access Journals (Sweden)

    Yinnon Dolev

    Full Text Available The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli--abstract 'stick figure' representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals.

  20. Reproductive Seasonality in Nesticus (Araneae: Nesticidae) Cave Spiders.

    Science.gov (United States)

    Carver, Linnea M; Perlaky, Patricia; Cressler, Alan; Zigler, Kirk S

    2016-01-01

    Spiders of the family Nesticidae are members of cave communities around the world with cave-obligate (troglobiotic) species known from North America, Europe, Asia and the Indo-Pacific. A radiation of Nesticus (Araneae: Nesticidae) in the southern Appalachians includes ten troglobiotic species. Many of these species are of conservation interest due to their small ranges, with four species being single-cave endemics. Despite conservation concerns and their important role as predators in cave communities, we know little about reproduction and feeding in this group. We addressed this knowledge gap by examining populations of two species on a monthly basis for one year. We made further observations on several other species and populations, totaling 671 individual spider observations. This more than doubled the reported observations of reproduction and feeding in troglobiotic Nesticus. Female Nesticus carry egg sacs, facilitating the determination of the timing and frequency of reproduction. We found that Nesticus exhibit reproductive seasonality. Females carried egg sacs from May through October, with a peak in frequency in June. These spiders were rarely observed with prey; only 3.3% (22/671) of individuals were observed with prey items. The frequency at which prey items were observed did not vary by season. Common prey items were flies, beetles and millipedes. Troglobiotic species constituted approximately half of all prey items observed. This result represents a greater proportion of troglobiotic prey than has been reported for various troglophilic spiders. Although our findings shed light on the life history of troglobiotic Nesticus and on their role in cave ecosystems, further work is necessary to support effective conservation planning for many of these rare species.