WorldWideScience

Sample records for rbs rbs shows

  1. RbsR Activates Capsule but Represses the rbsUDK Operon in Staphylococcus aureus.

    Science.gov (United States)

    Lei, Mei G; Lee, Chia Y

    2015-12-01

    Staphylococcus aureus capsule is an important virulence factor that is regulated by a large number of regulators. Capsule genes are expressed from a major promoter upstream of the cap operon. A 10-bp inverted repeat (IR) located 13 bp upstream of the -35 region of the promoter was previously shown to affect capsule gene transcription. However, little is known about transcriptional activation of the cap promoter. To search for potential proteins which directly interact with the cap promoter region (Pcap), we directly analyzed the proteins interacting with the Pcap DNA fragment from shifted gel bands identified by electrophoretic mobility shift assay. One of these regulators, RbsR, was further characterized and found to positively regulate cap gene expression by specifically binding to the cap promoter region. Footprinting analyses showed that RbsR protected a DNA region encompassing the 10-bp IR. Our results further showed that rbsR was directly controlled by SigB and that RbsR was a repressor of the rbsUDK operon, involved in ribose uptake and phosphorylation. The repression of rbsUDK by RbsR could be derepressed by D-ribose. However, D-ribose did not affect RbsR activation of capsule. Staphylococcus aureus is an important human pathogen which produces a large number of virulence factors. We have been using capsule as a model virulence factor to study virulence regulation. Although many capsule regulators have been identified, the mechanism of regulation of most of these regulators is unknown. We show here that RbsR activates capsule by direct promoter binding and that SigB is required for the expression of rbsR. These results define a new pathway wherein SigB activates capsule through RbsR. Our results further demonstrate that RbsR inhibits the rbs operon involved in ribose utilization, thereby providing an example of coregulation of metabolism and virulence in S. aureus. Thus, this study further advances our understanding of staphylococcal virulence regulation

  2. RBS analysis of electrochromic layers

    Energy Technology Data Exchange (ETDEWEB)

    Green, D C; Bell, J M [University of Technology, Sydney, NSW (Australia); Kenny, M J; Wielunski, L S [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics

    1994-12-31

    Tungsten oxide thin films produced by dip-coating from tungsten alkoxide solutions are of interest for their application in large area switchable windows. The application consists of a layer of electrochromic tungsten oxide (W0{sub 3}) on indium tin oxide (ITO) coated glass in contact with a complementary structure. Electrochromic devices are switchable between states of high and low transparency by the application of a small voltage. The mechanism relies on the dual injection of ions and electrons into the W0{sub 3} layer from adjacent layers in the device. Electrochromic tungsten oxide can be deposited using standard techniques (eg. sputtering and evaporation) but also using sol-gel deposition. Sol-gel processing has an advantage over conventional preparation techniques because of the simplicity of the equipment. The scaling up to large area coatings is also feasible. RBS and forward recoil has been used to obtain profiles for individual elements in the structure of electrochromic films. 3 refs., 3 figs.

  3. RBS analysis of electrochromic layers

    Energy Technology Data Exchange (ETDEWEB)

    Green, D.C.; Bell, J.M. [University of Technology, Sydney, NSW (Australia); Kenny, M.J.; Wielunski, L.S. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Div. of Applied Physics

    1993-12-31

    Tungsten oxide thin films produced by dip-coating from tungsten alkoxide solutions are of interest for their application in large area switchable windows. The application consists of a layer of electrochromic tungsten oxide (W0{sub 3}) on indium tin oxide (ITO) coated glass in contact with a complementary structure. Electrochromic devices are switchable between states of high and low transparency by the application of a small voltage. The mechanism relies on the dual injection of ions and electrons into the W0{sub 3} layer from adjacent layers in the device. Electrochromic tungsten oxide can be deposited using standard techniques (eg. sputtering and evaporation) but also using sol-gel deposition. Sol-gel processing has an advantage over conventional preparation techniques because of the simplicity of the equipment. The scaling up to large area coatings is also feasible. RBS and forward recoil has been used to obtain profiles for individual elements in the structure of electrochromic films. 3 refs., 3 figs.

  4. RBS using {sup 28}Si beams

    Energy Technology Data Exchange (ETDEWEB)

    Ophel, T.R. [Australian National Univ., Canberra, ACT (Australia); Mitchell, I.V. [University of Western Ontario, London, ON (Canada). Dept. of Physics

    1996-12-31

    Measurements of RBS using {sup 28}Si beams have been made to evaluate the enhancement of sensitivity that should obtain from kinematic suppression of silicon substrate scattering. Two detection methods were tried. Aside from a surface barrier detector, a magnetic spectrometer, instrumented with a multi-electrode gas focal plane detector, was used to indicate the resolution attainable with low energy {sup 28}Si ions. The results confirm that kinematically suppressed RBS does provide greatly improved sensitivity. 5 refs., 2 figs.

  5. RBS using {sup 28}Si beams

    Energy Technology Data Exchange (ETDEWEB)

    Ophel, T R [Australian National Univ., Canberra, ACT (Australia); Mitchell, I V [University of Western Ontario, London, ON (Canada). Dept. of Physics

    1997-12-31

    Measurements of RBS using {sup 28}Si beams have been made to evaluate the enhancement of sensitivity that should obtain from kinematic suppression of silicon substrate scattering. Two detection methods were tried. Aside from a surface barrier detector, a magnetic spectrometer, instrumented with a multi-electrode gas focal plane detector, was used to indicate the resolution attainable with low energy {sup 28}Si ions. The results confirm that kinematically suppressed RBS does provide greatly improved sensitivity. 5 refs., 2 figs.

  6. Surface analysis by RBS and NRA

    International Nuclear Information System (INIS)

    Braun, M.

    1984-01-01

    The use of Rutherford backscattering spectroscopy (RBS) and nuclear reaction analysis (NRA) for surface analysis is discussed. For the RBS technique, emphasis is laid on cases which are not discussed in existing review articles of the subject. The present work intends to describe a calculation procedure with the aid of which it is possible to obtain the depth distribution of a high concentration and non-homogeneously binary compound sample. This complicates the determination of the stopping and scattering cross-sections of the incoming particles at a certain depth below the surface. In addition, a method is described by which the thickness and composition of a two-element film, deposited on a single-element substrate, can be determined by RBS. One advantage with the method presented here is that it is not necessary to detect any signals from the lighter component of the film, in order to determine the composition. This improves the RBS technique to study light elements in connection with thin layers. Finally, the NRA method to measure concentration distributions of deuterium beneath a surface is presented. In the case discussed here, the analysis is done by the D( 3 He, H) 4 He nuclear reaction. (author)

  7. RBS Characterization of Yttrium Iron Garnet Thin Films

    International Nuclear Information System (INIS)

    Roumie, M; Abdel samad, B.

    2008-01-01

    Magnetic materials such as yttrium iron garnet (YIG) are of great importance for its magneto-optic properties and for their potential applications in the domain of optical telecommunications. The deposition of thin films of YIG, on quartz or GGG (gadolinium gallium garnet) substrate, was performed using radio frequency non reactive magnetron sputtering, followed by high temperature annealing which is needed to enhance the crystallinity of the layers. Rutherford backscattering spectrometry RBS was used to determine the thickness and stoichiometry of the performed layers in order to investigate correlations between growth conditions and the quality of the final material. RBS measurements showed the influence of the deposition time and the temperature substrate on the film growth and its stoichiometry. (author)

  8. Advanced capabilities and applications of a sputter-RBS system

    International Nuclear Information System (INIS)

    Brijs, B.; Deleu, J.; Beyer, G.; Vandervorst, W.

    1999-01-01

    In previous experiments, sputter-RBS 1 has proven to be an ideal tool to study the interaction of low energy ions. This contribution employs the same methodology to identify surface contamination induced during sputtering and to the determine absolute sputter yields. In the first experiment ERDA analysis was used to study the evolution of Hydrogen contamination during sputter-RBS experiments. Since the determination of Hydrogen concentration in very thin near surface layers is frequently limited by the presence of a strong surface peak of Hydrogen originating from adsorbed contamination of the residual vacuum, removal of this contamination would increase the sensitivity for Hydrogen detection in the near sub surface drastically. Therefore low energy (12 keV) Argon sputtering was used to remove the Hydrogen surface peak. However enhanced Hydrogen adsorption was observed related to the Ar dose. This experiment shows that severe vacuum conditions and the use of high current densities/sputter yields are a prerequisite for an efficient detection of Hydrogen in the near surface layers. In the second experiment, an attempt was made to determine the sputter yield of Cu during low energy (12 keV) Oxygen bombardment. In order to determine the accumulated dose of the low energy ion beam, a separate Faraday cup in combination with a remote controlled current have been added to the existing sputter-RBS set-up. Alternating sputtering and RBS analysis seem to be an adequate tool for the determination of the absolute sputter yield of Cu and this as well in the as under steady state conditions

  9. Analysis of kidney stones by PIXE and RBS techniques

    International Nuclear Information System (INIS)

    Alkofai, M.M.; Hallak, A.B.

    1995-01-01

    Human kidney stones were analyzed by PIXE and RBS techniques using 2 MeV He ++ beam. The stones were found to contain the elements: C, N, O, F, Na, Mg, Si, P, S, Cl, K, Ca, Fe and Br. Results obtained by PIXE agree with the results obtained by RBS within experimental errors. A Mechanism for the formation of the kidney stones is suggested. 3 figs., 1 tab

  10. Analysis of kidney stones by PIXE and RBS techniques

    Energy Technology Data Exchange (ETDEWEB)

    Alkofai, M M [Physics Dept., Yarmouk University, Irbid, (Jordan); Hallak, A B [Research Institute, King Fahd University of Petroleum and Minerals, Dhahran 31261, (Saudi Arabia)

    1995-10-01

    Human kidney stones were analyzed by PIXE and RBS techniques using 2 MeV He{sup ++} beam. The stones were found to contain the elements: C, N, O, F, Na, Mg, Si, P, S, Cl, K, Ca, Fe and Br. Results obtained by PIXE agree with the results obtained by RBS within experimental errors. A Mechanism for the formation of the kidney stones is suggested. 3 figs., 1 tab.

  11. Determination of accurate metal silicide layer thickness by RBS

    International Nuclear Information System (INIS)

    Kirchhoff, J.F.; Baumann, S.M.; Evans, C.; Ward, I.; Coveney, P.

    1995-01-01

    Rutherford Backscattering Spectrometry (RBS) is a proven useful analytical tool for determining compositional information of a wide variety of materials. One of the most widely utilized applications of RBS is the study of the composition of metal silicides (MSi x ), also referred to as polycides. A key quantity obtained from an analysis of a metal silicide is the ratio of silicon to metal (Si/M). Although compositional information is very reliable in these applications, determination of metal silicide layer thickness by RBS techniques can differ from true layer thicknesses by more than 40%. The cause of these differences lies in how the densities utilized in the RBS analysis are calculated. The standard RBS analysis software packages calculate layer densities by assuming each element's bulk densities weighted by the fractional atomic presence. This calculation causes large thickness discrepancies in metal silicide thicknesses because most films form into crystal structures with distinct densities. Assuming a constant layer density for a full spectrum of Si/M values for metal silicide samples improves layer thickness determination but ignores the underlying physics of the films. We will present results of RBS determination of the thickness various metal silicide films with a range of Si/M values using a physically accurate model for the calculation of layer densities. The thicknesses are compared to scanning electron microscopy (SEM) cross-section micrographs. We have also developed supporting software that incorporates these calculations into routine analyses. (orig.)

  12. Rbs1, a new protein implicated in RNA polymerase III biogenesis in yeast Saccharomyces cerevisiae.

    Science.gov (United States)

    Cieśla, Małgorzata; Makała, Ewa; Płonka, Marta; Bazan, Rafał; Gewartowski, Kamil; Dziembowski, Andrzej; Boguta, Magdalena

    2015-04-01

    Little is known about the RNA polymerase III (Pol III) complex assembly and its transport to the nucleus. We demonstrate that a missense cold-sensitive mutation, rpc128-1007, in the sequence encoding the C-terminal part of the second largest Pol III subunit, C128, affects the assembly and stability of the enzyme. The cellular levels and nuclear concentration of selected Pol III subunits were decreased in rpc128-1007 cells, and the association between Pol III subunits as evaluated by coimmunoprecipitation was also reduced. To identify the proteins involved in Pol III assembly, we performed a genetic screen for suppressors of the rpc128-1007 mutation and selected the Rbs1 gene, whose overexpression enhanced de novo tRNA transcription in rpc128-1007 cells, which correlated with increased stability, nuclear concentration, and interaction of Pol III subunits. The rpc128-1007 rbs1Δ double mutant shows a synthetic growth defect, indicating that rpc128-1007 and rbs1Δ function in parallel ways to negatively regulate Pol III assembly. Rbs1 physically interacts with a subset of Pol III subunits, AC19, AC40, and ABC27/Rpb5. Additionally, Rbs1 interacts with the Crm1 exportin and shuttles between the cytoplasm and nucleus. We postulate that Rbs1 binds to the Pol III complex or subcomplex and facilitates its translocation to the nucleus. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  13. Computer simulation of RBS spectra from samples with surface roughness

    Energy Technology Data Exchange (ETDEWEB)

    Malinský, P., E-mail: malinsky@ujf.cas.cz [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic, v. v. i., 250 68 Rez (Czech Republic); Department of Physics, Faculty of Science, J. E. Purkinje University, Ceske mladeze 8, 400 96 Usti nad Labem (Czech Republic); Hnatowicz, V., E-mail: hnatowicz@ujf.cas.cz [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic, v. v. i., 250 68 Rez (Czech Republic); Macková, A., E-mail: mackova@ujf.cas.cz [Nuclear Physics Institute of the Academy of Sciences of the Czech Republic, v. v. i., 250 68 Rez (Czech Republic); Department of Physics, Faculty of Science, J. E. Purkinje University, Ceske mladeze 8, 400 96 Usti nad Labem (Czech Republic)

    2016-03-15

    A fast code for the simulation of common RBS spectra including surface roughness effects has been written and tested on virtual samples comprising either a rough layer deposited on a smooth substrate or smooth layer deposited on a rough substrate and simulated at different geometries. The sample surface or interface relief has been described by a polyline and the simulated RBS spectrum has been obtained as the sum of many particular spectra from randomly chosen particle trajectories. The code includes several procedures generating virtual samples with random and regular (periodical) roughness. The shape of the RBS spectra has been found to change strongly with increasing sample roughness and an increasing angle of the incoming ion beam.

  14. Carbon buildup monitoring using RBS: Correlation with secondary electrons

    International Nuclear Information System (INIS)

    Aguilera, E.F.; Rosales, P.; Martinez-Quiroz, E.; Murillo, G.; Fernandez, M.C.

    2006-01-01

    The RBS technique is applied to solve the problem of on-line monitoring of the carbon deposited on a thin backed foil under ion bombardment. An iterative method is used to reliably extract quantities such as number of projectiles and target thickness in spite of beam energy changes and detector unstabilities. Experimental values for secondary electron yields are also deduced. Results are reported for the thickness variation of thin carbon foils bombarded with carbon ions of energies between 8.95 and 13 MeV. A linear correlation of this variation is found with both, the ion fluence at target and the number of secondary electrons emitted. The correlation exists even though a wide range of beam currents, beam energies and bombarding times was used during the experiment. The measured electron yields show evidence for a change in the emission process between the original foils and the deposited layer, possibly due to a texture change

  15. Proton RBS measurement of the oxygen in heavy-metal oxides

    International Nuclear Information System (INIS)

    Xie, T.; Ryan, S.R.; Fischbeck, H.J.

    1989-01-01

    Although the stoichoimetry of high-T c superconductors is often measured using alpha-particle RBS, the small Rutherford cross section for oxygen relative to the high-Z components makes a determination of the oxygen content difficult. Above 1 MeV, the cross section for proton backscattering from oxygen becomes significantly greater than the Rutherford cross section. Studies of proton backscattering in CuO between 0.6 and 2.0 MeV show that it is possible to measure the oxygen content of high-Z metal oxides. RBS simulations using the Bragg-rule stopping power consistently underestimate the low-energy yield. Scaling the stopping power by a linear function of energy to reduce loss at low energy improves the simulation in CuO, Cu and Au. This general result suggests that the standard RBS simulation procedure may omit some relevant physics. (orig.)

  16. RbsB (NTHI_0632) mediates quorum signal uptake in nontypeable Haemophilus influenzae strain 86-028NP.

    Science.gov (United States)

    Armbruster, Chelsie E; Pang, Bing; Murrah, Kyle; Juneau, Richard A; Perez, Antonia C; Weimer, Kristin E D; Swords, W Edward

    2011-11-01

    Nontypeable Haemophilus influenzae (NTHI) is a respiratory commensal and opportunistic pathogen, which persists within biofilms on airway mucosal surfaces. For many species, biofilm formation is impacted by quorum signalling. Our prior work shows that production of autoinducer-2 (AI-2) promotes biofilm development and persistence for NTHI 86-028NP. NTHI 86-028NP encodes an ABC transporter annotated as a ribose transport system that includes a protein (RbsB) with similarity to the Escherichia coli LsrB and Aggregatibacter actinomycetemcomitans RbsB proteins that bind AI-2. In this study, inactivation of rbsB significantly reduced uptake of AI-2 and the AI-2 precursor dihydroxypentanedione (DPD) by NTHI 86-028NP. Moreover, DPD uptake was not competitively inhibited by ribose or other pentose sugars. Transcript levels of rbsB increased in response to DPD and as bacteria approached stationary-phase growth. The NTHI 86-028NP rbsB mutant also formed biofilms with significantly reduced thickness and total biomass and reduced surface phosphorylcholine, similar to a luxS mutant. Infection studies revealed that loss of rbsB impaired bacterial persistence in the chinchilla middle ear, similar to our previous results with luxS mutants. Based on these data, we conclude that in NTHI 86-028NP, RbsB is a LuxS/AI-2 regulated protein that is required for uptake of and response to AI-2. © 2011 Blackwell Publishing Ltd.

  17. Various advanced capabilities of the RBS setup at IMEC

    International Nuclear Information System (INIS)

    Brijs, B.; Coster, W. de; Vandervorst, W.

    1992-01-01

    This article describes the various capabilities of the ion-beam analysis facility at IMEC which is designed to fulfill two needs. One is the high volume analysis service of material originating from the processing and material development groups at IMEC and the other is the research associated with gaining improved insight in the different analysis methods used for semiconductors, in particular all the aspects related with ion sputtering, and the development of improved analysis capabilities in order to cope with the demands from the analysis service. The latter includes the incorporation of a TOF spectrometer for heavy-ion RBS and ERD, the investigation towards the application of heavy-ion RBS for improved sensitivity, the application of angle resolved image scans for fast and certified channeling analysis and resonant analysis by automated energy scanning. (orig.)

  18. Inter-diffusion study of rhodium and tantalum by RBS

    International Nuclear Information System (INIS)

    Nuttens, V.E.; Hubert, R.L.; Bodart, F.; Lucas, S.

    2005-01-01

    The inter-diffusion of rhodium and tantalum has been studied with the goal of synthesizing an alloy acting as a diffusion barrier for high temperature applications. Rh/Ta sandwiched samples were annealed in vacuum at temperature ranging from 800 to 900 deg. C and from 1000 to 1075 deg. C. The diffusion profiles were obtained by RBS. They suggest the formation of two clearly different phases in each temperature range considered

  19. Use of reference samples for more accurate RBS analyses

    International Nuclear Information System (INIS)

    Lanford, W.A.; Pelicon, P.; Zorko, B.; Budnar, M.

    2002-01-01

    While one of the primary assets of RBS analysis is that it is quantitative without use of reference samples, for certain types of analyses the precision of the method can be improved by measuring RBS spectra of unknowns relative to the RBS spectra of a similar known sample. The advantage of such an approach is that one can reduce (or eliminate) the uncertainties that arise from error in the detector solid angle, beam current integration efficiency, scattering cross-section, and stopping powers. We have used this approach extensively to determine the composition (x) of homogeneous thin films of TaN x using as reference samples films of pure Ta. Our approach is to measure R=(Ta count) unknown /(Ta count) standard and use RUMP to determine the function x(R). Once the function x(R) has been determined, this approach makes it easy to analyze many samples quickly. Other analyses for which this approach has proved useful are determination of the composition (x) of WN x , SiO x H y and SiN x H y , using W, SiO 2 and amorphous Si as reference samples, respectively

  20. RBS/NRA/channeling analysis of implanted immiscible species

    International Nuclear Information System (INIS)

    Naramoto, H.; Yamamoto, S.; Narumi, K.

    2000-01-01

    Ion implantation of immiscible elements was performed to prepare supersaturated substance for further heat treatment. 63 Cu ion implantation was made at low temperature into Nb(1 0 0), (1 1 0) and (1 1 1) single crystal films on sapphire, and the induced lattice damage and the lattice location of implanted Cu atoms were analyzed by 2.7 MeV 4 He + RBS/channeling. The coherent segregation of 63 Cu atoms with specific crystallographic orientations was found in the near surface region (Cu(1 0 0)/Nb(1 0 0), Cu(1 1 1)/Nb(1 1 0) and Cu(1 1 0)/Nb(1 1 1)). The same kind of study was also made in Ir(1 0 0)/MgO(1 0 0) implanted with 50 keV 12 C + ions. In addition to 2 MeV 4 He + RBS/channeling, 1.22 MeV d + RBS/NRA/channeling was employed to detect implanted 12 C atoms. The results suggest that 12 C atoms are aligned along Ir direction at least by low temperature implantation followed by thermal annealing

  1. Heavy ion scattering: High energy limits of RBS and ERD

    International Nuclear Information System (INIS)

    Rauhala, E.

    1994-01-01

    Elastic scattering of 7 Li ions by oxygen and 12 C, 14 N and 16 O ions by aluminum, silicon, titanium and sulfur have been studied below the Coulomb barrier energies 3-30 MeV in the angular range of 78 degrees - 170 degrees. By kinematically reversing the reactions, the recoiling of carbon, nitrogen and oxygen by 40-100 MeV 27 Al, 28 Si, 32S and 48 Ti ions into recoil angles of 20 degrees, 25 degrees, 30 degrees and 40 degrees has also been investigated. Excitation functions and angular distributions are presented. Contrary to the case of light H and He ions, the heavy ion scattering cross sections fall off rapidly above the non-Rutherford threshold energy, rendering heavy ion RBS and ERD spectrometry worthless. Both classical and wave mechanical calculations have been attempted for predicting the RBS threshold energies. Simple calculations give moderate accuracy, while the more extensive nuclear potential perturbation approach relies on parameters fitted for the particular experiment. The authors present a general classical semi-empirical model for both direct scattering (RBS) and the kinematically reversed reactions (ERD), accurately reproducing the experimental data. The model is based on parameters fitted from the present scattering experiments and from an extensive literature survey

  2. RBS and RNRA studies on sorption of europium by apatite

    Energy Technology Data Exchange (ETDEWEB)

    Ohnuki, Toshihiko; Kozai, Naofumi; Isobe, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murakami, Takashi; Yamamoto, Shunya; Aoki, Yasushi; Naramoto, Hiroshi

    1997-03-01

    The sorption mechanism of europium, alternative of trivalent TRU has been studied based on the depth profiles of elements obtained by Rutherford Backscattering Spectroscopy (RBS) and Resonant Nuclear Reaction Analysis (RNRA). The positive peak for Eu and the negative peak for Ca were observed in the subtracted RBS spectra of the apatites on which Eu was sorbed from that of the fresh apatite. This indicates that Eu was sorbed on apatite, while a fraction of Ca was released from apatite. The peak height for Eu in the RBS spectrum of the apatite obtained at 75degC was higher than that of the apatite at 40degC. The depth profile of hydrogen of the apatite on which Eu was sorbed was similar to that of the fresh apatite. The concentration of Eu in the solution decreased with increasing temperature. On the contrary, the concentration of Ca increased with increasing temperature. Thus, it is concluded that a fraction of Eu is exchanged for Ca in the structure of apatite. (author)

  3. 3S-R10 automated RBS system

    International Nuclear Information System (INIS)

    Norton, G.A.; Schroeder, J.B.; Klody, G.M.; Strathman, M.D.

    1989-01-01

    The NEC 3S-R10 automated RBS spectrometer system includes the features required for routine application of Rutherford backscattering (RBS) and related techniques for materials analysis in both research and industrial settings. The NEC Model 3SDH Pelletron accelerator system provides stable, monoenergetic beams of helium ions up to 3.3 MeV and protons to 2.2 MeV and has heavy ion capability. The analytical end station is the fully computerized Charles Evans and Associates Model RBS-400. Automated features include sample positioning (precision 4-axis goniometer), channeling alignment, polar plot generation, and data acquisition and reduction. Computer automation of accelerator and chamber functions includes storage and recall of operating parameters. Unattended data acquisition, e.g., overnight or over a weekend, is possible for up to 100 samples per batch for random orientation, rotating random or channeling analyses at any sample location. Single samples may be up to 50 cm in diameter. A laser for sample alignment and a TV for video monitoring are included. Simultaneous detection (up to 4 detectors) at normal and grazing angles, external control of grazing angle detector position, and transmission scattering capabiltiy enhance system flexibility. The system is also compatible with PIXE, NRA, and hydrogen forward-backscattering analyses. Data reduction is part of the computer system, which features displays (several formats) and manipulation of up to five spectra at one time using constant multipliers or point by point operations between spectra. (orig.)

  4. RBS investigations of high-temperature reactions on graphite substrates

    Energy Technology Data Exchange (ETDEWEB)

    Eloi, C.C. [Kentucky Univ., Lexington, KY (United States). Dept. of Chemistry]|[Center for Applied Energy Research, University of Kentucky, Lexington, KY 40506 (United States); Robertson, J.D. [Kentucky Univ., Lexington, KY (United States). Dept. of Chemistry]|[Center for Applied Energy Research, University of Kentucky, Lexington, KY 40506 (United States); Majidi, V. [Kentucky Univ., Lexington, KY (United States). Dept. of Chemistry

    1995-05-01

    While graphite furnace atomic absorption spectrometry (GFAAS) is one of the most powerful techniques for ultratrace analysis of Pb, it is often plagued by matrix interferences. These interferences are minimized by the addition of matrix modifiers which stabilize the analyte signal through unknown mechanisms. Using RBS, the high temperature reactions of nitrate salts of Pb were studied on pyrolytically coated graphite with and without matrix modifiers. The addition of an ammonium phosphate modifier was found to stabilize Pb through the formation of a metal oxy-phosphorus compound. Moreover, the depth profiles demonstrated that the pyrolytically coated graphite was not impervious as previously thought. Pre-treatment of the surface with O{sub 2} is also known to cause a delay in the vaporization of Pb. While a surface effect had previously been postulated, the 3.04 MeV resonance {sup 16}O({alpha}, {alpha}){sup 16}O elastic scattering measurements show that it proceeds through the formation of surface bound lead-oxygen species as the number of oxygen atoms chemisorbed and the number of lead atoms, present on the surface prior to vaporization, are nearly equal. (orig.).

  5. Cyclic voltammetry and RBS study of paint components

    International Nuclear Information System (INIS)

    Bowman, Lynn; Spencer, Dirk; Muntele, Claudiu; Muntele, Iulia; Ila, D.

    2007-01-01

    Heavy metals and metalloid ions are found in environmental matrices. The most toxic are lead, cadmium and mercury. These three heavy metals have no biological function and are toxic at all concentrations. Lead is one of the most insidious heavy metals and is introduced into the environment by many different means. It persists in both urban and rural settings, being found in paint chips, pottery, crystal and pharmaceutical and nutritional products. The analysis of heavy elements such as lead in soil is of particular importance [W.T. Sturges, R.M. Harrison, Sci. Total Environ. 44 (3) (1985) 225; M.L. Lepow, L. Bruckman, M. Gillette, S. Markowitz, R. Robino, J. Kapish, Environ. Res. 10 (3) (1975) 415; A.E. Daniels, J.R. Kominsky, P.J. Clark, J. Hazard. Mater. B 87 (2001) 117; G. Hutter, D. Moshman, J. Hazard. Mater. 40 (1995) 1]. In preparing the methods for lead detection in paint, we have used Rutherford backscattering spectrometry (RBS) in order to study the type and amount of heavy metal content in paint samples collected at various sites in the historic campus at A and M University (AAMU). We will show the results of our study with emphasis on comparison of what we learned about presence of lead in paints using our ion beam methods compared with the analysis of lead in paints using cyclic voltammetry

  6. Structural characterization of Fe/Ag bilayers by RBS and AFM

    International Nuclear Information System (INIS)

    Tunyogi, A.; Tancziko, F.; Osvath, Z.; Paszti, F.

    2008-01-01

    Fe/Ag thin films are intensively investigated due to their special magnetic properties. Recently a deposition-order dependent asymmetric interface has been found. When iron is grown on silver, the interface is sharp, while the growth of Ag on Fe results in a long, low-energy tail of the Ag peak in the Rutherford backscattering spectrometry (RBS) spectra. The main purpose of this paper is to show that the low-energy Ag tail is caused by grain boundary diffusion, and that, when elevating the growing temperature of the Ag layer this effect becomes more significant. Two sets of polycrystalline and epitaxial Fe/Ag bilayers were prepared simultaneously onto Si(1 1 1) and MgO(1 0 0), respectively. The iron layers were grown at 250 deg. C and annealed at 450 deg. C in both sets, while the Ag layer was grown in the first set at room temperature (RT) and in the second set at 250 deg. C (HT). The sample composition, the interface sharpness and the quality of the epitaxy were studied by Rutherford backscattering spectrometry (RBS) combined with channeling effect. The surface morphology was determined by atomic force microscopy (AFM). RBS spectra show that in the case of RT samples the epitaxial MgO/Fe/Ag bilayer has sharp, well-defined interface, while for the polycrystalline Si/Fe/Ag sample the silver peak has a low-energy tail. Both the Fe and Ag peaks smeared out in the case of HT samples. AFM-images show that the RT samples have a continuous Ag layer, while the HT samples have fragmented surfaces. The RBS spectra taken on the HT samples were successfully simulated by the RBS-MAST code taking into account their fragmented structures.

  7. Experimental and Numerical Assessment of a New Alternative of RBS Moment Connection

    International Nuclear Information System (INIS)

    Mirghaderi, Rasoul; Imanpour, Ali; Keshavarzi, Farhad; Torabian, Shahab

    2008-01-01

    Reduced beam section (RBS) connection has been known as a famous connection for steel moment-resisting seismic frames in high-rise buildings, because of their economical advantages and seismic ductility. In the ordinary RBS connection, often portions of the beam flanges are selectively trimmed in the region adjacent to the beam-to-column connection, and beam section is weakened in the plastic hinge region; section weakening concept in the plastic hinge region of beam cause to reduction of beam plastic section modulus in this region, and force plastic hinge to occur within the reduced section.This paper presents a new alternative of RBS connection that has been used aforesaid weakening concept in it, with this difference that corrugated steel plate webs instead of beam flange cutting has been used in limited specific length near the column face. Corrugated steel plates because of their accordion effect don't have bending rigidity, then using of these plates in plastic hinge region reduces the beam plastic section modulus and plastic hinge is formed in corrugated region. For investigating the seismic behavior and performance of new RBS moment connection, experimental specimen of new RBS connection were subjected to cyclic load, and finite element analysis were executed. The result of cyclic test and numerical analysis specified that the corrugated webs improved the plastic stability and provided capability of large plastic rotation at the plastic hinge location without any appreciable buckling and brittle fractures in this region. The test observations also showed that the specimens' plastic rotations exceeded 0.04 rad without any local and global buckling. All of the analytical results for proposed connection are generally in good agreement with the test observations

  8. Analysis of desert rose using PIXE and RBS techniques

    International Nuclear Information System (INIS)

    Al-Kofahi, M.M.; Hallak, A.B.; Al-Juwair, H.A.; Saafin, A.K.

    1993-01-01

    Particle-induced x-ray emission (PIXE) and Rutherford backscattering spectrometry (RBS) were used to analyse desert rose geological samples. Samples from the rose core and from the rose peripherals were studied. All samples were found to contain C, N, O, Na, Mg, Si, S, Cl, K, Ca, Ti, Mn, Fe and Sr. Core samples were found to contain more silicon than peripheral samples. The extra silicon in the rose core may suggest a mechanism for the formation of the rose through crystal growth on a seed of silicon. (author)

  9. On the evaluation of micromatter thin standards by RBS

    International Nuclear Information System (INIS)

    Ionescu, M.; Stelcer, E.; Hawas, O.; Siegele, R.; Cohen, D.; Linch, D.; Sarbutt, A.; Garton, D.

    2005-01-01

    Thin film standards are routinely used in PIXE and PIGE techniques for elemental analysis of particulates present in air samples, collected on Teflon filters. A number of parameters such as thickness, homogeneity and the type and amount of impurities present in the standards are crucial in order to perform high accuracy measurements. In this paper we report the use of RBS on the new STAR 2MV accelerator for characterisation of thin film standards obtained commercially. All standards were produced by MicroMatter Co. on polymer substrates, using a room temperature evaporation method. (author). 4 refs., 5 figs., 1 tab

  10. Dose measurement of ion implanted silicon by RBS technique

    International Nuclear Information System (INIS)

    Kamawanna, Teerasak; Intarasiri, Saweat; Prapunsri, Chowunchun; Thongleurm, Chome; Maleepatra, Saenee; Singkarat, Somsorn

    2003-10-01

    Surface modification can be achieved by ion implantation. This study used a 1 mm thick silicon wafer as a target which was implanted with Ar+ at 80 keV. The degree of the modification depends on both the ion energy and the implanted dose. The distribution of argon in the silicon substrate and the absolute implanted dose can be measured by using Rutherford Backscattering Spectrometry (RBS). These investigations utilized a 1.7 MV Tandetron accelerator system at Chiang Mai University. The dose determination by a direct calculation is in agreement with the simulation by the SIMNRA code

  11. RBS characterization of Al2O3 films doped with Ce and Mn

    International Nuclear Information System (INIS)

    Martinez-Martinez, R.; Rickards, J.; Garcia-Hipolito, M.; Trejo-Luna, R.; Martinez-Sanchez, E.; Alvarez-Fregoso, O.; Ramos-Brito, F.; Falcony, C.

    2005-01-01

    Rutherford backscattering (RBS) with 4 He energies from 2 to 6 MeV has been used to study the properties of thin amorphous photoluminescent Al 2 O 3 :Ce,Mn films grown by spray pyrolysis on Corning 7059 glass substrates. The source solutions were AlCl 3 , CeCl 3 and MnCl 2 dissolved in deionized water. Different molar concentrations (Ce 10%; Mn 1%, 3%, 5%, 7% and 10%) were investigated under the same deposition conditions at a substrate temperature of 300 deg. C. The RBS spectra show a homogeneous depth profile of both Ce and Mn within the films, and the measured quantities are consistent with the original solution concentrations. An important amount of Cl, which plays a significant role in luminescent properties, was detected, in both the doped and undoped samples

  12. Blistering and exfoliation of 304 stainless steel studied by SEM and RBS

    International Nuclear Information System (INIS)

    Braun, M.; Emmoth, B.; Whitton, J.L.

    1981-01-01

    Blistering and exfoliation induced by helium irradiation have been studied in polycrystalline stainless steel with the aim of measuring flake or blister skin thicknesses for different implantation energies in the keV region. The authors present measurements of skin thicknesses determined both by direct SEM observations and RBS techniques. The results of the RBS studies show for all implantation energies used that the thickness measured in target atoms/unit area of a flake equals the calculated implantation range with an accuracy of about 10%. Conversely, the SEM measurements show that swelling gives rise to a geometrical skin thickness much greater than the corresponding implantation range. Thus from the SEM and RBS data swelling as a function of the implantation energy is obtained and the linear relative swelling is shown to be strongly dependent on the energy. In addition a comparison between the skin thickness of blisters and flakes has been made for the same material. Blisters were observed at low implantation temperatures and room temperature while exfoliation occurs at elevated temperatures. The result of this comparison is that within the experimental accuracy the flake and blister thicknesses are the same. (Auth.)

  13. Holistic RBS-PIXE data reanalysis of SBT thin film samples

    International Nuclear Information System (INIS)

    Reis, M.A.; Barradas, N.P.; Pascual-Izarra, C.; Chaves, P.C.; Ramos, A.R.; Alves, E.; Gonzalez-Aguilar, G.; Costa, M.E.V.; Miranda Salvado, I.M.

    2007-01-01

    The growth of SrBi 2 Ta 2 O 9 (SBT) films on top of Pt electrode substrates is an important issue for the fabrication of ferroelectric based memories. In a recent publication, SBT thin films grown using seeded and unseeded procedures were studied by PIXE and RBS. Difficulties and misfits found in the comparison of results from both techniques were, at that time, overcome by physical considerations. These, although not rendering interpretation impossible, left out the possibility of understanding the exact nature of the differences between the interface behavior in each case. In the present work it is shown that the reanalysis of the same data using the recently developed RBS-PIXE simultaneous and self-consistent calculation present in NDF leads to stronger conclusions on the solid state reaction occurring during the deposition stage for both types of samples. Allowing for the occurrence of solid state reactions between the deposited film and the Pt electrode even in the case of seeded samples leads to a full explanation of IBA data, this result showing that in complex systems such as this, the PIXE data are essential and must be integrated with the RBS data in an holistic analysis, in order to properly unfold the depth profile of the samples. Contrary to what is usually supposed PIXE data is therefore shown to contain hidden depth structure information

  14. A 3D-RBS study of irradiation-induced deformation and masking properties of ordered colloidal nanoparticulate masks

    International Nuclear Information System (INIS)

    Zolnai, Z.; Deak, A.; Nagy, N.; Toth, A.L.; Kotai, E.; Battistig, G.

    2010-01-01

    The 500 keV Xe 2+ irradiation-induced anisotropic deformation of ordered colloidal silica nanoparticulate masks is followed using 2 MeV 4 He + Rutherford Backscattering Spectrometry (RBS) with different measurement geometries and the improved data analysis capabilities of the RBS-MAST spectrum simulation code. The three-dimensional (3D) geometrical transformation from spherical to oblate ellipsoidal and polygonal shape and the decrease of the mask's hole size is described. The masking properties of the silica monolayer and the depth distribution of Xe in the underlying Si substrate vs. the irradiated Xe 2+ fluence are discussed. Field Emission Scanning Electron Microscopy (FESEM) is applied as complementary characterization tool. Our results give contribution to clarify the impact of ion-nanoparticle interactions on the potentials and limits of nanosphere lithography. We also show the capability of the conventional RBS technique to characterize laterally ordered submicron-sized three-dimensional structures.

  15. Involvement of the ribose operon repressor RbsR in regulation of purine nucleotide synthesis in Escherichia coli.

    Science.gov (United States)

    Shimada, Tomohiro; Kori, Ayako; Ishihama, Akira

    2013-07-01

    Escherichia coli is able to utilize d-ribose as its sole carbon source. The genes for the transport and initial-step metabolism of d-ribose form a single rbsDACBK operon. RbsABC forms the ABC-type high-affinity d-ribose transporter, while RbsD and RbsK are involved in the conversion of d-ribose into d-ribose 5-phosphate. In the absence of inducer d-ribose, the ribose operon is repressed by a LacI-type transcription factor RbsR, which is encoded by a gene located downstream of this ribose operon. At present, the rbs operon is believed to be the only target of regulation by RbsR. After Genomic SELEX screening, however, we have identified that RbsR binds not only to the rbs promoter but also to the promoters of a set of genes involved in purine nucleotide metabolism. Northern blotting analysis indicated that RbsR represses the purHD operon for de novo synthesis of purine nucleotide but activates the add and udk genes involved in the salvage pathway of purine nucleotide synthesis. Taken together, we propose that RbsR is a global regulator for switch control between the de novo synthesis of purine nucleotides and its salvage pathway. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  16. Analysis of biological materials by RBS and PIXE methods

    International Nuclear Information System (INIS)

    Latuszynski, A.; Maczka, D.; Kobzev, A. P.

    2002-01-01

    A problem of the exact determination of the element concentration in different substances is of essential significance, especially in medical, biological, as well as environment protection investigations. For this purpose some chemical and physical methods are used such as very sensitive and precise techniques: PIXE and RBS. The main advantage of those methods is the sensitivity of ppm level and very small sample amount necessary for carrying out the investigations. In this article the investigation results obtained by PIXE and RBS methods for the metal contents in cow milk (18 various samples were studied) as well as the heavy metal admixtures in the brain of the living domestic animals (6 cows, 6 dogs and 17 rats) are presented. The samples were prepared for the analysis in a liofilization process, then they were mixed with spectral pure graphite. The PIXE and RBS investigations were performed using a proton beam of about 2 mm diameter, intensity of about 10 nA and energy of 2.5 MeV from the Van-de-Graaff generator, FLNP, JINR, Dubna. The measurements of the characteristic spectrum were carried out by means of a Si (Li) detector with the resolution of 200 eV at the energy of 6,4 keV. Generally, in all samples of milk and brain we could identify 20 elements, among them 13 (C, N, O, P, Cl, K, Ca, Fe, Cu, Zn. Br, Rb, Sr) appeared in all of the studied samples. The difference in the concentration of the most of those elements between samples was in the range of 15 - 20 %. This indicates a good accuracy of the used methods of measurement. Especially our attention was paid to the presence of Sr, Rb and Br, practically in all the milk samples. This fact requires further investigations. Such elements as Pb, As, Ni, Co, Mn, V and Ti were found in some samples, including all samples coming from regions of a high urbanization. It is characteristic that the milk samples coming from villages located considerably far-away from cities and from communication tracks, practically

  17. PIXE and RBS applied to cultural heritage objects: Complementarity and limitations

    International Nuclear Information System (INIS)

    Morelle, M.; El Masri, Y.; Heitz, Ch.; Prieels, R.; Van Mol, J.; Dran, J.-C.; Salomon, J.; Calligaro, T.; Dubus, M.

    2005-01-01

    This paper reports on the use of PIXE and RBS (resonant and non-resonant RBS) implemented with proton beams to simultaneously analyse light and heavy elements in materials of cultural heritage significance, as exemplified by Russian icons or in lead seals. It is shown that in spite of its poor mass resolution RBS with protons can provide useful information when combined with PIXE. In the case of Russian icons, it is possible to discriminate between an Au-Ag bilayer and an alloy of these metals in the gilds. However, when applied to lead seals RBS with protons encounters a significant limitation due to some deficiency in the available computer programs used for spectrum processing

  18. Multidirectional channeling analysis of epitaxial CdTe layers using an automatic RBS/channeling system

    Energy Technology Data Exchange (ETDEWEB)

    Wielunski, L S; Kenny, M J [CSIRO, Lindfield, NSW (Australia). Applied Physics Div.

    1994-12-31

    Rutherford Backscattering Spectrometry (RBS) is an ion beam analysis technique used in many fields. The high depth and mass resolution of RBS make this technique very useful in semiconductor material analysis [1]. The use of ion channeling in combination with RBS creates a powerful technique which can provide information about crystal quality and structure in addition to mass and depth resolution [2]. The presence of crystal defects such as interstitial atoms, dislocations or dislocation loops can be detected and profiled [3,4]. Semiconductor materials such as CdTe, HgTe and Hg+xCd{sub 1-x}Te generate considerable interest due to applications as infrared detectors in many technological areas. The present paper demonstrates how automatic RBS and multidirectional channeling analysis can be used to evaluate crystal quality and near surface defects. 6 refs., 1 fig.

  19. Multidirectional channeling analysis of epitaxial CdTe layers using an automatic RBS/channeling system

    Energy Technology Data Exchange (ETDEWEB)

    Wielunski, L.S.; Kenny, M.J. [CSIRO, Lindfield, NSW (Australia). Applied Physics Div.

    1993-12-31

    Rutherford Backscattering Spectrometry (RBS) is an ion beam analysis technique used in many fields. The high depth and mass resolution of RBS make this technique very useful in semiconductor material analysis [1]. The use of ion channeling in combination with RBS creates a powerful technique which can provide information about crystal quality and structure in addition to mass and depth resolution [2]. The presence of crystal defects such as interstitial atoms, dislocations or dislocation loops can be detected and profiled [3,4]. Semiconductor materials such as CdTe, HgTe and Hg+xCd{sub 1-x}Te generate considerable interest due to applications as infrared detectors in many technological areas. The present paper demonstrates how automatic RBS and multidirectional channeling analysis can be used to evaluate crystal quality and near surface defects. 6 refs., 1 fig.

  20. ONO structures investigated by SIMS, RBS, and NRA

    International Nuclear Information System (INIS)

    Iberl, F.; Ramm, P.; Lang, W.

    1992-01-01

    Reoxidized nitrided oxides (ONO) will be used in ULSI technology to improve the properties of thin gate dielectrics as high breakdown fields, radiation resistance, and diffusion barriers. The ONO structures analyzed in our study are fabricated in a rapid thermal processing reactor (RTP) using oxygen and ammonium ambients. Typical data for the sequential processing mode are: rapid thermal oxidation (RTO) in oxygen atmosphere at 1100degC and rapid thermal nitridation in ammonium atmosphere (RTN) at 1050degC followed by RTO at 1150degC. Due to the complexity of the growth process it is very important to verify the resulting layers with analytical methods. The whole structure is only about 250 A thick. To analyse the sequence, composition and thickness of the layers, the depth resolution of SIMS is necessary. On the other hand, for quantification, RBS and NRA can be used. When the bulk signal is suppressed by channelling, the signal of oxygen, and in special cases nitrogen, can be evaluated from the He + backscattering spectrum. For nuclear reaction analysis, the reactions of nitrogen with deuterium are used. The combination of SIMS and the accelerator techniques allow quantitative analysis and depth profiling of this structure. (orig.)

  1. Study of multiple scattering effects in heavy ion RBS

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Z; O` Connor, D J [Newcastle Univ., NSW (Australia). Dept. of Physics

    1997-12-31

    Multiple scattering effect is normally neglected in conventional Rutherford Backscattering (RBS) analysis. The backscattered particle yield normally agrees well with the theory based on the single scattering model. However, when heavy incident ions are used such as in heavy ion Rutherford backscattering (HIRBS), or the incident ion energy is reduced, multiple scattering effect starts to play a role in the analysis. In this paper, the experimental data of 6MeV C ions backscattered from a Au target are presented. In measured time of flight spectrum a small step in front of the Au high energy edge is observed. The high energy edge of the step is about 3.4 ns ahead of the Au signal which corresponds to an energy {approx} 300 keV higher than the 135 degree single scattering energy. This value coincides with the double scattering energy of C ion undergoes two consecutive 67.5 degree scattering. Efforts made to investigate the origin of the high energy step observed lead to an Monte Carlo simulation aimed to reproduce the experimental spectrum on computer. As a large angle scattering event is a rare event, two consecutive large angle scattering is extremely hard to reproduce in a random simulation process. Thus, the simulation has not found a particle scattering into 130-140 deg with an energy higher than the single scattering energy. Obviously faster algorithms and a better physical model are necessary for a successful simulation. 16 refs., 3 figs.

  2. Study of multiple scattering effects in heavy ion RBS

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Z.; O`Connor, D.J. [Newcastle Univ., NSW (Australia). Dept. of Physics

    1996-12-31

    Multiple scattering effect is normally neglected in conventional Rutherford Backscattering (RBS) analysis. The backscattered particle yield normally agrees well with the theory based on the single scattering model. However, when heavy incident ions are used such as in heavy ion Rutherford backscattering (HIRBS), or the incident ion energy is reduced, multiple scattering effect starts to play a role in the analysis. In this paper, the experimental data of 6MeV C ions backscattered from a Au target are presented. In measured time of flight spectrum a small step in front of the Au high energy edge is observed. The high energy edge of the step is about 3.4 ns ahead of the Au signal which corresponds to an energy {approx} 300 keV higher than the 135 degree single scattering energy. This value coincides with the double scattering energy of C ion undergoes two consecutive 67.5 degree scattering. Efforts made to investigate the origin of the high energy step observed lead to an Monte Carlo simulation aimed to reproduce the experimental spectrum on computer. As a large angle scattering event is a rare event, two consecutive large angle scattering is extremely hard to reproduce in a random simulation process. Thus, the simulation has not found a particle scattering into 130-140 deg with an energy higher than the single scattering energy. Obviously faster algorithms and a better physical model are necessary for a successful simulation. 16 refs., 3 figs.

  3. Application of ion implantation RBS to the study of electrocatalysis

    International Nuclear Information System (INIS)

    Kelly, E.J.; Vallet, C.E.; White, C.W.

    1990-01-01

    Ir-implanted titanium near-surface alloys were prepared by ion implantation, characterized (Ir concentration/depth profiles) by Rutherford backscattering (RBS), and subsequently anodically oxidized to form electrocatalytically active Ir x Ti 1-x O 2 /Ti electrodes. The electrochemical behavior of the metallic-like Ir 4 Ti 1-x O 2 /Ti electrodes in acidic chloride, sulfate, and perchlorate solutions was investigated, and the results compared with those previously obtained with similarly prepared Ru x Ti 1-x O 2 /Ti electrodes. For both electrodes, M x Ti 1-x O 2 /Ti (M equals Ir or Ru), the Tafel slope for the Cl 2 evolution reaction is 40 mV, i.e.,δE/δlog i equals 2.303 (2RT/3F). The reaction order (n) with respect to chloride ion concentration δlogi/δlog[Cl - ] + 1, where K 9 equals 54.9 dm 3 mol -1 for Ir x Ti 1-x O 2 /Ti and K 9 equals 40 dm 3 mol -1 for Ru x Ti 1-x O 2 /Ti. A modified Volmer-Heyrovsky mechanism, one in which the role of absorbed chloride ions is taken into account, is shown to be consistent with aforementioned diagnostic parameters

  4. Depth profile of In and As in Si measured by RBS with He and C ions

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Q; Fang, Z [Newcastle Univ., NSW (Australia). Dept. of Physics; Ophel, T R [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics

    1994-12-31

    The depth profile of As and In implanted into Si have been measured by RBS (Rutherford Backscattering Spectrometry) with 2 MeV He ions and 6 MeV C ions. Advantages of enhanced depth and mass resolution with C ions have been demonstrated over the conventional He RBS. More reliable information for the depth profile of In and As in Si has been obtained. 12 refs., 3 figs.

  5. Depth profile of In and As in Si measured by RBS with He and C ions

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Q.; Fang, Z. [Newcastle Univ., NSW (Australia). Dept. of Physics; Ophel, T.R. [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics

    1993-12-31

    The depth profile of As and In implanted into Si have been measured by RBS (Rutherford Backscattering Spectrometry) with 2 MeV He ions and 6 MeV C ions. Advantages of enhanced depth and mass resolution with C ions have been demonstrated over the conventional He RBS. More reliable information for the depth profile of In and As in Si has been obtained. 12 refs., 3 figs.

  6. Study of CdTe surface by SIMS and RBS ellipsometry

    International Nuclear Information System (INIS)

    Stuck, R.; Hage-Ali, M.; Grob, A.; Siffert, P.

    1978-01-01

    For a better understanding of the mechanisms involved in the rectification of metal-cadmium telluride contacts, the surface of bromine-methanol etched CdTe crystals by means of ellipsometry, secondary ions mass spectroscopy (SIMS) and Rutherford backscattering of charged particles (RBS) has been investigated. The results show that these surfaces are contaminated with bromine and that a tellurium surface oxide layer grows, its thickness increasing with time. This surface layer composition has been analyzed at different steps of its evolution [fr

  7. Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE–RBS

    International Nuclear Information System (INIS)

    Zhou, Z.; Zhang, K.; Xia, C.D.; Liu, M.T.; Zhu, J.J.; An, Z.; Bai, B.

    2015-01-01

    Highlights: •We analyzed 61 unearthed porcelain shards in Yuan Dynasty by PIXE–RBS. •An electron gun was installed to solve the electric charge accumulations. •The factor analysis was performed for the element compositions. •The “exotic group” porcelain samples unearthed were produced locally. -- Abstract: A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271–1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB 6 crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907–960 A.D.) had been

  8. Compositional studies at the Bone-Cartilage interface using PIXE, RBS and cSAXS techniques

    International Nuclear Information System (INIS)

    Kaabar, W.; Gundogdu, O.; Bradley, D.A.; Bunk, O.; Pfeiffer, F.; Pfeiffer, F.; Farquharson, M.J.; Webb, M.; Jeynes, C.

    2009-01-01

    Micro Proton Induced X-ray Emission (μ-PIXE) analysis has been employed herein in investigating and quantifying the distribution of a number of essential cations in two thin slices of normal and diseased human articular cartilage, the latter being affected by osteoarthritis (OA). The elemental distribution maps for Ca, P, K, S and Zn in the normal and diseased slices showed similar patterns with marked increases in elemental concentrations in the bone-cartilage interface. The S concentration was significantly lower in bone than in cartilage. Conversely, the Ca and P concentrations were higher in bone. The Ca/P ratio (2.22) of the diseased slice was determined by employing the Rutherford backscattering technique (RBS). The RBS figures of this investigation agree with values previously reported by others. Structural and organisational changes of collagen networks were investigated by coherent Small-Angle X-ray Scattering (SAXS) using beamline facilities at the Swiss Light Source (SLS) for a decalcified diseased human articular cartilage slice. The SAXS findings showed a gradual reorientation of collagen type II fibres of cartilage from parallel to the surface of the joint to normal to the bone-cartilage interface. Similar patterns of orientation were observed at the subchondral bone to bone-cartilage interface

  9. Investigation of the impact of defect models on Monte Carlo simulations of RBS/C spectra

    International Nuclear Information System (INIS)

    Kovac, D.; Hobler, G.

    2006-01-01

    We compare the impact on the RBS/C spectra of defect configurations in silicon obtained from either empirical interatomic potentials or ab initio calculations. Using the Tersoff potential as the empirical potential and the VASP code for ab initio calculations we have determined the coordinates of the split- interstitial, of the di-, tri- and four-interstitial cluster, and of the tetrahedral interstitial as well as the strain on neighboring atoms induced by the presence of these defects. Using these coordinates in binary collision RBS/C simulations we find differences in the RBS/C yields of up to 30%. The dependence of the backscattering yield on the assumed defect type is larger with the defect coordinates obtained by the empirical potential than by the ab initio calculations

  10. Development and Validation of a Response Bias Scale (RBS) for the MMPI-2

    Science.gov (United States)

    Gervais, Roger O.; Ben-Porath, Yossef S.; Wygant, Dustin B.; Green, Paul

    2007-01-01

    This study describes the development of a Minnesota Multiphasic Personality Inventory (MMPI-2) scale designed to detect negative response bias in forensic neuropsychological or disability assessment settings. The Response Bias Scale (RBS) consists of 28 MMPI-2 items that discriminated between persons who passed or failed the Word Memory Test…

  11. A new mapping acquisition and processing system for simultaneous PIXE-RBS analysis with external beam

    International Nuclear Information System (INIS)

    Pichon, L.; Beck, L.; Walter, Ph.; Moignard, B.; Guillou, T.

    2010-01-01

    The combination of ion beam analysis techniques is particularly fruitful for the study of cultural heritage objects. For several years, the AGLAE facility of the Louvre laboratory has been implementing these techniques with an external beam. The recent set-up permits to carry out PIXE, PIGE and RBS simultaneously on the same analyzed spot with a particle beam of approximately 20 μm diameter. A new mapping system has been developed in order to provide elemental concentration maps from the PIXE and RBS spectra. This system combines the Genie2000 spectroscopy software with a homemade software that creates maps by handling acquisition with the object position. Each pixel of each PIXE and RBS maps contains the spectrum normalised by the dose. After analysing each pixel of the PIXE maps (low and high energy X-ray spectra) with the Gupixwin peak-fitting software, quantitative elemental concentrations are obtained for the major and trace elements. This paper presents the quantitative elemental maps extracted from the PIXE spectra and the development of RBS data processing for light element distribution and thin layer characterization. Examples on rock painting and lustrous ceramics will be presented.

  12. RBS and XPS study of TiOx layers prepared by the PVD technique .

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Peřina, Vratislav; Krumeich, J.; Zemek, J.; Kolouch, A.

    2004-01-01

    Roč. 36, č. 8 (2004), s. 1171-1173 ISSN 0142-2421 R&D Projects: GA ČR GP102/01/D069 Institutional research plan: CEZ:AV0Z1048901 Keywords : RBS * ERDA * TiOx Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.209, year: 2004

  13. Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE–RBS

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Z. [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); Zhang, K. [School of History and Culture, Sichuan University, Chengdu 610064 (China); Xia, C.D.; Liu, M.T.; Zhu, J.J. [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); An, Z., E-mail: anzhu@scu.edu.cn [Key Laboratory of Radiation Physics and Technology of Ministry of Education, Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610064 (China); Bai, B., E-mail: baibin@scu.edu.cn [School of History and Culture, Sichuan University, Chengdu 610064 (China)

    2015-03-01

    Highlights: •We analyzed 61 unearthed porcelain shards in Yuan Dynasty by PIXE–RBS. •An electron gun was installed to solve the electric charge accumulations. •The factor analysis was performed for the element compositions. •The “exotic group” porcelain samples unearthed were produced locally. -- Abstract: A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271–1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB{sub 6} crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907–960 A.D.) had been

  14. RBS/channeling study of buried Ge quantum dots grown in a Si layer

    International Nuclear Information System (INIS)

    Fonseca, A.; Alves, E.; Barradas, N.P.; Leitao, J.P.; Sobolev, N.A.; Carmo, M.C.; Nikiforov, A.I.; Presting, H.

    2006-01-01

    In last decades we have been assisting to a crescent importance of low dimensional systems for the fabrication of nano- and opto-electronic devices. Ge quantum dots (QDs) are well suited for fulfilling these requirements. In this work we present and discuss Ge/Si multilayer and single layer samples grown by molecular beam epitaxy. RBS/channeling results reveal the evidence for the presence of Ge QD for the thickest (with 1 ML of SiO 2 and 0.9 nm of Ge) single layer sample. On the other hand Ge atoms are fully substitutional incorporated in the Si matrix for the thinner sample, excluding the formation of Ge QDs. Multilayer sample shows an angular deviation of the Ge curve (-0.48 o ) with respect to the Si ones, indicating the compressive strain of the films. A tetragonal distortion of (1.78 ± 0.19%) was calculated

  15. RBS and NRA of cobalt oxide thin films prepared by the sol-gel process

    International Nuclear Information System (INIS)

    Andrade, E.; Huerta, L.; Pineda, J.C.; Zavala, E.P.; Barrera, E.; Rocha, M. F.; Vargas, C.A.

    2001-01-01

    This work presents a study of cobalt oxide thin films produced by the sol-gel process on aluminum and glass substrates. These films have been analyzed using two ion beam analysis (IBA) techniques: a) a standard RBS 4 He 2 MeV and b) nuclear reaction analysis (NRA) using a 1 MeV deuterium beam. The 12 C(d,p 0 ) 13 C nuclear reaction provides information that carbon is incorporated into the film structure, which could be associated to the sinterization film process. Other film measurements such as optical properties, XRD, and SEM were performed in order to complement the IBA analysis. The results show that cobalt oxide film coatings prepared by this technique have good optical properties as solar absorbers and potential uses in solar energy applications

  16. The LacI–Family Transcription Factor, RbsR, Is a Pleiotropic Regulator of Motility, Virulence, Siderophore and Antibiotic Production, Gas Vesicle Morphogenesis and Flotation in Serratia

    Directory of Open Access Journals (Sweden)

    Chin M. Lee

    2017-09-01

    Full Text Available Gas vesicles (GVs are proteinaceous, gas-filled organelles used by some bacteria to enable upward movement into favorable air/liquid interfaces in aquatic environments. Serratia sp. ATCC39006 (S39006 was the first enterobacterium discovered to produce GVs naturally. The regulation of GV assembly in this host is complex and part of a wider regulatory network affecting various phenotypes, including antibiotic biosynthesis. To identify new regulators of GVs, a comprehensive mutant library containing 71,000 insertion mutants was generated by random transposon mutagenesis and 311 putative GV-defective mutants identified. Three of these mutants were found to have a transposon inserted in a LacI family transcription regulator gene (rbsR of the putative ribose operon. Each of these rbsR mutants was GV-defective; no GVs were visible by phase contrast microscopy (PCM or transmission electron microscopy (TEM. GV deficiency was caused by the reduction of gvpA1 and gvrA transcription (the first genes of the two contiguous operons in the GV gene locus. Our results also showed that a mutation in rbsR was highly pleiotropic; the production of two secondary metabolites (carbapenem and prodigiosin antibiotics was abolished. Interestingly, the intrinsic resistance to the carbapenem antibiotic was not affected by the rbsR mutation. In addition, the production of a siderophore, cellulase and plant virulence was reduced in the mutant, whereas it exhibited increased swimming and swarming motility. The RbsR protein was predicted to bind to regions upstream of at least 18 genes in S39006 including rbsD (the first gene of the ribose operon and gvrA. Electrophoretic mobility shift assays (EMSA confirmed that RbsR bound to DNA sequences upstream of rbsD, but not gvrA. The results of this study indicate that RbsR is a global regulator that affects the modulation of GV biogenesis, but also with complex pleiotropic physiological impacts in S39006.

  17. Incremental validity of the MMPI-2-RF over-reporting scales and RBS in assessing the veracity of memory complaints.

    Science.gov (United States)

    Gervais, Roger O; Ben-Porath, Yossef S; Wygant, Dustin B; Sellbom, Martin

    2010-06-01

    The Response Bias Scale (RBS) has been found to be a better predictor of over-reported memory complaints than Minnesota Multiphasic Personality Inventory-2 (MMPI-2) F, Back Infrequency (Fb), Infrequency-Psychopathology (Fp), and FBS scales. The MMPI-2-Restructured Form (RF) validity scales were designed to meet or exceed the sensitivity of their MMPI-2 counterparts to symptom over-reporting. This study examined the incremental validity of MMPI-2-RF validity scales and RBS in assessing memory complaints. The MMPI-2-RF over-reporting validity scales were more strongly associated with mean Memory Complaints Inventory scores than their MMPI-2 counterparts (d = 0.22 to 0.49). RBS showed the strongest relationship with memory complaints. Regression analyses demonstrated the incremental validity of the MMPI-2-RF Infrequent Responses, Infrequent Psychopathology Responses, Infrequent Somatic Responses, and FBS-r scales relative to MMPI-2 F, Fp, and FBS in predicting memory complaints. This is consistent with the development objectives of the MMPI-2-RF validity scales as more efficient and sensitive measures of symptom over-reporting.

  18. Analysis of elemental composition of porcelains unearthed from Waguantan kiln site by PIXE-RBS

    Science.gov (United States)

    Zhou, Z.; Zhang, K.; Xia, C. D.; Liu, M. T.; Zhu, J. J.; An, Z.; Bai, B.

    2015-03-01

    A method combining proton-induced X-ray emission spectrometry (PIXE) and Rutherford backscattering spectrometry (RBS) was used to determine the composition of 61 porcelain shards from the Yuan Dynasty (1271-1368 A.D.) unearthed from the Waguantan kiln site at Tianzhu County in Guizhou Province, China. Based on our previous experimental setup, an electron gun device with a LaB6 crystal cathode was installed to solve the problem created when the incident proton beams generated electric charge accumulations on the surfaces of the insulating porcelain samples, which induced a large bremsstrahlung background. The use of the electron gun has largely eliminated the large bremsstrahlung background and has therefore improved the detection limits for elements, especially for trace elements, and made it possible to determine the origin of the porcelains based on the trace elements. Major and trace elemental compositions of the porcelain bodies and glazes measured by PIXE and RBS were analyzed by the factor analysis method. The factor analysis showed that a few pieces of porcelain with a style similar to the porcelain of the Longquan kiln among the unearthed porcelains from the Waguantan kiln site did not have obvious differences in elemental compositions from other remaining porcelains unearthed from the Waguantan kiln site, indicating that the pieces of unearthed porcelain with the Longquan kiln style did in fact belong to the product fired locally by imitating the model of the Longquan celadon with local raw materials. This result therefore indicated that the Longquan kiln technology that originated from the Five Dynasties (907-960 A.D.) had been propagated to the Waguantan kiln site of Guizhou Province in the Yuan Dynasty.

  19. Metallic nano-particles in lustre glazed ceramics from the 15th century in Seville studied by PIXE and RBS

    International Nuclear Information System (INIS)

    Polvorinos del Rio, A.; Castaing, J.; Aucouturier, M.

    2006-01-01

    Lustre ceramics, found in a workshop located in Triana (Sevilla), have been analysed to determine the composition of glazes including the metallic particle layers giving rise to the lustre effect. PIXE and RBS were used for the elemental composition and the sub-surface concentration profiles, respectively. Copper and silver at the origin of the lustre are detected by PIXE. RBS gives access to the detailed distribution of the elements in the surface layers. The simulation of RBS spectra confirms the occurrence of thin layers (less than 300 nm) containing metallic silver and/or copper. The results are compared with those obtained on other types of lustre ceramics

  20. Application of RBS and NRA in the fabrication of carbon based devices

    International Nuclear Information System (INIS)

    Ila, D.; Zimmerman, R.L.; Maleki, H.; Evelyn, A.L.; Poker, D.B.

    1995-06-01

    We have used Nuclear Reaction Analysis (NRA) and Rutherford Backscattering Spectrometry (RBS) as well as resonant backscattering as analytical tools in fabricating carbon based drug delivery bio-implants, electrodes for batteries, and devices to entrap or filter specific toxins. Precursor is resol C 7 H 8 O 2 liquid, which converts to fully cured phenolic resin C 7 H 6 O (sp gr 1.25) on heating at 170 C. This resin further transforms with no change in shape to glassy carbon (sp gr 1.45) on heating to 1000 C. Final product consists of long ribbon-like molecules of sp2 carbon atoms aggregated locally to form subcrystalline domains arranged randomly in space. RBS and NRA were used in measuring the porosity before and after activation, in concentration profiling of stored drugs before and after leaching, in detecting low level light element impurities, and in detecting changes in the structure of the device due to fabrication

  1. A 2-dimensional RBS simulation program for studying the edges of multilayer integrated circuit components

    Energy Technology Data Exchange (ETDEWEB)

    Guo, X.S.; Lanford, W.A. (Dept. of Physics, State Univ. of New York, Albany, NY (USA)); Rodbell, K.P. (IBM East Fishkill, Hopewell Junction, NY (USA))

    1990-01-01

    A computer program has been written to simulate the RBS spectrum from a sample consisting of many parallel three-layer stripes on a substrate (e.g. Al/Hf/Al stripes on SiO{sub 2}). The simulated RBS spectrum depends on the thickness of the different layers, the width of the stripes, the angle of the stripe side wall, the ion beam angle, the detector angle and the size and position of the ion beam on the stripe. The simulation fits experimental data well and can be used to determine diffusion in horizontal directions. It also provides an accurate way of measuring the angle of the stripe side wall. (orig.).

  2. RBS channeling measurement of damage annealing in InAs/AlSb HEMT structures

    International Nuclear Information System (INIS)

    Hallén, Anders; Moschetti, Giuseppe

    2014-01-01

    Electrical isolation of InAs/AlSb high electron mobility transistors has been achieved by the ion implantation isolation technique. The multilayered structures are grown by molecular beam epitaxy on GaAs substrates. The optimal isolation is provided by damaging patterned areas by 100 keV Ar ions implanted at room temperature using fluence of 2 × 10 15 cm −2 , and then annealing the samples in 365 °C for 30 min. The damage build-up and annealing is studied by channeling Rutherford backscattering spectrometry (RBS) and compared to sheet resistance measurements. Only a low level of damage annealing can be seen in RBS for the post-implant annealed samples, but for Ar fluence higher than 2 × 10 14 cm −2 , a strong electrical resistivity increase can still be achieved

  3. Combined RBS and TEM characterization of nano-SiGe layers embedded in SiO2

    International Nuclear Information System (INIS)

    Kling, A.; Ortiz, M.I.; Sangrador, J.; Rodriguez, A.; Rodriguez, T.; Ballesteros, C.; Soares, J.C.

    2006-01-01

    Grazing incidence RBS has been tested as a technique to detect and characterize SiGe nanoparticles embedded in a SiO 2 matrix. Suitable structures were deposited by low pressure chemical vapour deposition and characterized by TEM and RBS. The layers containing nanoparticles have been modelled by stacks of sublayers consisting of SiGeO layers with compositions calculated according to presumed shapes, sizes, Si/Ge ratios and particle area densities and used as input for RUMP. The nanoparticle parameters obtained by fitting the experimental RBS spectra agree well with the findings by TEM. This demonstrates that RBS is a useful and fast technique to characterize this kind of structures

  4. Structural analysis of erbium {delta}-doped InP by OMVPE with RBS-channeling

    Energy Technology Data Exchange (ETDEWEB)

    Yuhara, Junji; Takeda, Hitoshi; Matsubara, Naoki; Tabuchi, Masao; Fujiwara, Yasufumi; Morita, Kenji; Takeda, Yoshikazu [Nagoya Univ. (Japan). School of Engineering

    1997-03-01

    We have determined the lattice location of Er in InP {delta}-doped by OMVPE with RBS-channeling. Er concentrations along the <001> and <011> directions are same as random yields, while a significant flux peaking effect is seen for the <111> direction. These data suggest that Er atoms occupy the site equivalent to the hexahedral site in InP lattice. (author)

  5. Study of martensitic transformation in stainless steel by CEMS and RBS channeling

    International Nuclear Information System (INIS)

    Hayashi, N.; Sakamoto, I.; Tanoue, H.

    1993-01-01

    The effect of Xe ion irradiation in a single crystal of 17/13 stainless steel has been studied, using RBS channeling techniques and conversion electron Moessbauer spectroscopy (CEMS). 300 keV Xe ions were used to induce martensitic transformation in the austentic steel. A dynamic behavior of the transformation was observed as functions of the fluence and depth dependence. The martensite appears abruptly at a critical fluence, in contrast with polycrystalline 17/7 stainless steel. (orig.)

  6. Direction-dependent RBS channelling studies in ion implanted LiNbO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Wendler, E., E-mail: elke.wendler@uni-jena.de; Becker, G.; Rensberg, J.; Schmidt, E.; Wolf, S.; Wesch, W.

    2016-07-15

    Damage formation in ion implanted LiNbO{sub 3} was studied by Rutherford backscattering spectrometry (RBS) along various directions of the LiNbO{sub 3} crystal. From the results obtained it can be unambiguously concluded that Nb atoms being displaced during ion implantation preferably occupy the free octahedron sites of the LiNbO{sub 3} lattice structure and most likely also form Nb{sub Li} antisite defects.

  7. Timepix and FitPix detection system for RBS/C materials analysis

    CERN Document Server

    David-Bosne, Eric; Wahl, Ulrich

    This thesis reports the implementation of a Timepix position sensitive detector in a ion beam facility with a 0.5 mm collimated beam of 2MeV 1H$^{+}$ and 4He$^{+}$ for use in Rutherford Back-scattering Spectrometry channeling (RBS/C). A complete description is given of the methodology used for energy calibration, RBS data analysis and simulation with the FLUX Monte Carlo simulation program. Energy calibration was performed with internal test pulses and resulting resolution and accuracy were verified in two ways. The first time using a triple alpha source with the isotopes $^{239}$Pu, $^{241}$Am and $^{244}$Cm and secondly using a RBS spectrum of a thin film sample of Au/SiO$_{2}$/C. Setup characterization for channeling measurements was performed using single crystals of Si, 6H$^{-}$SiC and SrTiO$_{3}$. An energy resolution of 47.2 keV at 1862 keV for He$^{+}$ and an angular resolution of 0.11 (standard deviation) was achieved. Count rates as high as 2kHz were achieved with a frame rate of 15 frames/s. Higher...

  8. Characterisation of amorphous silicon alloys by RBS/ERD with self consistent data analysis using simulated annealing

    International Nuclear Information System (INIS)

    Barradas, N.P.; Wendler, E.; Jeynes, C.; Summers, S.; Reehal, H.S.; Summers, S.

    1999-01-01

    Full text: Hydrogenated amorphous silicon films are deposited by CVD onto insulating (silica) substrates for the fabrication of solar cells. 1.5MeV 4 He ERD/RBS is applied to the films, and a self consistent depth profile of Si and H using the simulated annealing (SA) algorithm was obtained for each sample. The analytical procedure is described in detail, and the confidence limits of the profiles are obtained using the Markov Chain Monte Carlo method which is a natural extension of the SA algorithm. We show how the results are of great benefit to the growers

  9. An RBS study of thin PLD and MOCVD strontium copper oxide layers

    Energy Technology Data Exchange (ETDEWEB)

    Kantor, Z. [Institute of Physics, University of Pannonia, H-8200 Veszprem (Hungary); Papadopoulou, E.L.; Aperathitis, E. [Inst. Electronic Struture and Laser, Foundation for Research and Technology - Hellas, P.O. Box 1527, Heraklion 71110 (Greece); Deschanvres, J.-L. [LMPG INP Grenoble-Minatec, BP 257, 38016 Grenoble Cedex 1 (France); Somogyi, K. [MicroVacuum Ltd., Kerekgyarto u.: 10, H-1147 Budapest (Hungary)], E-mail: karoly.somogyi@microvacuum.com; Szendro, I. [MicroVacuum Ltd., Kerekgyarto u.: 10, H-1147 Budapest (Hungary)

    2008-09-30

    Strontium copper oxide (SCO) has been studied as p-type transparent (VIS) conductive oxide material. Also theoretical studies suggested p-type conductivity of the SrCu{sub 2}O{sub 2} composition. SCO thin layers, with thicknesses of 30-2000 nm, were deposited on glass and silicon substrates both by pulsed laser deposition (PLD) and by MOCVD method. The as-grown layers showed high electrical resistance. Due to an annealing process, the resistivity significantly decreased and the layers showed p-type conductivity. Optical transparency measured on samples grown on glass substrates was found about or above 80%, including also thickness dependence. RBS measurements were applied for the determination of the chemical composition profile of the layers. A comparison revealed some specific differences between as-grown and annealed PLD samples. Due to the annealing, the ratio of oxide phases was changed and a vertical inhomogeneity in chemical composition was observed. Our measurements revealed also the influence of the deposition technique and of the substrate.

  10. Influence of surface topography on RBS measurements: case studies of (Cu/Fe/Pd) multilayers and FePdCu alloys nanopatterned by self-assembly

    Science.gov (United States)

    Krupinski, M.; Perzanowski, M.; Zabila, Y.; Zarzycki, A.; Marszałek, M.

    2017-03-01

    In this paper the influence of surface topography on Rutherford backscattering spectrometry (RBS) is discussed. (Cu/Fe/Pd) multilayers with total thickness of about 10 nm were deposited by physical vapor deposition on self-organized array of SiO2 nanoparticles with the size of 50 nm and 100 nm. As a reference, the multilayered systems were also prepared on flat substrates under the same conditions. After the deposition, morphology of the systems was studied by scanning electron microscopy (SEM), while chemical analysis was performed using Rutherford backscattering spectrometry. It was found that the RBS spectra and determined compositions for flat and patterned multilayers differ. The difference is discussed by taking into account the effect of additional inelastic scattering and energy straggling occurring due to developed topography of patterned systems. Then, the multilayers were annealed in 600 °C in order to obtain FePdCu alloy. The phenomenon of solid-state dewetting resulted in the formation of isolated alloy islands on the top of SiO2 nanoparticles. The SEM and RBS analysis were repeated showing correlation between the size distribution of obtained alloy islands and broadening of peaks appearing in RBS spectra. Invited talk at 8th International Workshop on Advanced Materials Science and Nanotechnology (IWAMSN2016), 8-12 November 2016, Ha Long City, Vietnam.

  11. Authenticity determination of Ag-Cu Lebanese coins using combined PIXE and RBS techniques

    International Nuclear Information System (INIS)

    Roumie, M; Nsouli, B; Assafiri, Y

    2012-01-01

    A set of silver-copper coins were investigated for their stochiometry in order to check any possible counterfeit. The studied coins are 50 Lebanese Piastres and are relatively recent, minted in 1952. They are supposed to have nominal concentration of 60 wt.% Ag and 40 wt.% Cu. In this work, it is shown the utility and capability of combining PIXE (particle induced X-ray emission) and RBS (Rutherford backscattering spectrometry) techniques to determine the elemental content and check the presence, if any, of surface layer. For this aim, 3 MeV proton beam and Al funny filter, used as x-ray absorber, were used to determine the elemental composition, based on the emission and detection of the characteristic x-rays of the corresponding elements. The first PIXE results of the supposed bulky coins showed an excess of silver composition vs. copper. In addition, the experimental protocol was checked by analyzing some other coins of known composition, such as 1-euro and 2-euro coins.

  12. Impulse control disorders and related behaviours (ICD-RBs) in Parkinson's disease patients: Assessment using ?Questionnaire for impulsive-compulsive disorders in Parkinson's disease? (QUIP)

    OpenAIRE

    Sharma, Ashish; Goyal, Vinay; Behari, Madhuri; Srivastva, Achal; Shukla, Garima; Vibha, Deepti

    2015-01-01

    Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs) in Indian patients with Parkinson′s Disease (PD). In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Com...

  13. Analysis of obsydians and films of silicon carbide by RBS technique

    International Nuclear Information System (INIS)

    Franco S, F.

    1998-01-01

    Motivated by archaeological interest this work is presented, which consist in the characterization of obsydian samples from different mineral sites in Mexico and films of silicon carbide, undertaken by an Ion Beam Analysis: RBS (Rutherford Back Scattering). As part of an intensive investigation of obsydian in Mesoamerica by anthropologists from Mexico National Institute of Anthropology and History, 818 samples were collected from different volcanic sources in Central Mexico for the purpose of establishing a data bank of element concentrations of each source. Part of this collection was analyzed by Neutron activation analysis and most of the important elements concentrations reported. In the first part of this work, the non-destructive IBA technique, RBS are used to analyze obsydian samples. The last part is an analysis of thin films of silicon carbide as a part of a research program of the Universidad Nacional Autonoma de Mexico and ININ. The application of this technique were carried out at the IF-UNAM, and the analysis was performed at laboratories of the ININ Nuclear Centre facilities. The samples considered in this work were mounted on a sample holder designed for the purpose of exposing each sample to the alpha particles beam. This RBS analysis was carried out with an ET Tandem accelerator at the IF UNAM. The spectrometry was carried out with employing a Si(Li) detector set at 15 degrees in relation to the target normal. The mean projectile energy was 2.00 MeV, and the beam profile was about 4 mm in diameter. As results were founded elemental concentrations of a set of samples from ten different sources: Altotonga (Veracruz), Penjamo (Guanajuato), Otumba (Mexico), Zinapecuaro (MIchoacan), Ucareo (Michoacan), Tres Cabezas (Puebla), Sierra Navajas (Hidalgo), Zaragoza (Puebla), Guadalupe Victoria (Puebla) and Oyameles (Puebla). The mean values are accompanied by errors expressed as one standard devistion of the mean for each element

  14. Analytical simulation of RBS spectra of nanowire samples

    Energy Technology Data Exchange (ETDEWEB)

    Barradas, Nuno P., E-mail: nunoni@ctn.ist.utl.pt [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10 ao km 139,7, 2695-066 Bobadela LRS (Portugal); García Núñez, C. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Redondo-Cubero, A. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Centro de Micro-Análisis de Materiales, Universidad Autónoma de Madrid, 28049 Madrid (Spain); Shen, G.; Kung, P. [Department of Electrical and Computer Engineering, The University of Alabama, AL 35487 (United States); Pau, J.L. [Laboratorio de Electrónica y Semiconductores, Departamento de Física Aplicada, Universidad Autónoma de Madrid, 28049 Madrid (Spain)

    2016-03-15

    Almost all, if not all, general purpose codes for analysis of Ion Beam Analysis data have been originally developed to handle laterally homogeneous samples only. This is the case of RUMP, NDF, SIMNRA, and even of the Monte Carlo code Corteo. General-purpose codes usually include only limited support for lateral inhomogeneity. In this work, we show analytical simulations of samples that consist of a layer of parallel oriented nanowires on a substrate, using a model implemented in NDF. We apply the code to real samples, made of vertical ZnO nanowires on a sapphire substrate. Two configurations of the nanowires were studied: 40 nm diameter, 4.1 μm height, 3.5% surface coverage; and 55 nm diameter, 1.1 μm height, 42% surface coverage. We discuss the accuracy and limits of applicability of the analysis.

  15. External-RBS, PIXE and NRA analysis for ancient swords

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Hellen C., E-mail: hellencsa@gmail.com; Added, Nemitala; Silva, Tiago F.; Rodrigues, C.L.

    2015-02-15

    Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi – São Paulo/Brazil, the latter being successfully implemented for the first time in this facility.

  16. External-RBS, PIXE and NRA analysis for ancient swords

    Science.gov (United States)

    Santos, Hellen C.; Added, Nemitala; Silva, Tiago F.; Rodrigues, C. L.

    2015-02-01

    Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi - São Paulo/Brazil, the latter being successfully implemented for the first time in this facility.

  17. External-RBS, PIXE and NRA analysis for ancient swords

    International Nuclear Information System (INIS)

    Santos, Hellen C.; Added, Nemitala; Silva, Tiago F.; Rodrigues, C.L.

    2015-01-01

    Elemental composition of the steel of two ancient swords (Japanese and Damascus from a private collection) was characterized using in air IBA techniques. Our results contribute for the understanding the processes of manufacturing (hammering and quenching) and surface treatments applied in these swords. The Particle Induced X-ray Emission (PIXE) measurements along the Damascus blade allowed to identify and to trace a superficial concentration profile for the elements such Cr, Mn, Fe, Ni, Cu, Zn and As, while results for the Japanese blade showed only the presence of iron. The carbon content on the surface was also investigated using a resonant region in the Elastic Backscattering Spectrometry (EBS) measurements and the results have shown a slightly difference between the surfaces under investigation. In order to investigate the nitrogen content on surface, that could explain the hardening process, we used Nuclear Reaction Analysis (NRA) and the results shown that nitrogen content was under our detection limit for the technique (0.3% in mass). The measurements of PIXE, NRA and EBS were taken using the external beam setup installed at Lamfi – São Paulo/Brazil, the latter being successfully implemented for the first time in this facility

  18. RBS and XRD analysis of silicon doped titanium diboride films

    International Nuclear Information System (INIS)

    Mollica, S.; Sood, D.K.; Ghantasala, M.K.; Kothari, R.

    1999-01-01

    Titanium diboride is a newly developed material suitable for protective coatings. Its high temperature oxidation resistance at temperatures of 700 deg C and beyond is limited due to its poor oxidative behaviour. This paper presents a novel approach to improving the coatings' oxidative characteristics at temperatures of 700 deg C by doping with silicon. Titanium diboride films were deposited onto Si(100) wafer substrates using a DC magnetron sputtering system. Films were deposited in two different compositions, one at pure TiB 2 and the other with 20 % Si doping. These samples were vacuum annealed at 700 deg C at 1x10 -6 Torr to investigate the anaerobic behaviour of the material at elevated temperatures and to ensure that they were crystalline. Samples were then oxidised in air at 700 deg C to investigate their oxidation resistance. Annealing the films at 700 deg C in air results in the oxidation of the film as titanium and boron form TiO 2 and B 2 O 3 . Annealing is seen to produce only minor changes in the films. There is some silicon diffusion from the substrate at elevated temperatures, which is related to the porous nature of the deposited film and the high temperature heat treatments. However, silicon doped films showed relatively less oxidation characteristics after annealing in air compared with the pure TiB 2 samples

  19. [German Language Version and Validation of the Risk-Taking Behaviour Scale (RBS-K) for High-Risk Sports].

    Science.gov (United States)

    Frühauf, Anika; Niedermeier, Martin; Ruedl, Gerhard; Barlow, Matthew; Woodman, Tim; Kopp, Martin

    2017-11-23

    Background  High-risk sports, particularly climbing, kayaking and extreme skiing, have become increasingly popular. The most widely used psychological survey instrument with regard to risk behaviour in sports is the Sensation Seeking Model, mostly assessed by the Sensation Seeking Scale (SSS-V). Until recently, the literature discussed risk behaviour solely through this model. However, this scale does not measure risk-taking behaviours. In contrast, the Risk-Taking Behaviour Scale (RBS-K) is a three-item scale that measures risk behaviour in high-risk sports. This study aimed to validate a German language version of the RBS-K. Methods  The RBS-K was translated and back-translated between English and German. High-risk sports participants (n = 2399) completed the German version of the RBS-K. Of those participants, 820 completed the RBS-K in person as part of a field survey and 1579 participated in an online survey. To validate the questionnaire, the SSS-V, accident involvement, age and sex were evaluated. The RBS-K divides the sample into deliberate risk takers (mean + standard deviation) and risk-averse persons (mean - standard deviation). We tested for internal consistency and correlations with SSS-V, age, sex and accident involvement. Group differences were calculated between deliberate risk takers and risk-averse persons. Results  For internal consistency, we obtained a Cronbach's alpha of 0.56 and a McDonald's omega of 0.63. Significant correlations were shown between RBS-K and SSS-V as well as age and sex. Compared to risk-averse persons (n = 643, 26.8 %), deliberate risk takers (n = 319, 13.3 %) scored significantly higher in sensation seeking, were significantly younger and primarily male and had a significantly higher accident involvement. Conclusion  The RBS-K discriminates well for age, sex and accident involvement. Also, correlations between the RBS-K and the well-established SSS-V are acceptable. With regard to the results and its

  20. Copper implantation defects in MgO observed by positron beam analysis, RBS and X-TEM

    International Nuclear Information System (INIS)

    Huis, M.A. van; Fedorov, A.V.; Veen, A. van; Smulders, P.J.M.; Kooi, B.J.; Hosson, J.Th.M. de

    2000-01-01

    In this work, effects of copper ion implantation in MgO were studied. (1 0 0) MgO samples were implanted with 50 keV Cu ions and thermally annealed stepwise in air for 30 minutes at 550, 750, 1000, 1250 and 1350 K. After ion implantation and after each annealing step, the samples were analysed with positron beam analysis (PBA). Use was also made of Rutherford backscattering spectrometry/channeling (RBS-C) and cross-sectional transmission electron microscopy (X-TEM). The combination of these techniques enabled to monitor the depth resolved evolution of both created defects and the copper atom depth distribution. PBA results show that copper implantation at a dose of 10 15 ions cm -2 yields a single layer of vacancy type defects after annealing. However a copper implantation at a dose of 10 16 ions cm -2 clearly yields two layers of defects in the material after annealing, separated by an intermediate layer. In both layers nanocavities have been identified. RBS experimental results show that the implanted copper atoms diffuse into the bulk material during annealing. X-TEM and channeling results show that after annealing, the lattice of the copper nanoprecipitates is epitaxial to the MgO host lattice. Under some circumstances, copper precipitates and small voids can co-exist. Furthermore, X-TEM measurements show that the nanocavities have rectangular shapes

  1. Determination of wear metals in engine oil by PIXE and RBS technique

    Energy Technology Data Exchange (ETDEWEB)

    Alkofahi, M M [Physics Dept., Yarmouk university, Irbid, (Jordan)

    1995-10-01

    The constituents of fresh and used engine oil were determined by PIXE and RBS techniques using 2 MeV He{sup ++} ion beams. The concentration of generated wear metals in used engine oil was measured as a function of running kilometers. The fresh oil was found to contain the elements: Si, P, S, Cl, K, Ca, and Fe. In addition to theses elements, Pb and Br were found in the used oil. Changes in the concentrations of S, Zn and Br were noticed as the running kilometers increased. 6 figs., 2 tabs.

  2. An in-situ RBS system for measuring nuclides adsorbed at the liquid-solid interface

    Energy Technology Data Exchange (ETDEWEB)

    Morita, K; Yuhara, J; Ishigami, R [Nagoya Univ. (Japan). School of Engineering; and others

    1997-03-01

    An in-situ RBS system has been developed in which heavier nuclides adsorbed at the inner surface of a thin lighter window specimen of liquid container in order to determine the rate constants for their sorption and release at the interface. The testing of a thin silicon window of the sample assembly, in which Xe gas of one atmosphere was enclosed, against the bombardment of the probing ion beam has been performed. A desorption behavior of a lead layer adsorbed at the SiO{sub 2} layer of silicon window surface into deionized water has been measured as a preliminary experiment. (author)

  3. Evolution of Zr/Hf/Zr trilayers during annealing studied by RBS

    International Nuclear Information System (INIS)

    Kling, A.; Soares, J.C.

    2010-01-01

    The Zr/Hf system is highly interesting due its various applications, e.g. formation of amorphous ternary alloys, superconductive properties and production of gate oxide layers with high dielectric coefficients by oxidation of Zr/Hf multilayers. In this work Zr/Hf/Zr trilayers with an individual layer thickness of approximately 50 nm were deposited by electron gun evaporation on a substrate consisting of silicon covered by a micrometer thick thermal oxide layer. Samples were subjected to annealing procedures at 500 and 1200 o C in flowing air atmosphere to promote oxidation and Zr/Hf interdiffusion effects. RBS studies of the as-deposited and annealed samples were performed at the van-de-Graaff accelerator of ITN using He + and H + beams with energies between 2.0 and 2.525 MeV in order to study compositional changes induced by the heat treatment. In the case of low-temperature annealing the layer system appears, besides the oxidation process starting from the surface, to be stable. On the other hand, high-temperature annealing leads to an asymmetric Hf-diffusion into the surface and interior Zr-layer provoked by anomalous diffusion due to a phase transition in Zr accompanied by an almost complete oxidation of the layer structure Oxygen and metal depth distributions obtained by RBS in the as-deposited and treated samples are provided.

  4. Towards truly simultaneous PIXE and RBS analysis of layered objects in cultural heritage

    International Nuclear Information System (INIS)

    Pascual-Izarra, Carlos; Barradas, Nuno P.; Reis, Miguel A.; Jeynes, Chris; Menu, Michel; Lavedrine, Bertrand; Ezrati, Jean Jacques; Roehrs, Stefan

    2007-01-01

    For a long time, RBS and PIXE techniques have been used in the field of cultural heritage. Although the complementarity of both techniques has long been acknowledged, its full potential has not been yet developed due to the lack of general purpose software tools for analysing the data from both techniques in a coherent way. In this work we provide an example of how the recent addition of PIXE to the set of techniques supported by the DataFurnace code can significantly change this situation. We present a case in which a non homogeneous sample (an oxidized metal from a photographic plate - heliography - made by Niepce in 1827) is analysed using RBS and PIXE in a straightforward and powerful way that can only be performed with a code that treats both techniques simultaneously as a part of one single and coherent analysis. The optimization capabilities of DataFurnace, allowed us to obtain the composition profiles for these samples in a very simple way

  5. Toward Ultraintense Compact RBS Pump for Recombination 3.4 nm Laser via OFI

    Science.gov (United States)

    Suckewer, S.; Ren, J.; Li, S.; Lou, Y.; Morozov, A.; Turnbull, D.; Avitzour, Y.

    In our presentation we overview progress we made in developing a new ultrashort and ultraintensive laser system based on Raman backscattering (RBS) amplifier /compressor from time of 10th XRL Conference in Berlin to present time of 11th XRL Conference in Belfast. One of the main objectives of RBS laser system development is to use it for pumping of recombination X-ray laser in transition to ground state of CVI ions at 3.4 nm. Using elaborate computer code the processes of Optical Field Ionization, electron energy distribution, and recombination were calculated. It was shown that in very earlier stage of recombination, when electron energy distribution is strongly non-Maxwellian, high gain in transition from the first excited level n=2 to ground level m=1 can be generated. Adding large amount of hydrogen gas into initial gas containing carbon atoms (e.g. methane, CH4) the calculated gain has reached values up to 150-200 cm-2 Taking into account this very encouraging result, we have proceed with arrangement of experimental setup. We will present the observation of plasma channels and measurements of electron density distribution required for generation of gain at 3.4 nm.

  6. Diffusion Experiments in Opalinus Clay: Laboratory, Large-Scale Diffusion Experiments and Microscale Analysis by RBS.

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Gutierrez, M.; Alonso de los Rios, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.

    2008-08-06

    The Opalinus Clay (OPA) formation in the Zurcher Weiland (Switzerland) is a potential host rock for a repository for high-level radioactive waste. Samples collected in the Mont Terri Underground Rock Laboratory (URL), where the OPA formation is located at a depth between -200 and -300 m below the surface, were used to study the radionuclide diffusion in clay materials. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), to understand the transport properties of the OPA and to enhance the methodologies used for in situ diffusion experiments. Through-Diffusion and In-Diffusion conventional laboratory diffusion experiments were carried out with HTO, 36{sup C}l-, I-, 22{sup N}a, 75{sup S}e, 85{sup S}r, 233{sup U}, 137{sup C}s, 60{sup C}o and 152{sup E}u. Large-scale diffusion experiments were performed with HTO, 36{sup C}l, and 85{sup S}r, and new experiments with 60{sup C}o, 137{sup C}s and 152{sup E}u are ongoing. Diffusion experiments with RBS technique were done with Sr, Re, U and Eu. (Author) 38 refs.

  7. Surface segregation of chromium in rapidly solidified Al studied by RBS and SPEM

    International Nuclear Information System (INIS)

    Tashlykova-Bushkevich, I.I.; Amati, M.; Aleman, B.; Gregoratti, L.; Kiskinova, M.; Ryabuhin, O.V.; Shepelevich, V.G.

    2013-01-01

    The present study demonstrates the advances of using scanning photoelectron microscopy and imaging accomplished by RBS and AFM to investigate the surface segregation of alloying elements in RS aluminum. Depth profiling of elemental composition indicates that RS microstructure evolution is influenced by solute-nanostructured defect interactions in Al-Cr alloys. It was found that Cr 2p and 3p core level photoemission spectra exhibits foil surface impoverishment of chromium. In agreement with dope depth profiling as carried out by RBS, the revealed phenomenon can be attributed to the fact that Cr drastically reduces the concentration of vacancies compared with RS pure Al, and affects H behaviour in RS Al-Cr alloys. Obtained results indicate that the surface microstructure of the Al alloy foils at the sub-micrometer scale, as far as the high density of quenched-in vacancies is concerned, is essential to elucidate how the microstructural morphology resulting from rapid solidification affects hydrogen trapping at lattice defects. (authors)

  8. Study of crystal damage by ion implantation using micro RBS/channeling

    International Nuclear Information System (INIS)

    Grambole, D.; Herrmann, F.; Heera, V.; Meijer, J.

    2007-01-01

    The combination of microbeam implantation and in-situ micro RBS/channeling analysis in the Rossendorf nuclear microprobe facility enables crystal damage studies with high current densities not achievable in standard ion implantation experiments. Si(1 0 0) samples were implanted with 600 keV Si + ions and a fluence of 1 x 10 16 cm -2 . Using a beam spot of 200 μm x 200 μm current densities from 4 to 120 μA/cm 2 were obtained. The substrate temperature was varied between RT and 265 deg. C. The implanted regions were subsequently analysed by micro RBS/channeling with a 3 MeV He + beam having a spot size of 50 μm x 50 μm. Crystal damage up to amorphisation was observed in dependence on the substrate temperature. Above a critical temperature T C no amorphisation occurs. T C was determined for each series of samples implanted with the same ion current density j. It was found that the empirical Arrhenius relation j ∼ exp(-E a /kT C ), known from standard implantation experiments, is also valid at high current densities. The observed Arrhenius law can be derived from a model of epitaxial crystallisation stimulated by defect diffusion

  9. Characterization of a SiC MIS Schottky diode as RBS particle detector

    Science.gov (United States)

    Kaufmann, I. R.; Pick, A. C.; Pereira, M. B.; Boudinov, H. I.

    2018-02-01

    A 4H-SiC Schottky diode was investigated as a particle detector for Rutherford Backscattering Spectroscopy (RBS) experiment. The device was fabricated on a commercial 4H-SiC epitaxial n-type layer grown onto a 4H-SiC n+ type substrate wafer doped with nitrogen. Hafnium oxide with thickness of 1 nm was deposited by Atomic Layer Deposition and 10 nm of Ni were deposited by sputtering to form the Ni/HfO2/4H-SiC MIS Schottky structure. Current-Voltage curves with variable temperature were measured to extract the real Schottky Barrier Height (0.32 V) and ideality factor values (1.15). Reverse current and Capacitance-Voltage measurements were performed on the 4H-SiC detector and compared to a commercial Si barrier detector acquired from ORTEC. RBS data for four alpha energies (1, 1.5, 2 and 2.5 MeV) were collected from an Au/Si sample using the fabricated SiC and the commercial Si detectors simultaneously. The energy resolution for the fabricated detector was estimated to be between 75 and 80 keV.

  10. PIXE/RBS as a tool to study cementitious materials: Application to the dynamic leaching of concrete

    Energy Technology Data Exchange (ETDEWEB)

    Llorente, I., E-mail: irene@cenim.csic.e [Centro Nacional de Investigaciones Metalurgicas (CENIM-CSIC), Avda Gregorio del Amo, 8, 28040 Madrid (Spain); Castellote, M. [Instituto de Ciencias de la Construccion ' Eduardo Torroja' (IETcc-CSIC), Serrano Galvache, 4, 28033 Madrid (Spain); Gonzalez-Arrabal, R. [Parque Cientifico de Madrid, Campus de Cantoblanco, Einstein 13, 28049 Madrid (Spain); Ynsa, M.D.; Munoz-Martin, A. [Centro de Microanalisis de Materiales (CMAM), Universidad Autonoma de Madrid, Campus de Cantoblanco, 28049 Madrid (Spain); Viedma, P.G. de; Castillo, A.; Martinez, I.; Andrade, C. [Instituto de Ciencias de la Construccion ' Eduardo Torroja' (IETcc-CSIC), Serrano Galvache, 4, 28033 Madrid (Spain); Zuloaga, P.; Ordonez, M. [Empresa Nacional de Residuos Radiactivos, S.A. (ENRESA), Emilio Vargas, 7, 28043 Madrid (Spain)

    2009-12-15

    The suitability of the application of Ion Beam Analysis (IBA) techniques such as Particle Induced X-ray Emission spectrometry (PIXE) and Rutherford Backscattering Spectrometry (RBS) to elemental depth profiling in concrete is analysed, studying hardened samples of concrete prior to and after a dynamic leaching test. A calibration of the data has been done by comparing the results obtained by IBA techniques with those obtained by Chemical and Thermogravimetric Analysis (TG/DTA). From PIXE and RBS data relevant information about the migration of minor elements, within the concrete matrix after leaching is obtained.

  11. PIXE/RBS as a tool to study cementitious materials: Application to the dynamic leaching of concrete

    International Nuclear Information System (INIS)

    Llorente, I.; Castellote, M.; Gonzalez-Arrabal, R.; Ynsa, M.D.; Munoz-Martin, A.; Viedma, P.G. de; Castillo, A.; Martinez, I.; Andrade, C.; Zuloaga, P.; Ordonez, M.

    2009-01-01

    The suitability of the application of Ion Beam Analysis (IBA) techniques such as Particle Induced X-ray Emission spectrometry (PIXE) and Rutherford Backscattering Spectrometry (RBS) to elemental depth profiling in concrete is analysed, studying hardened samples of concrete prior to and after a dynamic leaching test. A calibration of the data has been done by comparing the results obtained by IBA techniques with those obtained by Chemical and Thermogravimetric Analysis (TG/DTA). From PIXE and RBS data relevant information about the migration of minor elements, within the concrete matrix after leaching is obtained.

  12. Characterisation by PIXE RBS of metallic contamination of tissues surrounding a metallic prosthesis on a knee

    Science.gov (United States)

    Guibert, G.; Irigaray, J. L.; Moretto, Ph.; Sauvage, T.; Kemeny, J. L.; Cazenave, A.; Jallot, E.

    2006-09-01

    Implants used as biomaterials have to fulfill conditions of functionality, compatibility and sometimes bioactivity. There are four main families of biomaterials: metals and metal alloys, polymers, bioceramics and natural materials. Because of corrosion and friction in the human body, implants generate debris. This debris may develop toxicity, inflammation and prosthetic unsealing by osseous dissolution. Nature, size, morphology and amount of debris are the parameters influencing the tissue responses. In this paper, we characterised metallic contamination produced by knee prosthesis, composed with TiAl 6V 4 or Co-Cr-Mo alloys, into surrounding capsular tissue by depth migration, in vivo behaviour, content, size and nature of debris by PIXE (Particle Induced X-ray Emission) method associated with RBS (Rutherford Backscattering Spectroscopy). Debris distribution in the whole articulation is very heterogeneous. Debris migrates several thousand micrometers in tissues, with a characteristic decrease. Solid metallic particles of about micrometer size are found in the most polluted samples, in both alloys TiAl 6V 4 and Cr-Co-Mo. In the mean volume analysed by PIXE, the concentration mass ratios [Ti]/[V] and [Co]/[Cr] confirm the chemical stability of TiAl 6V 4 debris and show the chemical evolution of Cr-Co-Mo debris. Development of a protocol to prepare thin targets permits us to correlate PIXE and histological analysis in the same zone. The fibrous tissue (collagen fibres, fibroblasts) and macrophage cells are observed with optical microscope in polluted areas. This protocol could locate other pathologies in ppm contamination range, thanks to the great sensitivity of the PIXE method.

  13. Possibility of analysis using RBS, PIXE and nuclear reaction on the electrostatic Pelletron accelerator 5SDH-2

    International Nuclear Information System (INIS)

    Nguyen The Nghia; Bui Van Loat; Le Hong Khiem

    2011-01-01

    The electrostatic Pelletron accelerator 5SDH-2 is installing at Hanoi University of Sciences. This accelerator will be the first tandem electrostatic accelerator installed in Vietnam. The schematic structure, principle of operation of the machine and its application for analysis using Rutherford Back Scattering (RBS), Particle-Induced X-ray Emission (PIXE) and Nuclear Reaction Analysis (NRA) will be presented. (author)

  14. Comparative concentration analysis of Cr and Co in FeSi2 films performed by ERDA and RBS

    International Nuclear Information System (INIS)

    Bohne, W.; Reinsperger, G.-U.; Roehrich, J.; Roeschert, G.; Selle, B.; Stauss, P.

    2000-01-01

    Thin films of β-FeSi 2 doped by Co or Cr were grown on Si substrates by molecular beam epitaxy (MBE) using three separately controlled evaporation sources. The dopant concentration was measured concurrently by heavy-ion ERDA with 129 Xe ions of 140-250 MeV, by heavy-ion RBS with 15 MeV 14 N and by standard RBS with 1.4 MeV 4 He ions. Among these techniques, the TOF-ERDA was most powerful in providing a high mass resolution and a low detection limit for Co and Cr (∼0.1 at.%). Because of the complete overlap of the dopant signals with the Fe signal the standard RBS spectra were evaluated by relying on the differences between the scattering cross-sections from the dopant atoms and Fe. This approach proved to be applicable as far as the dopants had a constant depth profile with sufficiently high concentration. For Cr concentrations exceeding the miscibility limit the RBS results deviate significantly from those of ERDA due to increasing dopant depth inhomogeneities

  15. Advanced surface characterization of silver nanocluster segregation in Ag-TiCN bioactive coatings by RBS, GDOES, and ARXPS.

    Science.gov (United States)

    Escobar Galindo, R; Manninen, N K; Palacio, C; Carvalho, S

    2013-07-01

    Surface modification by means of wear protective and antibacterial coatings represents, nowadays, a crucial challenge in the biomaterials field in order to enhance the lifetime of bio-devices. It is possible to tailor the properties of the material by using an appropriate combination of high wear resistance (e.g., nitride or carbide coatings) and biocide agents (e.g., noble metals as silver) to fulfill its final application. This behavior is controlled at last by the outmost surface of the coating. Therefore, the analytical characterization of these new materials requires high-resolution analytical techniques able to provide information about surface and depth composition down to the nanometric level. Among these techniques are Rutherford backscattering spectrometry (RBS), glow discharge optical emission spectroscopy (GDOES), and angle resolved X-ray photoelectron spectroscopy (ARXPS). In this work, we present a comparative RBS-GDOES-ARXPS study of the surface characterization of Ag-TiCN coatings with Ag/Ti atomic ratios varying from 0 to 1.49, deposited at room temperature and 200 °C. RBS analysis allowed a precise quantification of the silver content along the coating with a non-uniform Ag depth distribution for the samples with higher Ag content. GDOES surface profiling revealed that the samples with higher Ag content as well as the samples deposited at 200 °C showed an ultrathin (1-10 nm) Ag-rich layer on the coating surface followed by a silver depletion zone (20-30 nm), being the thickness of both layers enhanced with Ag content and deposition temperature. ARXPS analysis confirmed these observations after applying general algorithm involving regularization in addition to singular value decomposition techniques to obtain the concentration depth profiles. Finally, ARXPS measurements were used to provide further information on the surface morphology of the samples obtaining an excellent agreement with SEM observations when a growth model of silver islands with

  16. Silver surface enrichment controlled by simultaneous RBS for reliable PIXE analysis of ancient coins

    International Nuclear Information System (INIS)

    Beck, L.; Alloin, E.; Berthier, C.; Reveillon, S.; Costa, V.

    2008-01-01

    Evidence of silver surface enrichment of ancient silver-copper coins has been pointed out in the past years. Surface enrichment can be fortuitous or intentional. In this paper, we have investigated the cleaning procedures usually performed after excavation or in museums. We have shown that chemicals or commercial products routinely used dissolve preferentially the copper phase and consequently contribute to the silver surface enrichment. As a result, surface analyses such as PIXE or XRF can be strongly affected by this effect. By using simultaneously RBS and PIXE, it is possible to check through the silver surface enrichment and then select the reliable measurements, characteristic of the bulk composition. Results on coins recently discovered and mechanically or chemically cleaned are presented

  17. Development of time-of-flight RBS system using multi microchannel plates

    International Nuclear Information System (INIS)

    Nguyen, N.V.; Abo, S.; Lohner, T.; Sawaragi, H.; Wakaya, F.; Takai, M.

    2007-01-01

    A new time-of-flight Rutherford backscattering spectroscopy (TOF-RBS) system with two circular microchannel plates (MCPs) installed at a distance of 140 mm from a sample holder and a scattering angle of 125 o and a 100 kV focused ion beam column having a liquid metal ion source (LMIS) of AuSiBe alloy has been assembled to obtain high counting rate and enhanced mass resolution. The possible influence of the two MCPs by logical summation of the output signals on the time resolution was investigated by measuring dedicated thin deposited metallic samples. And, the time resolution was found in the range of 1.5-2 ns

  18. Characterization of a silver-incorporated calcium phosphate film by RBS and its antimicrobial effects

    International Nuclear Information System (INIS)

    Han, I-H; Lee, I-S; Song, J-H; Lee, M-H; Park, J-C; Lee, G-H; Sun, X-D; Chung, S-M

    2007-01-01

    A thin calcium phosphate film was synthesized on both commercially pure Ti and Si wafers by electron beam evaporation of hydroxyapatite as an evaporant with simultaneous Ar ion beam bombardments. Silver was introduced into an ion-beam-assisted deposition of a calcium phosphate thin film for antimicrobial effect. The amount of incorporated silver ions was controlled by immersing calcium-phosphate-coated samples in different AgNO 3 concentrations, and Rutherford backscattering spectrometry (RBS) was employed to measure the amounts of substituted silver. The higher concentration of silver in the calcium phosphate film was more effective in reducing the bacteria of Escherichia coli ATCC 8739 and Streptococcus mutans OMZ 65 on contact with respect to controls

  19. Characterization of a silver-incorporated calcium phosphate film by RBS and its antimicrobial effects

    Energy Technology Data Exchange (ETDEWEB)

    Han, I-H [Institute of Physics and Applied Physics, and Atomic-Scale Surface Science Research Center, Yonsei University, Seou1 120-749 (Korea, Republic of); Lee, I-S [Institute of Physics and Applied Physics, and Atomic-Scale Surface Science Research Center, Yonsei University, Seou1 120-749 (Korea, Republic of); Song, J-H [Advanced Analysis Center, Korea Institute of Science and Technology, Seoul 136-791 (Korea, Republic of); Lee, M-H [Department of Medical Engineering, Yonsei University, Seoul 120-752 (Korea, Republic of); Park, J-C [Department of Medical Engineering, Yonsei University, Seoul 120-752 (Korea, Republic of); Lee, G-H [Korea Institute of Machinery and Materials, Chang-Won 641-010 (Korea, Republic of); Sun, X-D [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Chung, S-M [Implantium Research Center, Seoul 135-879 (Korea, Republic of)

    2007-09-15

    A thin calcium phosphate film was synthesized on both commercially pure Ti and Si wafers by electron beam evaporation of hydroxyapatite as an evaporant with simultaneous Ar ion beam bombardments. Silver was introduced into an ion-beam-assisted deposition of a calcium phosphate thin film for antimicrobial effect. The amount of incorporated silver ions was controlled by immersing calcium-phosphate-coated samples in different AgNO{sub 3} concentrations, and Rutherford backscattering spectrometry (RBS) was employed to measure the amounts of substituted silver. The higher concentration of silver in the calcium phosphate film was more effective in reducing the bacteria of Escherichia coli ATCC 8739 and Streptococcus mutans OMZ 65 on contact with respect to controls.

  20. Study of ancient Islamic gilded pieces combining PIXE-RBS on external microprobe with sem images

    International Nuclear Information System (INIS)

    Ynsa, M.D.; Gutierrez, P.C.; Enguita, O.; Chamon, J.; Pardo, A.I.; Arroyo, M.; Barrio, J.; Gomez-Morilla, I.; Ferretti, M.; Climent-Font, A.

    2008-01-01

    Numerous metallic objects with very aesthetic and technological qualities have been recovered by archaeological excavations. Adequate processes of restoration and conservation treatments require the accurate determination of the elemental composition and distribution within the objects, as well as the identification of the nature and distribution of the corrosion products. Ideally the identification method should cause no alteration in the sample. In this work, different archaeological pieces with a gilded look have been characterized using simultaneously PIXE and RBS at the CMAM external microprobe in order to study the gilding metalworking done in the Iberian Peninsula during the Middle Ages. The gold layer thickness and its elemental concentrations of Ag, Au and Hg were determined by both techniques and compared with the scanning electron microscopy images obtained for some fragments of pieces. (orig.)

  1. RBS cross-section of MeV ions channeling in crystals from quantum theory

    International Nuclear Information System (INIS)

    Den Besten, J.L.; Jamieson, D.N.; Spizzirri, P.G.; Allen, L.J.

    1999-01-01

    We present an alternative approach to describing Rutherford Backscattered (RBS) angular yield scans. The Bloch wave method to formulate the cross-section is a fundamental approach originating from Schrodinger's equation. This quantum formulation is often used when describing various aspects of electron diffraction including Backscattering, EDX and TEM but has seen little application to the very short wavelength regime of MeV ions. It offers several significant advantages. Great freedom is given to crystal properties and structure in the theory allowing a fundamental insight into the channeling phenomena and hence the crystal itself. We have calculated both planar and axial channeling scans and these maps are shown to be in good agreement to their experimental counterparts. There is excellent correlation between the theoretical and experimental results for both χ min and Ψ 1/2 . Further investigation is required into the area of absorption or dechanneling. This phenomenon requires different mechanisms for electron and ion scattering differ greatly

  2. Depth profiling: RBS versus energy-dispersive X-ray imaging using scanning transmission electron microscopy

    International Nuclear Information System (INIS)

    Markwitz, Andreas

    2000-01-01

    Rutherford backscattering spectrometry (RBS) is known to be one of the techniques ideal for analysis of thin films. Elemental concentrations of matrix components and impurities can be investigated as well as depth profiles of almost each element of the periodic table. Best of all, RBS has both a high sensitivity and a high depth resolution, and is a non-destructive analysis technique that does not require specific sample preparation. Solid-state samples are mounted without preparation inside a high-vacuum analysis chamber. However, depth-related interpretation of elemental depth profiles requires the material density of the specimen and stopping power values to be taken into consideration. In many cases, these parameters can be estimated with sufficient precision. However, the assumed density can be inaccurate for depth scales in the nanometer range. For example, in the case of Ge nanoclusters in 500 nm thick SiO 2 layers, uncertainty is related to the actual position of a very thin Ge nanocluster band. Energy-dispersive X-ray emission (EDX) spectroscopy, using a high-resolution scanning transmission electron microscope (STEM) can assist in removing this uncertainty. By preparing a thin section of the specimen, EDX can be used to identify the position of the Ge nanocluster band very precisely, by correlating the Ge profile with the depth profiles of silicon and oxygen. However, extraction of the concentration profiles from STEM-EDX spectra is in general not straightforward. Therefore, a combination of the two very different analysis techniques is often the best and only successful way to extract high-resolution concentration profiles

  3. Lattice location of impurities in semiconductors: a RBS/channeling and proton-induced x-ray emission study

    Energy Technology Data Exchange (ETDEWEB)

    Kringhoj, P [Australian National Univ., Canberra, ACT (Australia). Research School of Physical Sciences

    1994-12-31

    Rutherford backscattering spectrometry (RBS)/channeling and proton-induced x-ray emission (PIXE) are two well established and characterised techniques. Over the last three decades RBS/channeling measurements has been performed to extract the substitutional fraction of impurities in both elemental and compound semiconductors. However, due to the limitation of RBS, only elements heavier than the host crystal can be examined (except for a few elements, where a nuclear reaction or a resonance can be used). In silicon this limitation is acceptable, due to the low mass of Si, but in the III-V compounds (e.g. InP), the technique is limited to a few elements of hardly no technological or fundamental interest. One can overcome this by combining RBS/channeling with PIXE, where PIXE is applied to detect elements with a mass lower than the host crystal. In the present work, the lattice location of Ge in InP has been studied and compared to the group-III impurity Ga, and the group-VI impurity Se which is known to be a donor. The (RBS)/channeling technique has been used to detect not only the substitutional fraction, but also the relative population of the two sublattices. The half-width is approximately equal to the characteristic angle, {psi}{sub 1}. The channeling data obtained indicate that all three dopants are located exclusively on substitutional sites and that Ga is occuping the In position, Se theP position and that Ge is distributed equally between both sublattices. 6 refs., 1 tab., 3 figs.

  4. Lattice location of impurities in semiconductors: a RBS/channeling and proton-induced x-ray emission study

    Energy Technology Data Exchange (ETDEWEB)

    Kringhoj, P. [Australian National Univ., Canberra, ACT (Australia). Research School of Physical Sciences

    1993-12-31

    Rutherford backscattering spectrometry (RBS)/channeling and proton-induced x-ray emission (PIXE) are two well established and characterised techniques. Over the last three decades RBS/channeling measurements has been performed to extract the substitutional fraction of impurities in both elemental and compound semiconductors. However, due to the limitation of RBS, only elements heavier than the host crystal can be examined (except for a few elements, where a nuclear reaction or a resonance can be used). In silicon this limitation is acceptable, due to the low mass of Si, but in the III-V compounds (e.g. InP), the technique is limited to a few elements of hardly no technological or fundamental interest. One can overcome this by combining RBS/channeling with PIXE, where PIXE is applied to detect elements with a mass lower than the host crystal. In the present work, the lattice location of Ge in InP has been studied and compared to the group-III impurity Ga, and the group-VI impurity Se which is known to be a donor. The (RBS)/channeling technique has been used to detect not only the substitutional fraction, but also the relative population of the two sublattices. The half-width is approximately equal to the characteristic angle, {psi}{sub 1}. The channeling data obtained indicate that all three dopants are located exclusively on substitutional sites and that Ga is occuping the In position, Se theP position and that Ge is distributed equally between both sublattices. 6 refs., 1 tab., 3 figs.

  5. Study of new sheep bone and Zn/Ca ratio around TiAlV screw: PIXE RBS analysis

    Science.gov (United States)

    Guibert, G.; Munnik, F.; Langhoff, J. D.; Von Rechenberg, B.; Buffat, Ph. A.; Laub, D.; Faber, L.; Ducret, F.; Gerber, I.; Mikhailov, S.

    2008-03-01

    This study reports on in vivo particle induced X-ray emission (PIXE) measurements combined with Rutherford backscattering spectroscopy (RBS) analyses of new remodeled sheep bone formed around TiAlV screws. The implants (screws) were anodized by a modified TiMax™ process. The interface between the implant and the bone was carefully investigated. [Zn]/[Ca] in-depth composition profiles as well as Ca, Fe elemental maps were recorded. The thickness of new bone formed around the screw reached 300-400 μm. Osteon and Osteoid phases were identified in the new bone. A higher [Zn]/[Ca] ratio was observed in the new bone as compared to the mature bone. Blood vessels were observed in the bone in close contact with the screw. This study shows the potential of ion beam analysis for biological and biomedical characterization.

  6. Study of new sheep bone and Zn/Ca ratio around TiAlV screw: PIXE-RBS analysis

    International Nuclear Information System (INIS)

    Guibert, G.; Munnik, F.; Langhoff, J.D.; Von Rechenberg, B.; Buffat, Ph.A.; Laub, D.; Faber, L.; Ducret, F.; Gerber, I.; Mikhailov, S.

    2008-01-01

    This study reports on in vivo particle induced X-ray emission (PIXE) measurements combined with Rutherford backscattering spectroscopy (RBS) analyses of new remodeled sheep bone formed around TiAlV screws. The implants (screws) were anodized by a modified TiMax TM process. The interface between the implant and the bone was carefully investigated. [Zn]/[Ca] in-depth composition profiles as well as Ca, Fe elemental maps were recorded. The thickness of new bone formed around the screw reached 300-400 μm. Osteon and Osteoid phases were identified in the new bone. A higher [Zn]/[Ca] ratio was observed in the new bone as compared to the mature bone. Blood vessels were observed in the bone in close contact with the screw. This study shows the potential of ion beam analysis for biological and biomedical characterization

  7. RBS and ERDA determinations of depth distributions of high-dose carbon ions implanted in silicon for silicon-carbide synthesis study

    International Nuclear Information System (INIS)

    Intarasiri, S.; Kamwanna, T.; Hallen, A.; Yu, L.D.; Janson, M.S.; Thongleum, C.; Possnert, G.; Singkarat, S.

    2006-01-01

    For ion beam synthesis of silicon carbide (SiC), a knowledge of the depth distribution of implanted carbon ions in silicon is crucial for successful development. Based on its simplicity and availability, we selected Rutherford backscattering spectrometry (RBS) as an analysis technique for this purpose. A self-developed computer program dedicated to extract depth profiles of lighter impurities in heavier matrix is established. For control, calculated results are compared with an other ion beam analysis (IBA) technique superior for studying lighter impurity in heavier substrate i.e. elastic recoil detection analysis (ERDA). The RBS was performed with a 1.7-MV Tandetron accelerator using He 2+ as the probe ions. The ERDA was performed with a 5-MV Pelletron accelerator using I 8+ as the probe ions. This work shows that the RBS-extracted data had no significant deviations from those of ERDA and simulations by SRIM2003 and SIIMPL computer codes. We also found that annealing at temperatures as high as 1000 deg. C had quite limited effect on the redistribution of carbon in silicon

  8. RBS analysis of ions implanted in light substrates exposed to hot plasmas laser-generated at PALS

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Gammino, S.; Picciotto, A.; Wolowski, J.; Krása, Josef; Láska, Leoš; Calcagnile, L.; Quarta, G.

    2005-01-01

    Roč. 160, 10-12 (2005), s. 685-695 ISSN 1042-0150. [Workshop PIBHI 2005 /2./. Giardini Naxos, 08.06.06-11.06.06] R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z10100523 Keywords : RBS analysis * ion implantation * plasma-generated by lasers Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.353, year: 2005

  9. RBS and NRA damage analysis on PFA films bombarded with hydrogen

    Energy Technology Data Exchange (ETDEWEB)

    Parada, Marco A.; Petchevist, Paulo C.D.; Minamisawa, Renato A.; Almeida, Adelaide de [Sao Paulo Univ., SP (Brazil). Inst. de Fisica]. E-mail: dalmeida@ffclrp.usp.br; Muntele, Claudiu I.; Zimmerman, Robert L.; Ila, Daryush [A and M University, Normal, AL (United States). Center for Irradiation of Materials]. E-mail: ila@cim.aamu.edu

    2005-07-01

    The fluoropolymer PFA (Tetrafluoroethylene-per-fluoromethoxy ethylene) is a conventional thermoplastic used in civil engineering applications such as anti-adherent coatings and concrete additives. It is also candidate materials for radiation dosimetry with applications in medical physics. When such a polymer is exposed to ionizing radiation, it can suffers damages that depend on the type, energy, and intensity of the radiation. We present results on the damage caused by 1 MeV protons at fluences of 10{sup 13}, 10{sup 14}, 10{sup 15}, and 10{sup 16} protons/cm{sup 2}. The energy deposited during such hydrogen bombardment breaks the polymeric chains with the release of fluorine in amounts directly proportional to the amount of deposited energy. Virgin samples were first analyzed by RBS. Subsequent damage was then profiled by monitoring the alpha emission spectrum, resulting from the nuclear reaction: {sup 19}F(p,{alpha}{gamma}){sup 16}O induced by 1.38 MeV protons on the remaining fluorine content of damaged polymer samples. (author)

  10. RBS and NRA damage analysis on PFA films bombarded with hydrogen

    International Nuclear Information System (INIS)

    Parada, Marco A.; Petchevist, Paulo C.D.; Minamisawa, Renato A.; Almeida, Adelaide de; Muntele, Claudiu I.; Zimmerman, Robert L.; Ila, Daryush

    2005-01-01

    The fluoropolymer PFA (Tetrafluoroethylene-per-fluoromethoxy ethylene) is a conventional thermoplastic used in civil engineering applications such as anti-adherent coatings and concrete additives. It is also candidate materials for radiation dosimetry with applications in medical physics. When such a polymer is exposed to ionizing radiation, it can suffers damages that depend on the type, energy, and intensity of the radiation. We present results on the damage caused by 1 MeV protons at fluences of 10 13 , 10 14 , 10 15 , and 10 16 protons/cm 2 . The energy deposited during such hydrogen bombardment breaks the polymeric chains with the release of fluorine in amounts directly proportional to the amount of deposited energy. Virgin samples were first analyzed by RBS. Subsequent damage was then profiled by monitoring the alpha emission spectrum, resulting from the nuclear reaction: 19 F(p,αγ) 16 O induced by 1.38 MeV protons on the remaining fluorine content of damaged polymer samples. (author)

  11. RBS and XPS analyses of the composite calcium phosphate coatings for biomedical applications

    International Nuclear Information System (INIS)

    Ide-Ektessabi, Ari; Yamaguchi, Tetsuro; Tanaka, Yoshikazu

    2005-01-01

    The calcium phosphate coatings on metallic implants are widely used for biomedical applications. The calcium phosphate coatings require mechanical strength, strong adhesion to the metallic implants, chemical stability and low dissolution into the human body fluid for stable functioning in the corrosive environment of the human body. In this study, a novel approach for improving the calcium phosphate coatings is utilized by adding trace metallic element into the coatings. We focused on teeth enamel, which is the hardest calcium phosphate tissue in the human body. Zn concentration increases exponentially from the interior to the surface of the enamel. As the Zn concentration increases, so the local hardness increases. Our previous studies suggest that Zn has influence on the hardness and other properties of enamel, calcium phosphate tissue. Calcium phosphate coatings doped with Zn was fabricated and characterized. The atomic composition and chemical state were investigated by using Rutherford backscattering spectroscopy (RBS) and X-ray photoelectron spectrometer (XPS), respectively. Scratch test was also carried out for measuring the adhesion of the coatings

  12. Nuclear techniques (PIXE and RBS) applied to analysis of pre hispanic metals of the Templo Mayor at Tenochtitlan; Tecnicas nucleares (PIXE y RBS) aplicadas al analisis de metales prehispanicos del Templo Mayor de Tenochtitlan

    Energy Technology Data Exchange (ETDEWEB)

    Mendez U, I.; Tenorio, D.; Galvan, J.L. [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2000-07-01

    This work has the objective of determining by means of the utilization of nuclear techniques (PIXE and RBS) the composition and the alloy type of diverse aztec ornaments corresponding to Post classic period, they were manufactured principally with copper and gold such as bells, beads and disks; all they belonging at 9 oblations of Templo Mayor of Tenochtitlan. It is presented here briefly the historical and archaeological antecedents of the devices as well as the analytical methods for conclude with the results obtained. (Author)

  13. Application of the Rutherford backscattering analysis (RBS analysis) for detecting heavy impurity elements in pBN crucible materials

    International Nuclear Information System (INIS)

    Bethge, K.; Meyer, J.D.; Michelmann, R.; Krauskopf, J.

    1992-01-01

    By means of the Rutherford backscattering analysis evidence is given of an inhomogeneous depth distribution of the elements C, O, F, Na, Mg, Al, Si, P, S, Cl, Ca, Ti, Cr, Fe, Ni in pBN (pyrolytic boron nitride) materials of crucibles. This inhomogenous distribution is observed both at the original surface and at the surface of inner cracks. In addition, the distribution of the elements is found to differ depending on the spots chosen for analysis. The RBS measurements alone do not yield information on the volume concentration of the elements. (orig.) With 2 refs [de

  14. Nuclear techniques (PIXE and RBS) applied to analysis of pre hispanic metals of the Templo Mayor at Tenochtitlan

    International Nuclear Information System (INIS)

    Mendez U, I.; Tenorio, D.; Galvan, J.L.

    2000-01-01

    This work has the objective of determining by means of the utilization of nuclear techniques (PIXE and RBS) the composition and the alloy type of diverse aztec ornaments corresponding to Post classic period, they were manufactured principally with copper and gold such as bells, beads and disks; all they belonging at 9 oblations of Templo Mayor of Tenochtitlan. It is presented here briefly the historical and archaeological antecedents of the devices as well as the analytical methods for conclude with the results obtained. (Author)

  15. THERMOPHILIC BACILLUS LICHENIFORMIS RBS 5 ISOLATED FROM HOT TUNISIAN SPRING CO-PRODUCING ALKALINE AND THERMOSTABLE α-AMYLASE AND PROTEASE ENZYMES

    Directory of Open Access Journals (Sweden)

    Rakia Ben Salem

    2016-06-01

    Full Text Available Bacillus licheniformis RBS 5 was isolated from thermal spring in Tunisia. The isolate coproduce α-amylase and protease enzymes. The α-amylase activity showed an optimal activity at approximately 65°C and in wide pH interval ranging from 4 to 9. This enzyme was stable over the range of 45 to 70°C after 30 min of incubation and in the pH range of 8 to 10. Protease activity was optimal; at 80°C, pH 12. This enzyme was stable until 60°C over the pH range of 10 to 12. EDTA at concentration of 5 mM reduces slightly both activities evoking the serine alkaline protease. Cationic ions (Ca2+, Cu2+, Zn2+, and Mg 2+ have an inhibition effect on α-amylase. However, protease activity was enhanced by Ca2+, Cu2+ and Mg 2+; the other cations reduce slightly the proteolytic activity. SDS and H2O2 were found as inhibitors for both activities whereas Triton X-100 and perfume have no effect. Taken together, these traits make protease activity of B. licheniformis RBS 5 as efficient for use in detergent industry.

  16. Characterisation of zinc in slags originated from a contaminated sediment by coupling /μ-PIXE, /μ-RBS, /μ-EXAFS and powder EXAFS spectroscopy

    Science.gov (United States)

    Isaure, M. P.; Laboudigue, A.; Manceau, A.; Sarret, G.; Tiffreau, C.; Trocellier, P.

    2001-07-01

    Depositing dredged sediments on soils is usual but it is a hazardous practice for the local environment when these sediments are polluted by heavy metals. This chemical hazard can be assessed by determining the speciation of metals. In this study, slags highly polluted with Zn and originated from a contaminated dredged sediment were investigated. Zn speciation was studied by laterally resolved techniques such as μ-particle induced X-ray emission (μ-PIXE), μ-Rutherford backscattering spectrometry (μ-RBS), μ-extended X-ray absorption fine structure (μ-EXAFS), and bulk analyses such as powder EXAFS spectroscopy. μ-PIXE and μ-RBS results showed that high concentrations of Zn were associated with S in localised areas at the surface of the slags while moderate amounts of Zn were mainly associated with Fe in the matrix. EXAFS results allowed to identify ZnS and Zn sorbed on ferrihydrite (5Fe 2O 3·9H 2O), proxy for iron oxy-hydroxides, as the main Zn-bearing phases. The occurrence of this Zn-iron oxy-hydroxide is interpreted as a mobilisation of Zn released from ZnS oxidation.

  17. Characterisation of zinc in slags originated from a contaminated sediment by coupling μ-PIXE, μ-RBS, μ-EXAFS and powder EXAFS spectroscopy

    International Nuclear Information System (INIS)

    Isaure, M.P.; Laboudigue, A.; Manceau, A.; Sarret, G.; Tiffreau, C.; Trocellier, P.

    2001-01-01

    Depositing dredged sediments on soils is usual but it is a hazardous practice for the local environment when these sediments are polluted by heavy metals. This chemical hazard can be assessed by determining the speciation of metals. In this study, slags highly polluted with Zn and originated from a contaminated dredged sediment were investigated. Zn speciation was studied by laterally resolved techniques such as μ-particle induced X-ray emission (μ-PIXE), μ-Rutherford backscattering spectrometry (μ-RBS), μ-extended X-ray absorption fine structure (μ-EXAFS), and bulk analyses such as powder EXAFS spectroscopy. μ-PIXE and μ-RBS results showed that high concentrations of Zn were associated with S in localised areas at the surface of the slags while moderate amounts of Zn were mainly associated with Fe in the matrix. EXAFS results allowed to identify ZnS and Zn sorbed on ferrihydrite (5Fe 2 O 3 ·9H 2 O), proxy for iron oxy-hydroxides, as the main Zn-bearing phases. The occurrence of this Zn-iron oxy-hydroxide is interpreted as a mobilisation of Zn released from ZnS oxidation

  18. DsrA regulatory RNA represses both hns and rbsD mRNAs through distinct mechanisms in Escherichia coli.

    Science.gov (United States)

    Lalaouna, David; Morissette, Audrey; Carrier, Marie-Claude; Massé, Eric

    2015-10-01

    The 87 nucleotide long DsrA sRNA has been mostly studied for its translational activation of the transcriptional regulator RpoS. However, it also represses hns mRNA, which encodes H-NS, a major regulator that affects expression of nearly 5% of Escherichia coli genes. A speculative model previously suggested that DsrA would block hns mRNA translation by binding simultaneously to start and stop codon regions of hns mRNA (coaxial model). Here, we show that DsrA efficiently blocked translation of hns mRNA by base-pairing immediately downstream of the start codon. In addition, DsrA induced hns mRNA degradation by actively recruiting the RNA degradosome complex. Data presented here led to a model of DsrA action on hns mRNA, which supports a canonical mechanism of sRNA-induced mRNA degradation by binding to the translation initiation region. Furthermore, using MS2-affinity purification coupled with RNA sequencing technology (MAPS), we also demonstrated that DsrA targets rbsD mRNA, involved in ribose utilization. Surprisingly, DsrA base pairs far downstream of rbsD start codon and induces rapid degradation of the transcript. Thus, our study enables us to draw an extended DsrA targetome. © 2015 John Wiley & Sons Ltd.

  19. Micro-ERDA, micro-RBS and micro-PIXE techniques in the investigation of fish otoliths

    International Nuclear Information System (INIS)

    Huszank, R.; Simon, A.; Szilagyi, E.; Keresztessy, K.; Kovacs, I.

    2009-01-01

    Elemental distribution in the otolith of the fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford Backscattering Spectrometry (RBS) and as a complementary technique, Particle-Induced X-ray Emission (PIXE) with a focussed ion beam of 1.5 x 1.5 μm 2 spot size. The organic- and inorganic-rich regions of the otolith are distinguished and they are presented as hydrogen and calcium maps at depth regions of 0-70, 70-140 and 140-210 nm. The textured surface of the sample and its porosity were characterized from the effect on the RBS spectra. The oxygen and carbon PIXE elemental maps can also be used to identify the organic- and inorganic-rich regions of the otolith. The calcium map was found to be more homogeneous because the otolith structure is averaged in a larger depth. The trace elements Fe, Zn and Sr were detected only in very low concentration by micro-PIXE.

  20. Low energy RBS-channeling measurement system with the use of a time-of-flight scattered ion detector

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Masataka; Kobayashi, Naoto; Hayashi, Nobuyuki [Electrotechnical Lab., Tsukuba, Ibaraki (Japan)

    1996-07-01

    We have developed a low energy Rutherford backscattering spectrometry-ion channeling measurement system for the analysis of thin films and solid surfaces with the use of several tens keV hydrogen ions and a time-of-flight particle energy spectrometer. For the detection of the scattered ions new TOF spectrometer has been developed, which consists of two micro-channel-plate detectors. The pulsing of the primary ion beam is not necessary for this type of TOF measurement, and it is possible to observe continues scattered ion beams. The dimension of whole system is very compact compared to the conventional RBS-channeling measurement system with the use of MeV He ions. The energy resolution, {delta} E/E, for 25 keV H{sup +} was 4.1%, which corresponds to the depth resolution of 4.8 nm for silicon. The depth resolution of our system is better than that of conventional RBS system with MeV helium ions and solid state detectors. We have demonstrated the ion channeling measurement by this system with 25 keV hydrogen ions. The system can be available well to the analysis of thin films and solid surfaces with the use of the ion channeling effect. The observation of the reaction between Fe and hydrogen terminated silicon surface was also demonstrated. (J.P.N.)

  1. Micro-ERDA, micro-RBS and micro-PIXE techniques in the investigation of fish otoliths

    Energy Technology Data Exchange (ETDEWEB)

    Huszank, R. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, H-4001 Debrecen (Hungary)], E-mail: huszank@atomki.hu; Simon, A. [Institute of Nuclear Research of the Hungarian Academy of Sciences, P.O. Box 51, H-4001 Debrecen (Hungary); Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, P.O. Box 49, H-1525 Budapest (Hungary); Keresztessy, K. [Department of Fish Culture, Institute of Environmental and Landscape Management, Szent Istvan University, Pater K.u.1, H-2103 Goedoello (Hungary); Kovacs, I. [KFKI Research Institute for Particle and Nuclear Physics, P.O. Box 49, H-1525 Budapest (Hungary)

    2009-06-15

    Elemental distribution in the otolith of the fresh water fish burbot (Lota lota L.) collected in Hungary was measured with Elastic Recoil Detection Analysis (ERDA), Rutherford Backscattering Spectrometry (RBS) and as a complementary technique, Particle-Induced X-ray Emission (PIXE) with a focussed ion beam of 1.5 x 1.5 {mu}m{sup 2} spot size. The organic- and inorganic-rich regions of the otolith are distinguished and they are presented as hydrogen and calcium maps at depth regions of 0-70, 70-140 and 140-210 nm. The textured surface of the sample and its porosity were characterized from the effect on the RBS spectra. The oxygen and carbon PIXE elemental maps can also be used to identify the organic- and inorganic-rich regions of the otolith. The calcium map was found to be more homogeneous because the otolith structure is averaged in a larger depth. The trace elements Fe, Zn and Sr were detected only in very low concentration by micro-PIXE.

  2. Characterization of electroless Au, Pt and Pd contacts on CdTe and ZnTe by RBS and SIMS techniques

    Energy Technology Data Exchange (ETDEWEB)

    Roumie, M. E-mail: mroumie@cnrs.edu.lb; Hageali, M.; Zahraman, K.; Nsouli, B.; Younes, G

    2004-06-01

    Rutherford backscattering spectrometry (RBS) was applied to characterize Au, Pt and Pd contacts on II-VI semiconductor materials, CdTe and ZnTe, used as nuclear detectors. Electroless thin film depositions were prepared by changing the concentration of the reaction solution. Contrary to the deposition reaction time, it was observed that the amount of solution dilution degree had a considerable effect on increasing the thickness of the metal layer. Furthermore, PICTS electrical measurements confirmed the depth profile analysis performed by RBS and SIMS.

  3. Characterisation by PIXE-RBS of metallic contamination of tissues surrounding a metallic prosthesis on a knee

    Energy Technology Data Exchange (ETDEWEB)

    Guibert, G. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France)]. E-mail: geoffroy.guibert@he-arc.ch; Irigaray, J.L. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France); Moretto, Ph. [Centre d' Etudes Nucleaires de Bordeaux-Gradignan, IN2P3/CNRS UMR 5797, Le Haut Vigneau, BP 120, 33175 Gradignan Cedex (France); Sauvage, T. [Centre d' Etudes et de Recherches par Irradiation, CNRS Orleans France, 3A rue de la ferollerie, 45071 Orleans Cedex 2 (France); Kemeny, J.L. [CHU, Service d' Anatomie et de Cytologie Pathologiques, Universite d' Auvergne, 63100 Clermont-Ferrand (France); Cazenave, A. [Institut Calot, 62608 Berck sur Mer Cedex (France); Jallot, E. [Laboratoire de Physique Corpusculaire de Clermont-Ferrand, IN2P3/CNRS UMR 6533, Universite Blaise Pascal, 63177 Aubiere Cedex (France)

    2006-09-15

    Implants used as biomaterials have to fulfill conditions of functionality, compatibility and sometimes bioactivity. There are four main families of biomaterials: metals and metal alloys, polymers, bioceramics and natural materials. Because of corrosion and friction in the human body, implants generate debris. This debris may develop toxicity, inflammation and prosthetic unsealing by osseous dissolution. Nature, size, morphology and amount of debris are the parameters influencing the tissue responses. In this paper, we characterised metallic contamination produced by knee prosthesis, composed with TiAl{sub 6}V{sub 4} or Co-Cr-Mo alloys, into surrounding capsular tissue by depth migration, in vivo behaviour, content, size and nature of debris by PIXE (Particle Induced X-ray Emission) method associated with RBS (Rutherford Backscattering Spectroscopy). Debris distribution in the whole articulation is very heterogeneous. Debris migrates several thousand micrometers in tissues, with a characteristic decrease. Solid metallic particles of about micrometer size are found in the most polluted samples, in both alloys TiAl{sub 6}V{sub 4} and Cr-Co-Mo. In the mean volume analysed by PIXE, the concentration mass ratios [Ti]/[V] and [Co]/[Cr] confirm the chemical stability of TiAl{sub 6}V{sub 4} debris and show the chemical evolution of Cr-Co-Mo debris. Development of a protocol to prepare thin targets permits us to correlate PIXE and histological analysis in the same zone. The fibrous tissue (collagen fibres, fibroblasts) and macrophage cells are observed with optical microscope in polluted areas. This protocol could locate other pathologies in ppm contamination range, thanks to the great sensitivity of the PIXE method.

  4. RBS characterisation of SrxBa1-xNb2O6 (SBN) thin films obtained by laser deposition

    International Nuclear Information System (INIS)

    Pantelica, D.; Petris, M.; Negoita, F.; Dinescu, M.; Dinu, R.; Bauerle, D.; Pedarnig, J.; Bauer-Gogonea, S.; Bauer, S.

    1999-01-01

    Sr x Ba 1-x Nb 2 O 6 (SBN) is an attractive material for many applications such as nonvolatile ferroelectric random-access memories. SBN thin films have been grown by different techniques, such as solid source metalorganic chemical vapor deposition, liquid phase epitaxy, sol-gel synthesis and rf-sputter deposition. Pulsed laser deposition (PLD) is a relatively new growth technique which is ideally suited to the epitaxial growth of multicomponent oxides, because complex target compositions can be stoichiometrically reproduced at the substrate. Multilayer SBN/LSCO/TiN/MgO was prepared as follows: the (100) MgO substrate was glued onto a Ni holder with silver paint and the whole assembly was heated radiatively to the deposition temperatures in the range 450-800 deg. C. MgO substrates were annealed in oxygen at 1050 deg. C for 12 hours prior to the deposition of films. A UV-excimer laser (KrF, λ = 248 nm, t(FWHM) = 25 ns) operating at a repetition rate of 5 Hz was used for ablation. The laser fluence was varied between 0.8-2.6 J/cm 2 ; 4000 pulses were given for the deposition of LSCO film and 8000 pulses for the deposition of SBN film. The composition of the film was analysed using RBS. The measurements were conducted using a 7 Li ++ beam at 4.5 MeV provided by the Van de Graaff Tandem accelerator of IFIN-HH. An ordinary backscattering setup was used. The backscattered particles were detected using a passivated ion implanted silicon detector, placed at 145 angle with respect with the beam. The energy resolution for 7 Li at 4 MeV was about 30 keV. The sample surface was perpendicular to the beam direction. For the quantitative analysis of RBS spectra we used the code RUMP. A typical RBS spectrum of a SBN/LSCO/TiN/MgO sample is shown. A simulation is plotted on the same graph. The simulation curve fit well the experimental data. The profiles for different element are flat topped, indicating that the composition is constant with depth. The sharp high and low energy

  5. Characterization of human kidney stones using micro-PIXE and RBS: A comparative study between two different populations

    International Nuclear Information System (INIS)

    Pineda-Vargas, C.A.; Eisa, M.E.M.; Rodgers, A.L.

    2009-01-01

    The micro-PIXE and RBS techniques are used to investigate the matrix as well as the trace elemental composition of calcium-rich human tissues on a microscopic scale. This paper deals with the spatial distribution of trace metals in hard human tissues such as kidney stone concretions, undertaken at the nuclear microprobe (NMP) facility. Relevant information about ion beam techniques used for material characterization will be discussed. Mapping correlation between different trace metals to extract information related to micro-regions composition will be illustrated with an application using proton energies of 1.5 and 3.0 MeV and applied to a comparative study for human kidney stone concretions nucleation region analysis from two different population groups (Sudan and South Africa)

  6. RBS-study of GexSi1-x Compounds Formed by Variable Dose Ge Implantation into Si Wafers

    Directory of Open Access Journals (Sweden)

    Ramírez A.

    2002-01-01

    Full Text Available Amorphous and relaxed epitaxial GeSi films are prepared by Ge-implantation into Si(111 wafers of both 60 keV and 200 keV energetic Ge+-ions with appropriate dose, followed by post-implantation thermal annealing, comprising a single final annealing at a temperature of 900 °C. The implantation dose was varied between 10(14 and 10(17 atoms cm-2. Rutherford backscattering (RBS and channeling analysis was applied in order to explore the formation of a single crystalline Si-Ge compound layer, both prior and after the thermal treatment. The depth and the thickness of the implanted layer, as well as their molar composition and crystalline quality was determined, and it was found that a single crystalline Si-Ge alloy layer was created, with both depth and mole fraction depending on the ion energy and the ion dose.

  7. Impulse control disorders and related behaviours (ICD-RBs) in Parkinson's disease patients: Assessment using "Questionnaire for impulsive-compulsive disorders in Parkinson's disease" (QUIP).

    Science.gov (United States)

    Sharma, Ashish; Goyal, Vinay; Behari, Madhuri; Srivastva, Achal; Shukla, Garima; Vibha, Deepti

    2015-01-01

    There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs) in Indian patients with Parkinson's Disease (PD). In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated "Questionnaire for Impulsive-Compulsive Disorders in Parkinson's disease (QUIP)" and to examine their association with Dopamine replacement therapy (DRT). This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver) were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%), at least one Impulse control disorder (ICD) was present in 74 (24.75%) and at least one Impulse control related compulsive behaviour (ICRB) was present in 93 (31.1%) patients. Punding was the most frequent (12.4%) followed by hyper sexuality (11.04%), compulsive hobbyism (9.4%), compulsive shopping (8.4%), compulsive medication use (7.7%), compulsive eating (5.35%), walkabout (4%) and pathological gambling (3.3%). ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD) were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Our study revealed a relatively higher frequency of ICD-RBs, probably because of the use of screening instrument and because

  8. High Resolution and Differential PIXE combined with RBS, EBS and AFM analysis of magnesium titanate (MgTiO3) multilayer structures

    International Nuclear Information System (INIS)

    Reis, M.A.; Alves, L.C.; Barradas, N.P.; Chaves, P.C.; Nunes, B.; Taborda, A.; Surendran, K.P.; Wu, A.; Vilarinho, P.M.; Alves, E.

    2010-01-01

    Thorough structural characterization of deep laying thin film, including the inference of interdiffusion profiles is frequently a complex problem. The use of RBS/PIXE holistic approaches, already shown to represent a powerful method, sometimes faces difficulties if standard experimental procedures are used. In this work, following a series of 4 He Rutherford backscattering and 1 H elastic backscattering experiments, carried out to study the influence of SrTiO 3 as a possible cladding layer between Pt/TiO 2 /SiO 2 /(1 0 0)Si substrates and MgTiO 3 films, a simple holistic RBS-PIXE is shown to be not enough for the solution of such a problem. Establishing of the Sr depth profile, was only possible after AFM, High-Resolution EDS PIXE and differential PIXE analysis were carried out. Results, problems faced and conclusions obtained are presented.

  9. Characterisation of an enamelled metallic object found in Guerrero Negro (Baja California) by PIXE and RBS techniques

    International Nuclear Information System (INIS)

    Calvo del Castillo, H.; Ruvalcaba, J.L.; Calderon, T.; Salinas Nolasco, M.F.; Mejia, L.M.; Perdigon, K.

    2008-01-01

    The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for enamels

  10. Anti-lock braking system (ABS) and regenerative braking system (RBS) in hybrid electric vehicle for smart transportation system

    Science.gov (United States)

    Evuri, Geetha Reddy; Rao, G. Srinivasa; Reddy, T. Ramasubba; Reddy, K. Srinivasa

    2018-04-01

    Pulse width modulation (PWM) based (a non-consistent) breaking system is used to keep the wheels from being bolted in the proposed antilock breaking system (ABS). Using this method a better hold of the street by wheels is possible and halting separations likewise diminish essentially particularly on precarious street surfaces like frosty or wet streets. The active vitality of the wheel is by and large lost amid braking as warmth because of grinding among brake cushions. This vitality can be recuperated using regenerative braking systems (RBS). In this strategy, the overabundance vitality is put away incidentally in capacitor banks before it gets changed over to warm vitality and is squandered. This framework delays the battery life by reviving the battery utilizing the put away vitality. Subsequently the mileage of the electric vehicle likewise increments as it can travel more separation in a solitary battery charge. These two techniques together help make electric vehicle vitality productive and more secure and less demanding to utilize subsequently anticipating and diminishing the quantity of mischance's.

  11. Characterisation of an enamelled metallic object found in Guerrero Negro (Baja California) by PIXE and RBS techniques

    Energy Technology Data Exchange (ETDEWEB)

    Calvo del Castillo, H. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid (Spain); Instituto de Fisica, Universidad Nacional Autonoma de Mexico (Mexico); Centre Europeen d' Archeometrie - I.P.N.A.S., Universite de Liege, Allee du 6 Aout, 10 Bat-15, Sart Tilman, 4000-Liege 1 (Belgium)], E-mail: hcalvo@ulg.ac.be; Ruvalcaba, J.L. [Instituto de Fisica, Universidad Nacional Autonoma de Mexico (Mexico); Calderon, T. [Departamento de Geologia y Geoquimica, Universidad Autonoma de Madrid (Spain); Salinas Nolasco, M.F. [Coordinacion de Conservacion del Patrimonio Cultural, Instituto Nacional de Antropologia e Historia (Mexico); Mejia, L.M. [Direccion de Arqueologia Subacuatica, Instituto Nacional de Antropologia e Historia (Mexico); Perdigon, K. [Coordinacion de Conservacion del Patrimonio Cultural, Instituto Nacional de Antropologia e Historia (Mexico)

    2008-05-15

    The coast of Guerrero Negro (Baja California) has been known for a long time by archaeologists for its shipwrecks. Archaeologists are recovering objects that come from sunken Spanish galleons in the colonial period, and reach the American coast in the frontier of the USA with Mexico. An enamelled metallic object was found next to the beach in Guerrero Negro. We have analysed the piece with proton induced X-ray emission (PIXE) and Rutherford backscattering (RBS) in an attempt to establish whether the object could come from one of the colonial shipwrecks and to valuate its cleaning process. Scanning electron microscopy (SEM) and energy dispersive X-ray spectrometry (EDS) have been also performed in three samples taken from the object in order to observe the heterogeneity of the material. The materials found revealed the presence of typical lead-glass enamels from with pigments such as cuprite (red), or lead-tin yellow used in colonial times. The metallic part consisted of brass. As for the cleaning process, the average efficiency considered as the weight% of chlorine removed, was of 83.4% for brass and 100% for ename0008.

  12. Cashing in on Tar Sands. RBS, UK banks and Canada's 'blood oil'

    Energy Technology Data Exchange (ETDEWEB)

    Evans, M.; Howarth, C.; Kellay, A.; Laboucan, B.J.; Mercredi, M.; Minio-Paluelo, M.; Schling, H.; Smith, K.; Thomas-Muller, C.; Wood, A.

    2010-03-15

    Tar sands extraction in Canada is devastating Indigenous communities, wildlife and vast areas of boreal forests, as well as being many times more carbon-intensive to produce than 'conventional' oil. The higher oil prices in recent years have meant that it's become a more attractive prospect for oil companies to expand their operations in the costly process of obtaining and processing the thick bitumen into a usable form. It's estimated that the industry is looking for a capital investment of 120-220 billion USD over the next 20 years to build the new pipelines, mines, refineries and upgraders that are necessary to sustain the boom. This report looks at the role that UK banks are playing in providing the necessary capital, and how RBS (Royal Bank of Scotland), which is 84% owned by the UK public, has been the bank the most heavily involved in underwriting loans to companies engaging in tar sands extraction.

  13. RBS and ion channeling studies of Ag-doped YBa2Cu3O7-δ targets and films

    International Nuclear Information System (INIS)

    Li Yupu; Liu, J.R.; Cui, X.T.; Chu, W.K.

    1998-01-01

    The location of Ag in Ag-doped YBa 2 Cu 3 O 7-δ (YBCO) films and other high-T c materials (such as Ag-doped BiSrCaCuO films and Ag-sheathed textured BiSrCaCuO wires) is a very important issue for improving high-T c materials. In this work, laser ablated and DC magnetron sputtered YBCO films on (100) LaAlO 3 and (100) SrTiO 3 were prepared from sintered Ag-YBCO composite targets (nominally containing 5 wt% Ag) and studied by Rutherford backscattering spectrometry (RBS) and ion channeling techniques using 2.0 MeV 4 He + and 7 Li + beams. We have found that the Ag-YBCO targets contain about 3 wt% Ag and most of the retained Ag atoms form some small size Ag precipitates with a typical size smaller than a few microns. We have demonstrated that in very good single crystalline YBCO films, the percentage of retained Ag in substitutional sites can be estimated by ion channeling technique. For example, we have found that about 1.2 wt% Ag atoms remain in the laser ablated Ag-doped films prepared from the Ag-YBCO target and about two-thirds of the retained Ag atoms occupy substitutional sites. The sputtered films contain less retained Ag atoms since the deposition temperature is higher and deposition time is longer than those for laser ablated films. (orig.)

  14. Diffusion Experiments with Opalinus and Callovo-Oxfordian Clays: Laboratory, Large-Scale Experiments and Microscale Analysis by RBS

    International Nuclear Information System (INIS)

    Garcia-Gutierrez, M.; Alonso, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.

    2009-01-01

    Consolidated clays are potential host rocks for deep geological repositories for high-level radioactive waste. Diffusion is the main transport process for radionuclides (RN) in these clays. Radionuclide (RN) diffusion coefficients are the most important parameters for Performance Assessment (PA) calculations of clay barriers. Different diffusion methodologies were applied at a laboratory scale to analyse the diffusion behaviour of a wide range of RN. Main aims were to understand the transport properties of different RNs in two different clays and to contribute with feasible methodologies to improve in-situ diffusion experiments, using samples of larger scale. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed, together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), for diffusion analyses at the micrometer scale. The main experimental and theoretical characteristics of the different methodologies, and their advantages and limitations are here discussed. Experiments were performed with the Opalinus and the Callovo-Oxfordian clays. Both clays are studied as potential host rock for a repository. Effective diffusion coefficients ranged between 1.10 - 10 to 1.10 - 12 m 2 /s for neutral, low sorbing cations (as Na and Sr) and anions. Apparent diffusion coefficients for strongly sorbing elements, as Cs and Co, are in the order of 1.10-13 m 2 /s; europium present the lowest diffusion coefficient (5.10 - 15 m 2 /s). The results obtained by the different approaches gave a comprehensive database of diffusion coefficients for RN with different transport behaviour within both clays. (Author) 42 refs

  15. RBS/channeling analysis of hydrogen-implanted single crystals of FZ silicon and 6H silicon

    International Nuclear Information System (INIS)

    Irwin, R.B.

    1984-01-01

    Single crystals of FZ silicon and 6H silicon carbide were implanted with hydrogen ions (50 and 80 keV, respectively) to fluences from 2 x 10 16 H + /cm 2 to 2 x 10 18 H+/cm 2 . The implantations were carried out at three temperatures: approx.95K, 300 K, and approx.800 K. Swelling of the samples was measured by surface profilometry. RBS/channeling was used to obtain the damage profiles and to determine the amount of hydrogen retained in the lattice. The damage profiles are centered around X/sub m/ for the implants into silicon and around R/sub p/ for silicon carbide. For silicon carbide implanted at 95 K and 300 K and for silicon implanted at 95 K, the peak damage region is amorphous for fluences above 8 x 10 16 H + /cm 2 , 4 x 10 17 H + /cm 2 , and 2 x 10 17 H + /cm 2 , respectively. Silicon implanted at 300 and 800 K and silicon carbide implanted at 800 K remain crystalline up to fluences of 1 x 10 18 H + /cm 2 . The channeling damage results agree with previously reported TEM and electron diffraction data. The predictions of a simple disorder-accumulation model with a linear annealing term explains qualitatively the observed damage profiles in silicon carbide. Quantitatively, however, the model predicts faster development of the damage profiles than is observed at low fluences in both silicon and silicon carbide. For samples implanted at 300 and 800 K, the model also predicts substantially less peak disorder than is observed. The effect of the surface, the retained hydrogen, the shape of S/sub D/(X), and the need for a nonlinear annealing term may be responsible for the discrepancy

  16. Diffusion Experiments with Opalinus and Callovo-Oxfordian Clays: Laboratory, Large-Scale Experiments and Microscale Analysis by RBS

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Gutierrez, M.; Alonso, U.; Missana, T.; Cormenzana, J.L.; Mingarro, M.; Morejon, J.; Gil, P.

    2009-09-25

    Consolidated clays are potential host rocks for deep geological repositories for high-level radioactive waste. Diffusion is the main transport process for radionuclides (RN) in these clays. Radionuclide (RN) diffusion coefficients are the most important parameters for Performance Assessment (PA) calculations of clay barriers. Different diffusion methodologies were applied at a laboratory scale to analyse the diffusion behaviour of a wide range of RN. Main aims were to understand the transport properties of different RNs in two different clays and to contribute with feasible methodologies to improve in-situ diffusion experiments, using samples of larger scale. Classical laboratory essays and a novel experimental set-up for large-scale diffusion experiments were performed, together to a novel application of the nuclear ion beam technique Rutherford Backscattering Spectrometry (RBS), for diffusion analyses at the micrometer scale. The main experimental and theoretical characteristics of the different methodologies, and their advantages and limitations are here discussed. Experiments were performed with the Opalinus and the Callovo-Oxfordian clays. Both clays are studied as potential host rock for a repository. Effective diffusion coefficients ranged between 1.10{sup -}10 to 1.10{sup -}12 m{sup 2}/s for neutral, low sorbing cations (as Na and Sr) and anions. Apparent diffusion coefficients for strongly sorbing elements, as Cs and Co, are in the order of 1.10-13 m{sup 2}/s; europium present the lowest diffusion coefficient (5.10{sup -}15 m{sup 2}/s). The results obtained by the different approaches gave a comprehensive database of diffusion coefficients for RN with different transport behaviour within both clays. (Author) 42 refs.

  17. La cobertura televisiva del fútbol en el Sur de Brasil y de España: RBS – Canal Sur

    Directory of Open Access Journals (Sweden)

    Joaquín M. Marín Montín

    2002-01-01

    Full Text Available Este artículo constituye parte de un trabajo comparativo entre Brasil y España, correspondiente al tratamiento que los medios de comunicación hacen del deporte. En él se analizan las claves que configuran el acercamiento a un mismo fenómeno sociológico, como es el fútbol, en dos realidades culturales diferentes. La programación deportiva de televisión llevada a cabo por Canal Sur en Andalucía y RBS en Rio Grande do Sul, así como la cobertura que ambas cadenas realizan en sus retransmisiones en directo del fútbol completan el análisis del presente estudio.ABSTRACTThis article is part of a comparative research between Brazil and Spain, about how the media treats the sports activities. Besides, this study analyses the keys of the same sociological phenomenon, which is football, in two different cultural realities. The broadcasting on television regarding sports events in Andalusia with Canal Sur, and Rio Grande do Sul with RBS. The live broadcasting of these channels completes the analysis of the present research.

  18. MANUAL JORNALÍSTICO E PRÁTICAS CONTRADITÓRIAS: DIÁLOGO ENTRE O TEXTO DE ZERO HORA E A TRAJETÓRIA DA RBS

    Directory of Open Access Journals (Sweden)

    Maria Berenice da Costa Machado

    2007-08-01

    Full Text Available Para bem refletir sobre um jornal, no caso Zero Hora (ZH, de Porto Alegre, seria necessário, também, resgatar a história da sua controladora, a Rede Brasil Sul (RBS. O exercício fez emergir muitas contradições entre o código normativo do diário e a trajetória do Grupo de comunicação. Oito desses episódios trazemos para o diálogo neste estudo: o uso indiscriminado de nomes e siglas, dos espaços de expressão das opiniões, os cruzamentos do jornalismo – editorial – com a publicidade – comercial –, os desencontros de datas, a estrutura monopolística, os valores propagados, a relação com as pessoas e a parceria com a Rede Globo. Nossa hipótese é de que está na gênese da RBS (e de ZH a “vocação” para o contraditório. PALAVRAS-CHAVE: Zero Hora. Rede Brasil Sul. História. Contradições.

  19. Characterization of the alteration products formed at the surface of LaYSiAlO and CeYSiAlO glasses using ERDA and RBS techniques

    International Nuclear Information System (INIS)

    Gavarini, S.; Trocellier, P.; Matzen, G.

    2004-01-01

    Leaching tests have been performed on LnYSiAlO glasses (Ln = La or Ce) that are considered as potential matrices for the specific immobilization of minor actinides. Elastic recoil detection analysis (ERDA) performed on leached samples indicated a superficial hydration of LaYSiAlO glass of about 100-150 nm. This hydrated layer is (Al, Y)-enriched according to SEM-EDS analysis, suggesting the formation of hydroxide (or hydroxycarbonates) compounds including these two elements. This process leads to a very efficient passivation of the material due to the low solubility of Al and Y hydroxides (and hydroxycarbonates) species in near neutral media, even when the solution is rapidly replenished is dynamic leaching experiments. Rutherford Backscattering Spectrometry elemental mapping revealed very localized and significantly Y-enriched deposits at the surface of the sample after leaching. This could be the sign of heterogeneities already present on the pristine glass. These may be correlated with the weak solubility of yttrium (and rare earth) elements in silicate matrices (Y + Ln initial content in the glass ∼11 at.%). In the case of CeYSiAlO glass, a thin layer was formed on the solid after leaching. The simulation of the corresponding RBS spectra showed a surface (Y, Ce)-enrichment and (Al, Si)-depletion in both cases. This could be explained by the oxidation of trivalent cerium initially present in the glass structure during leaching. This might be explained by the low solubility of Ce(IV)-compounds (CeO 2 and/or Ce(OH) 4 ) in solution leading to an enrichment of this element at the glass/solution interface, to form a mixture of amorphous CeO 2 and Y(OH) 3 , as confirmed by XPS and XRD experiments

  20. Desempeño de un reactor biológico secuencial (RBS en el tratamiento de aguas residuales domésticas

    Directory of Open Access Journals (Sweden)

    Carmen Cárdenas

    2012-07-01

    was divided into four phases in which the organic load and the duration of anaerobic, aerobic and anoxic cycle were modified, considering sludge ages of 10 and 7.5 days. During Phases I and II the system was operated with low mass load values: 0.364 and 0.220 kg.COD/kg.VSS.day, while during Phases III and IV were used heavier loads: 0.665 and 0.737 kg.COD/Kg.VSS.day respectively. The results obtained show that the removal efficiencies of organic matter in terms of BOD were achieved during Phase III (91% and IV (82% with phosphorus removal exceeding 40%. As for the nitrification process during Phases I and II showed rates of 0.032 and 0.024 kg.N-NH3/kg.VSS.day, this due to lower organic matter content and low BOD/TKN, while during phases III and IV these were lower: 0.015 kg.N-NH3/kg.VSS.day during Phase III and 0.020 kg.N-NH3/kg.VSS.day in Phase IV, however, was in these phases which reached the highest levels of denitrification during the anoxic phase, favored by a C/N appropriate next of 4 kg.BOD/kg.N-NO3- and the presence of an easily biodegradable substrate. The results show the RBS as an efficient and viable process in the treatment of domestic wastewater Keywords: sequential biological reactor; nitrification/denitrification; biological removal; sludge age.

  1. Impulse control disorders and related behaviours (ICD-RBs in Parkinson′s disease patients: Assessment using “Questionnaire for impulsive-compulsive disorders in Parkinson′s disease” (QUIP

    Directory of Open Access Journals (Sweden)

    Ashish Sharma

    2015-01-01

    Full Text Available Background: There is limited data on the prevalence of impulse control disorder and related behaviors (ICD-RBs in Indian patients with Parkinson′s Disease (PD. In the context of potential genetic and environmental factors affecting the expression of ICD-RBs, studying other multiethnic populations may bring in-sights into the mechanisms of these disorders. Objectives: To ascertain point prevalence estimate of ICD-RBs in Indian PD patients, using the validated “Questionnaire for Impulsive-Compulsive Disorders in Parkinson′s disease (QUIP” and to examine their association with Dopamine replacement therapy (DRT. Materials and Methods: This was a hospital based observational cross-sectional study. After taking informed consent, patients and their informants (spouse, or primary caregiver were made to complete the QUIP, and were instructed to answer questions based on behaviors that occurred anytime during PD that lasted at least four consecutive weeks. Results: Total of 299 patients participated in the study. At least one ICD-RB was present in 128 (42.8%, at least one Impulse control disorder (ICD was present in 74 (24.75% and at least one Impulse control related compulsive behaviour (ICRB was present in 93 (31.1% patients. Punding was the most frequent (12.4% followed by hyper sexuality (11.04%, compulsive hobbyism (9.4%, compulsive shopping (8.4%, compulsive medication use (7.7%, compulsive eating (5.35%, walkabout (4% and pathological gambling (3.3%. ≥ 2 ICD-RBs were observed in 15.7% of patients. After multivariate analysis, younger age of onset, being unmarried were specifically associated with presence of ICD. Longer disease duration was specifically associated with presence of ICRB. Whereas smoking and higher dopamine levodopa equivalent daily doses (DA LEDD were associated with both presence of ICD and ICRB. Higher LD LEDD was specifically associated with presence of ICD-RB. Conclusions: Our study revealed a relatively higher

  2. VIBA-Lab 3.0: Computer program for simulation and semi-quantitative analysis of PIXE and RBS spectra and 2D elemental maps

    Energy Technology Data Exchange (ETDEWEB)

    Orlić, Ivica; Mekterović, Darko [Department of Physics, University of Rijeka, Radmile Matejčić 2, 51000 Rijeka (Croatia); Mekterović, Igor [Faculty of Electrical Engineering and Computing, University of Zagreb (Croatia); Ivošević, Tatjana [Faculty of Engineering, University of Rijeka, Vukovarska 58, HR-51000 Rijeka (Croatia)

    2015-11-15

    VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster–Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By “running” a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.

  3. VIBA-Lab 3.0: Computer program for simulation and semi-quantitative analysis of PIXE and RBS spectra and 2D elemental maps

    International Nuclear Information System (INIS)

    Orlić, Ivica; Mekterović, Darko; Mekterović, Igor; Ivošević, Tatjana

    2015-01-01

    VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster–Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By “running” a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.

  4. Coupled PIXE and RBS using a 6MeV 4He2+ external beam: A new experimental device for particle detection and dose monitoring

    International Nuclear Information System (INIS)

    Mathis, F.; Moignard, B.; Pichon, L.; Dubreuil, O.; Salomon, J.

    2005-01-01

    AGLAE (Accelerateur Grand Louvre d'Analyses Elementaire), the IBA facility of the 'Centre de Recherche et de Restauration des Musees de France' (C2RMF) has been equipped for several years with an external micro-beam line, in order to perform ion beam analysis on materials relevant to cultural heritage. This beam line is undergoing constant improvement. Recently, a new extraction nozzle for the external beam of the accelerator has been designed in order to obtain simultaneously from the same spot: - detection of the X-ray emission by two detectors, for low and high energies; - detection of the backscattered particles for a backscattering angle between 170 and 175 deg., thanks to an annular surface barrier detector included in the nozzle; - particle current monitoring by intermittent beam deflection on a reference material included in the system. This technical development has been induced by the study of artificial patinas on archaeological copper-alloy objects and the attempt to characterize them with a 6MeV 4 He 2+ beam, an unusual beam for this type of investigation. A detailed description of the new device and some results on an application of the use of high-energy alpha beam in PIXE and RBS made on a Roman strigil are presented here

  5. VIBA-Lab 3.0: Computer program for simulation and semi-quantitative analysis of PIXE and RBS spectra and 2D elemental maps

    Science.gov (United States)

    Orlić, Ivica; Mekterović, Darko; Mekterović, Igor; Ivošević, Tatjana

    2015-11-01

    VIBA-Lab is a computer program originally developed by the author and co-workers at the National University of Singapore (NUS) as an interactive software package for simulation of Particle Induced X-ray Emission and Rutherford Backscattering Spectra. The original program is redeveloped to a VIBA-Lab 3.0 in which the user can perform semi-quantitative analysis by comparing simulated and measured spectra as well as simulate 2D elemental maps for a given 3D sample composition. The latest version has a new and more versatile user interface. It also has the latest data set of fundamental parameters such as Coster-Kronig transition rates, fluorescence yields, mass absorption coefficients and ionization cross sections for K and L lines in a wider energy range than the original program. Our short-term plan is to introduce routine for quantitative analysis for multiple PIXE and XRF excitations. VIBA-Lab is an excellent teaching tool for students and researchers in using PIXE and RBS techniques. At the same time the program helps when planning an experiment and when optimizing experimental parameters such as incident ions, their energy, detector specifications, filters, geometry, etc. By "running" a virtual experiment the user can test various scenarios until the optimal PIXE and BS spectra are obtained and in this way save a lot of expensive machine time.

  6. If it works there, will it work here? The effect of a multi-component responsible beverage service (RBS) programme on violence in Oslo.

    Science.gov (United States)

    Skardhamar, Torbjørn; Fekjær, Silje Bringsrud; Pedersen, Willy

    2016-12-01

    The Stockholm Prevents Alcohol and Drug Problems (STAD) programme has been regarded as one of the most successful programmes to date, in reducing alcohol-related violence. This multi-component Responsible Beverage Service (RBS) programme was implemented in Stockholm, Sweden, and has been documented to be extremely effective in reducing alcohol-related nightlife violence. The SALUTT programme in Oslo, Norway was carefully modelled on the STAD project. We investigate whether the results from STAD were replicated in the SALUTT intervention. Using geocoded data, the level of violence in the intervention area was compared with different control areas before and after the intervention. Autoregressive moving average models (ARIMA). The SALUTT programme had no statistically significant effect on violence. However, the level of violence in the different potential control areas of Oslo fluctuated without a clear common trend. Hence, it was difficult to establish proper control areas. The results from the Swedish STAD-intervention were not replicated in Oslo. Successful interventions are not necessarily replicated in other contexts, and the current literature does not shed sufficient light on the conditions under which such interventions actually work. Moreover, more attention should be devoted to the identification of adequate control areas in future research. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  7. RBS characterization of the deposition of very thin SiGe/SiO2 multilayers by LPCVD

    International Nuclear Information System (INIS)

    Munoz-Martin, A.; Climent-Font, A.; Rodriguez, A.; Sangrador, J.; Rodriguez, T.

    2005-01-01

    Multilayer structures consisting of several alternated layers of SiGe and SiO 2 with thickness ranging from 2 or Si as well as the deposition of SiO 2 on Si show negligible incubation times. The deposition of SiO 2 on SiGe, however, exhibits an incubation time of several minutes, which would be related to the oxidation of the surface necessary for the SiO 2 deposition to start. In all cases the film thickness increases linearly with deposition time, thus allowing the growth rates to be determined. These data allow the deposition process of these very thin layers to be accurately controlled

  8. Instrumentation for PIXE and RBS

    International Nuclear Information System (INIS)

    2000-12-01

    The purpose of this document is to give an overview of instrumentation for PIXE and Rutherford backscattering analysis, including hardware and software needed to perform the analysis, including detectors, analyzers, data acquisition systems and data analysis software. It also provides some information on accelerators needed for these applications

  9. Scania RBS brake system; Das Bremssystem EBS von Scania

    Energy Technology Data Exchange (ETDEWEB)

    Winterhagen, J.

    1996-09-01

    Scania claims to be the first producer of industrial vehicles to market an electronic braking system (EBS) combined with disc brakes for all axles. The new braking systems for long-distance trailers were presented for the first time at the IAA, Hanover, in September 1996. (orig.) [Deutsch] Scania ist nach eigenen Angaben der erste Lkw-Hersteller, der eine elektronisch geregelte Bremsanlage (EBS) in Kombination mit Scheibenbremsen an allen Achsen auf den Markt bringt. Der Oeffentlichkeit stellt Scania das neue Bremssystem fuer die Fernverkehrs-Zugmaschinen der Baureihe 4 zum ersten Mal auf der IAA in Hannover im September 1996 vor. (orig.)

  10. 7 CFR 2003.26 - Functional organization of RBS.

    Science.gov (United States)

    2010-01-01

    ... business plans for new cooperatives. It provides research, analysis, and technical assistance to rural... way that empowers communities. It develops methods for working with rural business intermediaries to... BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE...

  11. RBS study of Ti/ZnO interface

    International Nuclear Information System (INIS)

    Rahman, A.M.A.; Narusawa, T.

    2008-01-01

    We have studied the interface stability of the Ti(overlayer)/ZnO(substrate) system. Ti thin film was grown on the Zn face of single crystal ZnO(0 0 0 1) substrate by the vacuum deposition technique. The Ti film thickness was typically 16 nm. Then the samples were annealed in air at 300 and 400 deg. C for 15 min, respectively. The deposition and annealing effects on the interface structure were investigated with Rutherford backscattering and channeling spectroscopy using 2 MeV He + ion beam. After Ti deposition the minimum yield from the ZnO substrate increased from 2% to 7%. This suggests severe damage caused by deposition, i.e. the interface reaction between Ti and ZnO (even at room temperature). A significant amount of Zn (approximately 6.4 x 10 16 atoms/cm 2 ) moved onto the surface after post-annealing at 400 deg. C. Since Ti has a stronger tendency to react with O than Zn, it is expected that Ti reacts with substrate oxygen leaving behind free Zn atoms, which can easily migrate onto the surface. We discuss how the Ti/ZnO interface reaction in detail, and seek to find another good metallic contact for ZnO devices, which are attracting much attention recently for practical applications as well as scientific aspects

  12. Computer simulation of RBS spectra from samples with surface roughness

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Hnatowicz, Vladimír; Macková, Anna

    2016-01-01

    Roč. 371, MAR (2016), s. 101-105 ISSN 0168-583X. [22nd International conference on Ion Beam Analysis (IBA). Opatija, 14.06.2015-19.06.2015] R&D Projects: GA MŠk(CZ) LM2011019; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : computer simulation * Rutherford backscattering * surface roughness Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.109, year: 2016

  13. RBS and SEM analysis of the nickel-fullerene hybrid systems

    Czech Academy of Sciences Publication Activity Database

    Vacík, Jiří; Naramoto, J.; Narumi, K.; Yamanoto, S.; Abe, J.

    2003-01-01

    Roč. 206, - (2003), s. 395-398 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nicke-fullerene hybrid Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.041, year: 2003

  14. The influence of the beam charge state on the analytical calculation of RBS and ERDA spectra

    Energy Technology Data Exchange (ETDEWEB)

    Barradas, Nuno P., E-mail: nunoni@ctn.ist.utl.pt [Centro de Ciências e Tecnologias Nucleares, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10 ao km 139,7, 2695-066 Bobadela LRS (Portugal); Kosmata, Marcel [Helmholtz-Zentrum Dresden-Rossendorf, Bautzner Landstraße 400, 01328 Dresden (Germany); Globalfoundries, Wilschdorfer Landstraße 101, 01109 Dresden (Germany); Hanf, Daniel; Munnik, Frans [Helmholtz-Zentrum Dresden-Rossendorf, Bautzner Landstraße 400, 01328 Dresden (Germany)

    2016-03-15

    Analytical codes dedicated to the analysis of Ion Beam Analysis data rely on the accuracy of both the calculations and of basic data such as scattering cross sections and stopping powers. So far, the effect of the beam charge state of the incoming beam has been disregard by general purpose analytical codes such as NDF. In fact, the codes implicitly assume that the beam always has the equilibrium charge state distribution, by using tabulated stopping power values e.g. from SRIM, which are in principle valid for the effective charge state. The dependence of the stopping power with the changing charge state distribution is ignored. This assumption is reasonable in most cases, but for high resolution studies the actual change of the charge state distribution from the initial beam charge state towards equilibrium as it enters and traverses the sample must be taken into account, as it influences the shape of the observed data. In this work, we present an analytical calculation, implemented in NDF, that takes this effect into account. For elastic recoil detection analysis (ERDA), the changing charge state distribution of the recoils can also be taken into account. We apply the calculation to the analysis of experimental high depth resolution ERDA data for various oxide layers collected using a magnetic spectrometer.

  15. Characterization for rbs of layers de grown cdznse for chemical deposition (cbd)

    International Nuclear Information System (INIS)

    Pedrero, E.; Larramendi, E.; Calzadilla, O.

    1999-01-01

    Depth and composition of CdZnSe thin films grown by Chemical Bath Deposition were characterized by Rutherford Backscattering Spectrometry. Depth and the relative cuantitity of Se, both decrease when annealed in air. The films have a non-stoichiometric Cd:Zn:Se composition constant from the substrate to the surface , with vacancies of Se. After annealing all the films come up to a similar composition: Cd( Zn 0.2 )Se

  16. Simulation of RBS spectra with known 3D sample surface roughness

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Siegel, J.; Hnatowicz, Vladimír; Macková, Anna; Švorčík, V.

    2017-01-01

    Roč. 406, SEP (2017), s. 99-103 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : computer simulation * surface roughness * AFM Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 1.109, year: 2016

  17. Perfect Composition Depth Profiling of Ionic Liquid Surfaces Using High-Resolution RBS/ERDA.

    Czech Academy of Sciences Publication Activity Database

    Nakajima, K.; Zolboo, E.; Ohashi, T.; Lísal, Martin; Kimura, K.

    2016-01-01

    Roč. 32, č. 10 (2016), s. 1089-1094 ISSN 0910-6340 R&D Projects: GA ČR(CZ) GA16-12291S Institutional support: RVO:67985858 Keywords : surface structure * ionic liquid * hydrogen Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.228, year: 2016

  18. Comparison of SIMS and RBS for depth profiling of silica glasses implanted with metal ions

    Czech Academy of Sciences Publication Activity Database

    Lorinčík, Jan; Veselá, D.; Vytykáčová, S.; Švecová, B.; Nekvindová, P.; Macková, Anna; Mikšová, Romana; Malinský, Petr; Boettger, R.

    2016-01-01

    Roč. 34, č. 3 (2016), č. článku 03H129. ISSN 1071-1023 R&D Projects: GA ČR GA15-01602S; GA MŠk(CZ) LM2011019 Institutional support: RVO:67985882 ; RVO:61389005 Keywords : Nanoparticles * Spectroscopy * Backscattering Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 1.573, year: 2016

  19. ERDA, RBS, TEM and SEM characterization of microstructural evolution in helium-implanted Hastelloy N alloy

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Jie [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Bao, Liangman [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Huang, Hefei, E-mail: huanghefei@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Li, Yan, E-mail: liyan@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Lei, Qiantao [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Deng, Qi [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Liu, Zhe; Yang, Guo [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); School of Physical Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China); Shi, Liqun [Institute of Modern Physics, Fudan University, Shanghai 200433 (China)

    2017-05-15

    Hastelloy N alloy was implanted with 30 keV, 5 × 10{sup 16} ions/cm{sup 2} helium ions at room temperature, and subsequent annealed at 600 °C for 1 h and further annealed at 850 °C for 5 h in vacuum. Using elastic recoil detection analysis (ERDA) and transmission electron microscopy (TEM), the depth profiles of helium concentration and helium bubbles in helium-implanted Hastelloy N alloy were investigated, respectively. The diffusion of helium and molybdenum elements to surface occurred during the vacuum annealing at 850 °C (5 h). It was also observed that bubbles in molybdenum-enriched region were much larger in size than those in deeper region. In addition, it is worth noting that plenty of nano-holes can be observed on the surface of helium-implanted sample after high temperature annealing by scanning electron microscope (SEM). This observation provides the evidence for the occurrence of helium release, which can be also inferred from the results of ERDA and TEM analysis.

  20. Characterisation of annealed Fe/Ag bilayers by RBS and XRD

    Energy Technology Data Exchange (ETDEWEB)

    Tunyogi, A., E-mail: tunyogi@rmki.kfki.h [KFKI Research Institute for Particle and Nuclear Physics, H-1525 Budapest, P.O. Box 49 (Hungary); Tancziko, F.; Bogdan, Cs. [KFKI Research Institute for Particle and Nuclear Physics, H-1525 Budapest, P.O. Box 49 (Hungary); Horvath, Z.E. [Research Institute for Technical Physics and Materials Science, H-1525 Budapest, P.O. Box 49 (Hungary); Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, H-1525 Budapest, P.O. Box 49 (Hungary)

    2010-06-15

    Recently Fe/Ag thin films have been intensively investigated due to their special magnetic properties. To study the stability of the Fe-Ag interfaces very long time experiments are necessary at room temperature. To enhance the processes which take place at interfaces, high temperature annealing can be used. A detailed annealing experiment was carried out on Si-covered Fe/Ag (Ag grown on Fe) and Ag/Fe (Fe grown on Ag) polycrystalline bilayers, which were deposited on Si(1 1 1) substrates by MBE method. Heat treatments of various duration and temperature were applied in UHV conditions. Rutherford backscattering spectrometry and X-ray diffractometry were used to determine the effects of the heat treatments. In case of Fe/Ag samples, formation of iron-silicide phases was observed between the Fe layer and Si substrate, and the silver and the silicon capping layer were also completely mixed with each other. In case of the Ag/Fe samples the silver moved to the sample surface through the iron layers, while iron shifted to the substrate and mixed with silicon.

  1. Surface Segregation in a Binary Mixture of Ionic Liquids: Comparison between High-Resolution RBS Measurements and Molecular Dynamics Simulations.

    Czech Academy of Sciences Publication Activity Database

    Nakajima, K.; Nakanishi, S.; Chval, Z.; Lísal, Martin; Kimura, K.

    2016-01-01

    Roč. 145, č. 18 (2016), s. 184704 ISSN 0021-9606 R&D Projects: GA ČR(CZ) GA16-12291S Institutional support: RVO:67985858 Keywords : rutherford backscattering spectroscopy * vapor interface * tensions Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.965, year: 2016

  2. Surface Structure of Imidazolium-based Ionic Liquids: Quantitative Comparison between Simulations and High-resolution RBS Measurements.

    Czech Academy of Sciences Publication Activity Database

    Nakajima, K.; Nakanishi, S.; Lísal, Martin; Kimura, K.

    2016-01-01

    Roč. 144, č. 11 (2016), s. 114702 ISSN 0021-9606 R&D Projects: GA ČR GA16-12291S Institutional support: RVO:67985858 Keywords : spectroscopy * rutherford backscattering spectroscopy * molten-salt Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.965, year: 2016

  3. RBS analysis of substoichiometric TiO{sub 2}-anatase thin films for visible-light photocatalysis

    Energy Technology Data Exchange (ETDEWEB)

    Ager, F.J. [Depto. Fisica Aplicada I, Escuela Universitaria Politecnica, Universidad de Sevilla, C. Virgen de Africa 7, E-41011 Sevilla (Spain) and Centro Nacional de Aceleradores, Av. Thomas A. Edison, E-41092 Sevilla (Spain)]. E-mail: fjager@us.es; Justicia, I. [ICMAB/CSIC, Campus UAB, 08193 Bellaterra (Spain); Gerbasi, R. [Istituto di Chimica Inorganica e delle Superficie, Corso Stati Uniti 4, I-35127 Padova (Italy); Battiston, G.A. [Istituto di Chimica Inorganica e delle Superficie, Corso Stati Uniti 4, I-35127 Padova (Italy); McSporran, N. [ICMAB/CSIC, Campus UAB, 08193 Bellaterra (Spain); Figueras, A. [ICMAB/CSIC, Campus UAB, 08193 Bellaterra (Spain); CFATA-UNAM, Juriquilla, Queretaro, C.P. 76230 Queretaro (Mexico)

    2006-08-15

    The anatase phase of TiO{sub 2} is the most promising photocatalyst for organic pollutants degradation. However, due to the large anatase band gap energy the possibility of using visible sunlight as energy source for the photocalatysis activation is ruled out and ultraviolet (UV) radiation with a wave length below the critical limit is thus required. Inducing defects in the anatase crystalline structure in the form of oxygen substoichiometry may theoretically reduce this large band gap energy. This paper focuses on the determination of the stoichiometry of TiO{sub 2} thin films and its influence on the photodegradation properties.

  4. Iron site location in Fe-diffused lithium niobate crystals by combined RBS-PIXE-NRA analysis

    Energy Technology Data Exchange (ETDEWEB)

    Zaltron, A. [University of Padova and CNISM, Via Marzolo 8, 35131 Padova (Italy); Argiolas, N., E-mail: nicola.argiolas@unipd.it [University of Padova and CNISM, Via Marzolo 8, 35131 Padova (Italy); Laboratori Nazionali di Legnaro, Istituto Nazionale Fisica Nucleare, Viale dell' Universita 2, 35020 Legnaro (Padova) (Italy); De Salvador, D.; Bazzan, M. [University of Padova and CNISM, Via Marzolo 8, 35131 Padova (Italy); Laboratori Nazionali di Legnaro, Istituto Nazionale Fisica Nucleare, Viale dell' Universita 2, 35020 Legnaro (Padova) (Italy); Ciampolillo, M.V.; Bacci, L.; Sada, C. [University of Padova and CNISM, Via Marzolo 8, 35131 Padova (Italy)

    2012-03-15

    Iron diffused x-cut lithium niobate samples have been studied from a structural point of view by ion beam analysis techniques in channeling conditions. The aim of this work is to determine the most probable position of iron atoms after high temperature diffusion treatment in pure oxygen atmosphere and to verify their location after an additional full reducing annealing at low temperature. The results are compared with the bulk doping case that can be considered the final equilibrium state of the diffusion process. By comparing the iron signal with niobium and lithium counterparts in angular scans along proper crystallographic directions, we demonstrate that iron occupies in any case the lithium site or a very close position regardless of the reduction degree, just as in the case of bulk doped samples.

  5. RBS-channeling study of radiation damage in Ar{sup +} implanted CuInSe{sub 2} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Yakushev, Michael V., E-mail: michael.yakushev@strath.ac.uk [Department of Physics, SUPA, Strathclyde University, Glasgow G4 0NG (United Kingdom); Ural Federal University, Ekaterinburg 620002 (Russian Federation); Institute of Solid State Chemistry of the Urals Branch of RAS, Ekaterinburg 620990 (Russian Federation); Volkov, Vladimir A. [Ural Federal University, Ekaterinburg 620002 (Russian Federation); Mursakulov, Niyazi N.; Sabzaliyeva, Chimnaz E. [Institute of Physics, National Academy of Sciences of Azerbaijan, H.Cavid ave., 33, AZ-1143 Baku (Azerbaijan); Martin, Robert W. [Department of Physics, SUPA, Strathclyde University, Glasgow G4 0NG (United Kingdom)

    2016-09-15

    Chalcopyrite solar cells are reported to have a high tolerance to irradiation by high energy electrons or ions, but the origin of this is not well understood. This work studies the evolution of damage in Ar{sup +}-bombarded CuInSe{sub 2} single crystal using Rutherford backscattering/channeling analysis. Ar{sup +} ions of 30 keV were implanted with doses in the range from 10{sup 12} to 3 × 10{sup 16} cm{sup −2} at room temperature. Implantation was found to create two layers of damage: (1) on the surface, caused by preferential sputtering of Se and Cu atoms; (2) at the layer of implanted Ar, possibly consisting of stacking faults and dislocation loops. The damage in the second layer was estimated to be less than 2% of the theoretical prediction suggesting efficient healing of primary implantation defects.

  6. Artificial neural network analysis of RBS data with roughness: Application to Ti{sub 0.4}Al{sub 0.6}N/Mo multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Oehl, G.; Matias, V.; Vieira, A.; Barradas, N.P. E-mail: nunoni@itn.mces.pt

    2003-10-01

    In multilayered Ti{sub 0.4}Al{sub 0.6}N/Mo coatings, a strengthening effect can be obtained by using alternate layers of materials with high and low elastic constants. This behaviour requires a multilayer periodicity below a certain value in order to reduce dislocation motion across layer interface. Below this critical period, in most cases the hardness decreases as the period decreases. The multiple interfaces have an important role on this behaviour, working as stress relaxation areas and preventing crack propagation, influencing the mechanical properties of the system. Understanding the origin of these effects requires knowledge of the interface structure, where the interfacial roughness is of prime importance. We used Rutherford backscattering to study roughness in a quantitative way, and developed an artificial neural network algorithm dedicated to the analysis of the data. The results compare very well with previous TEM and AFM data.

  7. Elastic Scattering of 7Li+27Al at Backward Angles in the 7-11 MeV Energy Range for Application in RBS

    International Nuclear Information System (INIS)

    Carnelli, P. F. F.; Arazi, A.; Cardona, M. A.; Figueira, J. M.; Hojman, D.; Martinez Heimann, D.; Negri, A. E.; Pacheco, A. J.; Abriola, D.; Capurro, O. A.; Fimiani, L.; Grinberg, P.; Marti, G. V.; Fernandez Niello, J. O.

    2010-01-01

    We have measured elastic excitation functions for the 7 Li+ 27 Al system, in an energy range close to its Coulomb barrier (E lab = 8.4 MeV) in steps of 0.25 MeV. For this purpose, an array of eight surface-barrier detectors was used. To get an insight on the background composition (mainly α particles), a telescope-detector was used for atomic-number identification. Identical measurements for the 6 Li+ 27 Al system are planned for the near future.

  8. Analysis rbs of CdS thin films grown by cbd to different intensities of the magnetic field and temperature of the chemical bath

    International Nuclear Information System (INIS)

    Pedrero, E.; Vigil, O.

    1999-01-01

    Depth and composition of CdS thin films grown by chemical bath deposition under different temperature and magnetic DC field conditions, were determined by Rutherford Backscattering Spectrometry. The above parameters were evaluated as a function of the bath temperature and the intensity of the induction magnetic field applied

  9. Surface segregation of Ge during Si growth on Ge/Si(0 0 1) at low temperature observed by high-resolution RBS

    International Nuclear Information System (INIS)

    Nakajima, K.; Hosaka, N.; Hattori, T.; Kimura, K.

    2002-01-01

    The Si/Ge/Si(0 0 1) multilayer with about 1 ML Ge layer is fabricated by evaporating Si overlayer on a Ge/Si(0 0 1) surface at 20-300 deg. C. The depth profile of the Ge atoms is observed by high-resolution Rutherford backscattering spectroscopy to investigate the possibility of Ge delta doping in Si. The observed profile of the Ge atoms spreads over several atomic layers even at 20 deg. C and a significant amount of Ge is located in the surface layer at higher temperatures. The results at 20-150 deg. C are well explained with two-layer model for surface segregation of the Ge atoms and the segregation rates are estimated. The activation energy for surface segregation of Ge atoms in amorphous Si is evaluated to be 0.035 eV, which is much smaller than the value reported for Si deposition at 500 deg. C. The small activation energy suggests that local heating during the Si deposition is dominant at low temperature

  10. Effectiveness and economic analysis of the whole cell/recombinant B subunit (WC/rbs inactivated oral cholera vaccine in the prevention of traveller's diarrhoea

    Directory of Open Access Journals (Sweden)

    Diez-Diaz Rosa

    2009-05-01

    Full Text Available Abstract Background Nowadays there is a debate about the indication of the oral whole-cell/recombinant B-subunit cholera vaccine (WC/rBS in traveller's diarrhoea. However, a cost-benefit analysis based on real data has not been published. Methods A cost-effectiveness and cost-benefit study of the oral cholera vaccine (WC/rBS, Dukoral® for the prevention of traveller's diarrhoea (TD was performed in subjects travelling to cholera risk areas. The effectiveness of WC/rBS vaccine in the prevention of TD was analyzed in 362 travellers attending two International Vaccination Centres in Spain between May and September 2005. Results The overall vaccine efficacy against TD was 42,6%. Direct healthcare-related costs as well as indirect costs (lost vacation days subsequent to the disease were considered. Preventive vaccination against TD resulted in a mean saving of 79.26 € per traveller. Conclusion According to the cost-benefit analysis performed, the recommendation for WC/rBS vaccination in subjects travelling to zones at risk of TD is beneficial for the traveller, regardless of trip duration and visited continent.

  11. Characterization for rbs of Titanium Oxide thin films grown by Dip Coating in a coloidal suspension of nano structured Titanium Oxide

    International Nuclear Information System (INIS)

    Pedrero, E.; Vigil, E.; Zumeta, I.

    1999-01-01

    The depth of Titanium Oxide thin films grown by Dip Coating in a coloidal suspension of nano structured Titanium Oxide was characterized using Rutherford Backscattering Spectrometry. Film depths are compared in function of bath and suspension parameters

  12. Microprobe PIXE study of Ni–Ge interactions in lateral diffusion couples

    Energy Technology Data Exchange (ETDEWEB)

    Chilukusha, D. [Department of Physics, University of Zambia, P.O. Box 32379, Lusaka 10101 (Zambia); Pineda-Vargas, C.A. [iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa); Faculty of Health & Wellness Sciences, CPUT, Bellville (South Africa); Nemutudi, R. [iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa); Habanyama, A. [Department of Physics, Copperbelt University, P.O. Box 21692, Jambo Drive, Riverside, Kitwe 10101 (Zambia); Comrie, C.M. [iThemba LABS, National Research Foundation, P.O. Box 722, Somerset West 7129 (South Africa)

    2015-11-15

    Rutherford backscattering spectrometry on the nuclear microprobe (μRBS) is often used in studies of lateral diffusion couples. RBS requires that the positions of the interacting species on the periodic table are not too close in terms of atomic number and therefore do not produce excessive RBS peak overlap. In order to satisfactorily characterize systems that have atomic numbers which are close, it is necessary to find techniques which can complement μRBS. The aim of this study was to determine the extent to which particle induced X-ray emission (PIXE) could be applied in the lateral diffusion couple study of a system with relatively close atomic numbers. This was with a view that it may eventually be adopted to study systems where the atomic numbers are too close for RBS analysis. The system studied here was the Ni–Ge binary system. Since RBS is an established technique for studying lateral diffusion couples, we used it as a standard for comparison. The PIXE results showed a maximum error of 12% with reference to the RBS standard. In order to achieve the most effective use of PIXE in lateral diffusion couple studies we recommend the use of the technique in such a way as to obtain depth information and the use of relatively thick sample layers.

  13. Development and process evaluation of a Web-based responsible beverage service training program.

    Science.gov (United States)

    Danaher, Brian G; Dresser, Jack; Shaw, Tracy; Severson, Herbert H; Tyler, Milagra S; Maxwell, Elisabeth D; Christiansen, Steve M

    2012-09-22

    Responsible beverage service (RBS) training designed to improve the appropriate service of alcohol in commercial establishments is typically delivered in workshops. Recently, Web-based RBS training programs have emerged. This report describes the formative development and subsequent design of an innovative Web-delivered RBS program, and evaluation of the impact of the program on servers' knowledge, attitudes, and self-efficacy. Formative procedures using focus groups and usability testing were used to develop a Web-based RBS training program. Professional alcohol servers (N = 112) who worked as servers and/or mangers in alcohol service settings were recruited to participate. A pre-post assessment design was used to assess changes associated with using the program. Participants who used the program showed significant improvements in their RBS knowledge, attitudes, and self-efficacy. Although the current study did not directly observe and determine impact of the intervention on server behaviors, it demonstrated that the development process incorporating input from a multidisciplinary team in conjunction with feedback from end-users resulted in creation of a Web-based RBS program that was well-received by servers and that changed relevant knowledge, attitudes, and self-efficacy. The results also help to establish a needed evidence base in support of the use of online RBS training, which has been afforded little research attention.

  14. RBS studies of the lattice damage caused by 1 MeV Si+ implantation into Al0.3Ga0.7As/GaAs superlattices at elevated temperature

    International Nuclear Information System (INIS)

    Xu Tianbing; Zhu Peiran; Zhou Junsi; Li Daiqing; Gong Baoan; Wan Ya; Mu Shanming; Zhao Qingtai; Wang Zhonglie

    1994-01-01

    The lattice damage accumulation in GaAs and Al 0.3 Ga 0.7 As/GaAs superlattices by 1 MeV Si + irradiation at room temperature and 350 C has been studied. For irradiations at 350 C, at lower doses the samples were almost defect-free after irradiation, while a large density of accumulated defects was induced at a higher dose. The critical dose above which the damage accumulation is more efficient is estimated to be 2 x 10 15 Si/cm 2 for GaAs, and is 5 x 10 15 Si/cm 2 for Al 0.8 Ga 0.7 As/GaAs superlattice for implantation with 1.0 MeV Si ions at 350 C. The damage accumulation rate for 1 MeV Si ion implantation in Al 0.3 Ga 0.7 As/GaAs superlattice is less than that in GaAs. (orig.)

  15. Fusion proteins of HIV-1 envelope glycoprotein gp120 with CD4-induced antibodies showed enhanced binding to CD4 and CD4 binding site antibodies

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Weizao, E-mail: chenw3@mail.nih.gov [Protein Interactions Group, Frederick National Laboratory for Cancer Research, National Cancer Institute, National Institutes of Health, Frederick, MD 21702 (United States); Feng, Yang [Protein Interactions Group, Frederick National Laboratory for Cancer Research, National Cancer Institute, National Institutes of Health, Frederick, MD 21702 (United States); Wang, Yanping [Protein Interactions Group, Frederick National Laboratory for Cancer Research, National Cancer Institute, National Institutes of Health, Frederick, MD 21702 (United States); The Basic Research Program, Science Applications International Corporation-Frederick, Inc., National Cancer Institute, National Institutes of Health, Frederick, MD 21702 (United States); Zhu, Zhongyu; Dimitrov, Dimiter S. [Protein Interactions Group, Frederick National Laboratory for Cancer Research, National Cancer Institute, National Institutes of Health, Frederick, MD 21702 (United States)

    2012-09-07

    Highlights: Black-Right-Pointing-Pointer Some recombinant HIV-1 gp120s do not preserve their conformations on gp140s. Black-Right-Pointing-Pointer We hypothesize that CD4i antibodies could induce conformational changes in gp120. Black-Right-Pointing-Pointer CD4i antibodies enhance binding of CD4 and CD4bs antibodies to gp120. Black-Right-Pointing-Pointer CD4i antibody-gp120 fusion proteins could have potential as vaccine immunogens. -- Abstract: Development of successful AIDS vaccine immunogens continues to be a major challenge. One of the mechanisms by which HIV-1 evades antibody-mediated neutralizing responses is the remarkable conformational flexibility of its envelope glycoprotein (Env) gp120. Some recombinant gp120s do not preserve their conformations on gp140s and functional viral spikes, and exhibit decreased recognition by CD4 and neutralizing antibodies. CD4 binding induces conformational changes in gp120 leading to exposure of the coreceptor-binding site (CoRbs). In this study, we test our hypothesis that CD4-induced (CD4i) antibodies, which target the CoRbs, could also induce conformational changes in gp120 leading to better exposed conserved neutralizing antibody epitopes including the CD4-binding site (CD4bs). We found that a mixture of CD4i antibodies with gp120 only weakly enhanced CD4 binding. However, such interactions in single-chain fusion proteins resulted in gp120 conformations which bound to CD4 and CD4bs antibodies better than the original or mutagenically stabilized gp120s. Moreover, the two molecules in the fusion proteins synergized with each other in neutralizing HIV-1. Therefore, fusion proteins of gp120 with CD4i antibodies could have potential as components of HIV-1 vaccines and inhibitors of HIV-1 entry, and could be used as reagents to explore the conformational flexibility of gp120 and mechanisms of entry and immune evasion.

  16. Annealing damage caused by implantation of group IB elements into silicon

    International Nuclear Information System (INIS)

    Johansen, A.; Svenningsen, B.; Chadderton, L.T.; Whitton, J.L.

    1976-01-01

    Transmission electron microscopy (TEM) and the Rutherford backscattering method (RBS) have been used in an investigation of the annealing of radiation damage produced in silicon by 80 keV Cu + , Ag + and Au + ions up to doses of 10 15 ions/cm 2 . Whilst the damage caused by Cu + and Ag + implantation, measured by RBS, persists following annealing sequences up to temperatures of 800 0 C, Au + -implanted samples show recovery. Furthermore, RBS indicates quite clearly that, in the case of gold, atomic diffusion to the silicon surface takes place. TEM and electron diffraction both indicate that in all three implants the anomalous 'damage' remaining in RBS spectra is due to an amorphous-polycrystalline transition. In the case of Au + implants, however, there is less inhibition of the process of recovery, quite apart from the thermal history of the sample. The importance of using another technique, especially TEM, in conjunction with RBS investigations of radiation damage in the solid state is emphasized. (author)

  17. Non-destructive study of ancient documents and books by means of ion beams; Estudio no destructivo de documentos y libros antiguos mediante haces de iones

    Energy Technology Data Exchange (ETDEWEB)

    Ruvalcaba S, J.L.; Monroy, M. [IFUNAM, A.P. 20-364, 01000 Mexico D.F. (Mexico)

    2004-07-01

    In this work, a non destructive methodology for the analysis of ancient manuscripts and books using an external beam system and the techniques Particle Induced X-ray Emission Spectroscopy (PIXE) and Rutherford Backscattering Spectrometry (RBS) is presented. This application shows the analytical features of the particle accelerator based techniques for the characterization of this kind of historical materials. This methodology was used for the analysis of inks of an European book from XVII century. This is the first study in Mexico of an ancient book using simultaneously PIXE and RBS non-vacuum techniques. (Author) 21 refs., 9 figs.

  18. Non-destructive study of ancient documents and books by means of ion beams

    International Nuclear Information System (INIS)

    Ruvalcaba S, J.L.; Monroy, M.

    2004-01-01

    In this work, a non destructive methodology for the analysis of ancient manuscripts and books using an external beam system and the techniques Particle Induced X-ray Emission Spectroscopy (PIXE) and Rutherford Backscattering Spectrometry (RBS) is presented. This application shows the analytical features of the particle accelerator based techniques for the characterization of this kind of historical materials. This methodology was used for the analysis of inks of an European book from XVII century. This is the first study in Mexico of an ancient book using simultaneously PIXE and RBS non-vacuum techniques. (Author) 21 refs., 9 figs

  19. White Shrimp Litopenaeus vannamei That Have Received Gracilaria tenuistipitata Extract Show Early Recovery of Immune Parameters after Ammonia Stressing

    Directory of Open Access Journals (Sweden)

    Yu-Yuan Chen

    2015-06-01

    Full Text Available White shrimp Litopenaeus vannamei immersed in seawater (35‰ containing Gracilaria tenuistipitata extract (GTE at 0 (control, 400, and 600 mg/L for 3 h were exposed to 5 mg/L ammonia-N (ammonia as nitrogen, and immune parameters including hyaline cells (HCs, granular cells (GCs, including semi-granular cells, total hemocyte count (THC, phenoloxidase (PO activity, respiratory bursts (RBs, superoxide dismutase (SOD activity, lysozyme activity, and hemolymph protein level were examined 24~120 h post-stress. The immune parameters of shrimp immersed in 600 mg/L GTE returned to original values earlier, at 96~120 h post-stress, whereas in control shrimp they did not. In another experiment, shrimp were immersed in seawater containing GTE at 0 and 600 mg/L for 3 h and examined for transcript levels of immune-related genes at 24 h post-stress. Transcript levels of lipopolysaccharide and β-1,3-glucan binding protein (LGBP, peroxinectin (PX, cytMnSOD, mtMnSOD, and HSP70 were up-regulated at 24 h post-stress in GTE receiving shrimp. We concluded that white shrimp immersed in seawater containing GTE exhibited a capability for maintaining homeostasis by regulating cellular and humoral immunity against ammonia stress as evidenced by up-regulated gene expression and earlier recovery of immune parameters.

  20. White Shrimp Litopenaeus vannamei That Have Received Gracilaria tenuistipitata Extract Show Early Recovery of Immune Parameters after Ammonia Stressing.

    Science.gov (United States)

    Chen, Yu-Yuan; Chen, Jiann-Chu; Lin, Yong-Chin; Yeh, Su-Tuen; Huang, Chien-Lun

    2015-06-05

    White shrimp Litopenaeus vannamei immersed in seawater (35‰) containing Gracilaria tenuistipitata extract (GTE) at 0 (control), 400, and 600 mg/L for 3 h were exposed to 5 mg/L ammonia-N (ammonia as nitrogen), and immune parameters including hyaline cells (HCs), granular cells (GCs, including semi-granular cells), total hemocyte count (THC), phenoloxidase (PO) activity, respiratory bursts (RBs), superoxide dismutase (SOD) activity, lysozyme activity, and hemolymph protein level were examined 24~120 h post-stress. The immune parameters of shrimp immersed in 600 mg/L GTE returned to original values earlier, at 96~120 h post-stress, whereas in control shrimp they did not. In another experiment, shrimp were immersed in seawater containing GTE at 0 and 600 mg/L for 3 h and examined for transcript levels of immune-related genes at 24 h post-stress. Transcript levels of lipopolysaccharide and β-1,3-glucan binding protein (LGBP), peroxinectin (PX), cytMnSOD, mtMnSOD, and HSP70 were up-regulated at 24 h post-stress in GTE receiving shrimp. We concluded that white shrimp immersed in seawater containing GTE exhibited a capability for maintaining homeostasis by regulating cellular and humoral immunity against ammonia stress as evidenced by up-regulated gene expression and earlier recovery of immune parameters.

  1. Radiographic skeletal survey and radionuclide bone scan in Langerhans cell histiocytosis of bone

    International Nuclear Information System (INIS)

    Nieuwenhuyse, J.P. van; Clapuyt, P.; Malghem, J.; Everarts, P.; Melin, J.; Pauwels, S.; Brichard, B.; Ninane, J.; Vermylen, C.; Cornu, G.

    1996-01-01

    Background. The lack of a consensus in the literature on the imaging strategy in Langerhans cell histiocytosis (LCH) bone lesions in childhood. Objective. To evaluate the relative value of radionuclide bone scan (RBS) and radiographic skeletal survey (RSS) in the detection of LCH bone lesions, both in the initial work-up of the disease and during the follow-up period. Materials and methods. Ten children with bone lesions evaluated by means of RSS and RBS in a retrospective study (1984-1993). Results. Fifty radiologically and/or scintigraphically abnormal foci were detected: 27 anomalies in the initial work-up (12 by both RSS and RBS, 8 by RSS only and 7 by RBS only) and 23 additional anomalies during follow-up (10 by both RSS and RBS, 10 by RSS only and 3 by RBS only). RSS+/RBS- lesions (n = 18) are more frequently encountered in the skull (P = 0.038), and more frequently lack radiologic signs of osteoblastic activity (P = 0.020), than RSS+/RBS+ lesions (n = 22). RSS-/RBS+ abnormalities (n = 10) were most frequently insignificant. Conclusion. In the initial work-up both RSS and RBS should be carried out, while in the follow-up only RSS should be performed. (orig.). With 2 figs., 4 tabs

  2. Lattice location of helium in uranium dioxide single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Garrido, F.; Nowicki, L. E-mail: lech.nowicki@fuw.edu.pl; Sattonnay, G.; Sauvage, T.; Thome, L

    2004-06-01

    Lattice location of {sup 3}He atoms implanted into UO{sub 2} single crystals was performed by means of the channeling technique combined with nuclear reaction analysis (NRA) and Rutherford backscattering spectrometry (RBS). The {sup 3}He(d,p){sup 4}He reaction was used. The experimental angular scans show that helium atoms occupy octahedral interstitial positions.

  3. Absence of single critical dose for the amorphization of quartz under ion irradiation

    Science.gov (United States)

    Zhang, S.; Pakarinen, O. H.; Backholm, M.; Djurabekova, F.; Nordlund, K.; Keinonen, J.; Wang, T. S.

    2018-01-01

    In this work, we first simulated the amorphization of crystalline quartz under 50 keV 23 Na ion irradiation with classical molecular dynamics (MD). We then used binary collision approximation algorithms to simulate the Rutherford backscattering spectrometry in channeling conditions (RBS-C) from these irradiated MD cells, and compared the RBS-C spectra with experiments. The simulated RBS-C results show an agreement with experiments in the evolution of amorphization as a function of dose, showing what appears to be (by this measure) full amorphization at about 2.2 eVṡatom-1 . We also applied other analysis methods, such as angular structure factor, Wigner-Seitz, coordination analysis and topological analysis, to analyze the structural evolution of the irradiated MD cells. The results show that the atomic-level structure of the sample keeps evolving after the RBS signal has saturated, until the dose of about 5 eVṡatom-1 . The continued evolution of the SiO2 structure makes the definition of what is, on the atomic level, an amorphized quartz ambiguous.

  4. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    Johnson, E.; Littmark, U.; Johansen, A.; Christodoulides, C.

    1981-01-01

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb + ions to a fluence of 5 x 10 20 ions/m 2 , thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  5. Ozone Formation Induced by the Impact of Reactive Bromine and Iodine Species on Photochemistry in a Polluted Marine Environment.

    Science.gov (United States)

    Shechner, M; Tas, E

    2017-12-19

    Reactive iodine and bromine species (RIS and RBS, respectively) are known for altering atmospheric chemistry and causing sharp tropospheric ozone (O 3 ) depletion in polar regions and significant O 3 reduction in the marine boundary layer (MBL). Here we use measurement-based modeling to show that, unexpectedly, both RIS and RBS can lead to enhanced O 3 formation in a polluted marine environment under volatile organic compound (VOC)-limited conditions associated with high nitrogen oxide (NO X = [NO] + [NO 2 ]) concentrations. Under these conditions, the daily average O 3 mixing ratio increased to ∼44 and ∼28% for BrO and IO mixing ratios of up to ∼6.8 and 4.7 ppt, respectively. The increase in the level of O 3 was partially induced by enhanced ClNO 3 formation for higher Br 2 and I 2 emission flux. The increase in the level of O 3 was associated with an increased mixing ratio of hydroperoxyl radical to hydroxyl radical ([HO 2 ]/[OH]) and increased [NO 2 ]/[NO] with higher levels of RBS and/or RIS. NO X -rich conditions are typical of the polluted MBL, near coastlines and ship plumes. Considering that O 3 is toxic to humans, plants, and animals and is a greenhouse gas, our findings call for adequate updating of local and regional air-quality models with the effects of activities of RBS and RIS on O 3 mixing ratios in the polluted MBL.

  6. An Intelligent Regenerative Braking Strategy for Electric Vehicles

    Directory of Open Access Journals (Sweden)

    Zhibin Song

    2011-09-01

    Full Text Available Regenerative braking is an effective approach for electric vehicles (EVs to extend their driving range. A fuzzy-logic-based regenerative braking strategy (RBS integrated with series regenerative braking is developed in this paper to advance the level of energy-savings. From the viewpoint of securing car stability in braking operations, the braking force distribution between the front and rear wheels so as to accord with the ideal distribution curve are considered to prevent vehicles from experiencing wheel lock and slip phenomena during braking. Then, a fuzzy RBS using the driver’s braking force command, vehicle speed, battery SOC, battery temperature are designed to determine the distribution between friction braking force and regenerative braking force to improve the energy recuperation efficiency. The experimental results on an “LF620” prototype EV validated the feasibility and effectiveness of regenerative braking and showed that the proposed fuzzy RBS was endowed with good control performance. The maximum driving range of LF620 EV was improved by 25.7% compared with non-RBS conditions.

  7. Measurement-based modeling of bromine chemistry in the boundary layer: 1. Bromine chemistry at the Dead Sea

    Science.gov (United States)

    Tas, E.; Peleg, M.; Pedersen, D. U.; Matveev, V.; Pour Biazar, A.; Luria, M.

    2006-12-01

    The Dead Sea is an excellent natural laboratory for the investigation of Reactive Bromine Species (RBS) chemistry, due to the high RBS levels observed in this area, combined with anthropogenic air pollutants up to several ppb. The present study investigated the basic chemical mechanism of RBS at the Dead Sea using a numerical one-dimensional chemical model. Simulations were based on data obtained from comprehensive measurements performed at sites along the Dead Sea. The simulations showed that the high BrO levels measured frequently at the Dead Sea could only partially be attributed to the highly concentrated Br- present in the Dead Sea water. Furthermore, the RBS activity at the Dead Sea cannot solely be explained by a pure gas phase mechanism. This paper presents a chemical mechanism which can account for the observed chemical activity at the Dead Sea, with the addition of only two heterogeneous processes: the "Bromine Explosion" mechanism and the heterogeneous decomposition of BrONO2. Ozone frequently dropped below a threshold value of ~1 to 2 ppbv at the Dead Sea evaporation ponds, and in such cases, O3 became a limiting factor for the production of BrOx (BrO+Br). The entrainment of O3 fluxes into the evaporation ponds was found to be essential for the continuation of RBS activity, and to be the main reason for the jagged diurnal pattern of BrO observed in the Dead Sea area, and for the positive correlation observed between BrO and O3 at low O3 concentrations. The present study has shown that the heterogeneous decomposition of BrONO2 has a great potential to affect the RBS activity in areas influenced by anthropogenic emissions, mainly due to the positive correlation between the rate of this process and the levels of NO2. Further investigation of the influence of the decomposition of BrONO2 may be especially important in understanding the RBS activity at mid-latitudes.

  8. Measurement-based modeling of bromine chemistry in the boundary layer: 1. Bromine chemistry at the Dead Sea

    Directory of Open Access Journals (Sweden)

    E. Tas

    2006-01-01

    Full Text Available The Dead Sea is an excellent natural laboratory for the investigation of Reactive Bromine Species (RBS chemistry, due to the high RBS levels observed in this area, combined with anthropogenic air pollutants up to several ppb. The present study investigated the basic chemical mechanism of RBS at the Dead Sea using a numerical one-dimensional chemical model. Simulations were based on data obtained from comprehensive measurements performed at sites along the Dead Sea. The simulations showed that the high BrO levels measured frequently at the Dead Sea could only partially be attributed to the highly concentrated Br− present in the Dead Sea water. Furthermore, the RBS activity at the Dead Sea cannot solely be explained by a pure gas phase mechanism. This paper presents a chemical mechanism which can account for the observed chemical activity at the Dead Sea, with the addition of only two heterogeneous processes: the "Bromine Explosion" mechanism and the heterogeneous decomposition of BrONO2. Ozone frequently dropped below a threshold value of ~1 to 2 ppbv at the Dead Sea evaporation ponds, and in such cases, O3 became a limiting factor for the production of BrOx (BrO+Br. The entrainment of O3 fluxes into the evaporation ponds was found to be essential for the continuation of RBS activity, and to be the main reason for the jagged diurnal pattern of BrO observed in the Dead Sea area, and for the positive correlation observed between BrO and O3 at low O3 concentrations. The present study has shown that the heterogeneous decomposition of BrONO2 has a great potential to affect the RBS activity in areas influenced by anthropogenic emissions, mainly due to the positive correlation between the rate of this process and the levels of NO2. Further investigation of the influence of the decomposition of BrONO2 may be especially important in understanding the RBS activity at mid-latitudes.

  9. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    DEFF Research Database (Denmark)

    Gordillo, M.; Vega, H.; Trainer, A.H.

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth...... and nonsense mutations associated with decreased levels of mRNA and absence of protein. We found decreased proliferation capacity in RBS cell lines associated with cell death, but not with increased cell cycle duration, which could be a factor in the development of phocomelia and cleft palate in RBS...

  10. Highly selective and reversible chemosensor for Pd(2+) detected by fluorescence, colorimetry, and test paper.

    Science.gov (United States)

    Wang, Mian; Liu, Xiaomei; Lu, Huizhe; Wang, Hongmei; Qin, Zhaohai

    2015-01-21

    A "turn-on" fluorescent and colorimetric chemosensor (RBS) for Pd(2+) has been designed and synthesized through introduction of sulfur as a ligand atom to Rhodamine B. RBS exhibits high selectivity (freedom from the interference of Hg(2+ )in particular) and sensitivity toward Pd(2+) with a detection limit as low as 2.4 nM. RBS is also a reversible sensor, and it can be made into test paper to detect Pd(2+) in pure water. Compared to the chemosensors that introduced phosphorus to Rhodamine to detect Pd(2+), RBS can be synthesized more simply and economically.

  11. Making the Case for Reusable Booster Systems: The Operations Perspective

    Science.gov (United States)

    Zapata, Edgar

    2012-01-01

    Presentation to the Aeronautics Space Engineering Board National Research Council Reusable Booster System: Review and Assessment Committee. Addresses: the criteria and assumptions used in the formulation of current RBS plans; the methodologies used in the current cost estimates for RBS; the modeling methodology used to frame the business case for an RBS capability including: the data used in the analysis, the models' robustness if new data become available, and the impact of unclassified government data that was previously unavailable and which will be supplied by the USAF; the technical maturity of key elements critical to RBS implementation and the ability of current technology development plans to meet technical readiness milestones.

  12. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available nsport ... protein rbsD [Pirellula sp.] ... Length = 135 ... Query: 1 ... MKRTRLLNSELSYEISRIGHTASIT...LCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILS 60 ... MKRTRLLNSELSYEISRIGHTASITLCDAGL...PIPSGVKRIDLAIEEGYPTFLRTLDAILS Sbjct: 1 ... MKRTRLLNSELSYEISRIGHTASITLCDAGLPIPSGVKRIDLAIEEGYPTFLRTLDAILS 60 ... Qu

  13. Show-Bix &

    DEFF Research Database (Denmark)

    2014-01-01

    The anti-reenactment 'Show-Bix &' consists of 5 dias projectors, a dial phone, quintophonic sound, and interactive elements. A responsive interface will enable the Dias projectors to show copies of original dias slides from the Show-Bix piece ”March på Stedet”, 265 images in total. The copies are...

  14. Talking with TV shows

    DEFF Research Database (Denmark)

    Sandvik, Kjetil; Laursen, Ditte

    2014-01-01

    User interaction with radio and television programmes is not a new thing. However, with new cross-media production concepts such as X Factor and Voice, this is changing dramatically. The second-screen logic of these productions encourages viewers, along with TV’s traditional one-way communication...... mode, to communicate on interactive (dialogue-enabling) devices such as laptops, smartphones and tablets. Using the TV show Voice as our example, this article shows how the technological and situational set-up of the production invites viewers to engage in new ways of interaction and communication...

  15. Talk Show Science.

    Science.gov (United States)

    Moore, Mitzi Ruth

    1992-01-01

    Proposes having students perform skits in which they play the roles of the science concepts they are trying to understand. Provides the dialog for a skit in which hot and cold gas molecules are interviewed on a talk show to study how these properties affect wind, rain, and other weather phenomena. (MDH)

  16. Obesity in show cats.

    Science.gov (United States)

    Corbee, R J

    2014-12-01

    Obesity is an important disease with a high prevalence in cats. Because obesity is related to several other diseases, it is important to identify the population at risk. Several risk factors for obesity have been described in the literature. A higher incidence of obesity in certain cat breeds has been suggested. The aim of this study was to determine whether obesity occurs more often in certain breeds. The second aim was to relate the increased prevalence of obesity in certain breeds to the official standards of that breed. To this end, 268 cats of 22 different breeds investigated by determining their body condition score (BCS) on a nine-point scale by inspection and palpation, at two different cat shows. Overall, 45.5% of the show cats had a BCS > 5, and 4.5% of the show cats had a BCS > 7. There were significant differences between breeds, which could be related to the breed standards. Most overweight and obese cats were in the neutered group. It warrants firm discussions with breeders and cat show judges to come to different interpretations of the standards in order to prevent overweight conditions in certain breeds from being the standard of beauty. Neutering predisposes for obesity and requires early nutritional intervention to prevent obese conditions. Journal of Animal Physiology and Animal Nutrition © 2014 Blackwell Verlag GmbH.

  17. Honored Teacher Shows Commitment.

    Science.gov (United States)

    Ratte, Kathy

    1987-01-01

    Part of the acceptance speech of the 1985 National Council for the Social Studies Teacher of the Year, this article describes the censorship experience of this honored social studies teacher. The incident involved the showing of a videotape version of the feature film entitled "The Seduction of Joe Tynan." (JDH)

  18. The energy show

    International Nuclear Information System (INIS)

    1988-01-01

    The Energy Show is a new look at the problems of world energy, where our supplies come from, now and in the future. The programme looks at how we need energy to maintain our standards of living. Energy supply is shown as the complicated set of problems it is - that Fossil Fuels are both raw materials and energy sources, that some 'alternatives' so readily suggested as practical options are in reality a long way from being effective. (author)

  19. Showing Value (Editorial

    Directory of Open Access Journals (Sweden)

    Denise Koufogiannakis

    2009-06-01

    Full Text Available When Su Cleyle and I first decided to start Evidence Based Library and Information Practice, one of the things we agreed upon immediately was that the journal be open access. We knew that a major obstacle to librarians using the research literature was that they did not have access to the research literature. Although Su and I are both academic librarians who can access a wide variety of library and information literature from our institutions, we belong to a profession where not everyone has equal access to the research in our field. Without such access to our own body of literature, how can we ever hope for practitioners to use research evidence in their decision making? It would have been contradictory to the principles of evidence based library and information practice to do otherwise.One of the specific groups we thought could use such an open access venue for discovering research literature was school librarians. School librarians are often isolated and lacking access to the research literature that may help them prove to stakeholders the importance of their libraries and their role within schools. Certainly, school libraries have been in decline and the use of evidence to show value is needed. As Ken Haycock noted in his 2003 report, The Crisis in Canada’s School Libraries: The Case for Reform and Reinvestment, “Across the country, teacher-librarians are losing their jobs or being reassigned. Collections are becoming depleted owing to budget cuts. Some principals believe that in the age of the Internet and the classroom workstation, the school library is an artifact” (9. Within this context, school librarians are looking to our research literature for evidence of the impact that school library programs have on learning outcomes and student success. They are integrating that evidence into their practice, and reflecting upon what can be improved locally. They are focusing on students and showing the impact of school libraries and

  20. THE EPISTEMOLOGICAL PERSPECTIVE OF FRACTIONAL RESERVE BANKING AND FULL RESERVE BANKING: WHERE ISLAMIC BANKING SHOULD STAND?

    Directory of Open Access Journals (Sweden)

    Yaser Taufik Syamlan

    2017-06-01

    Full Text Available Objectives – this research is aimed to compare those epistemological bases to the mindset of Islamic Bank and try to drive the philosophy in practical operation whether based on the Fractional Reserve Banking Sytem (RBS or 100% RBS and analyze the challenges in deploying the 100%RBS. Methods - This research will be conducted based on an extensive literature review.Results - Based on the epistemological analysis of money and the business cycle as well as the views of Islamic scholars, 100%RBS should be the best for Islamic Bank. There are four types of 100% RBS namely Pure Commodity Money, Sovereign Money, Narrow Banking, and Limited Purpose Banking. To deploy it into the economic system, another philosophical work should be done to choose one of the types and strengthen it so that the theory of 100%RBS can be implemented for the goodness of Islamic Bank.  Conclusion - In Conclusions, Based on the epistemology defined by Islamic Scholars, FractRBS has more mafsadah if we compare to the maslahah. Therefore, 100% RBS should be better for the Islamic Bank.

  1. The molecular mechanism underlying Roberts syndrome involves loss of ESCO2 acetyltransferase activity

    NARCIS (Netherlands)

    Gordillo, Miriam; Vega, Hugo; Trainer, Alison H.; Hou, Fajian; Sakai, Norio; Luque, Ricardo; Kayserili, Hülya; Basaran, Seher; Skovby, Flemming; Hennekam, Raoul C. M.; Uzielli, Maria L. Giovannucci; Schnur, Rhonda E.; Manouvrier, Sylvie; Chang, Susan; Blair, Edward; Hurst, Jane A.; Forzano, Francesca; Meins, Moritz; Simola, Kalle O. J.; Raas-Rothschild, Annick; Schultz, Roger A.; McDaniel, Lisa D.; Ozono, Keiichi; Inui, Koji; Zou, Hui; Jabs, Ethylin Wang

    2008-01-01

    Roberts syndrome/SC phocomelia (RBS) is an autosomal recessive disorder with growth retardation, craniofacial abnormalities and limb reduction. Cellular alterations in RBS include lack of cohesion at the heterochromatic regions around centromeres and the long arm of the Y chromosome, reduced growth

  2. Ecological correlates of relative brain size in some South African ...

    African Journals Online (AJOL)

    Relative brain size (size of the brain once body size effects have been removed) has been calculated for 16 species of rodent from South Africa and is shown to vary with six species having a positive RBS (that is a brain larger than expected) and 10 a negative RBS. Arboreal species such as Paraxerus cepapi and ...

  3. 77 FR 65532 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-10-29

    ... each State. RBS will collect information using various forms from the lender and the borrower. This information is vital for making prudent financial decisions. Need and Use of the Information: RBS will collect information to monitor the guaranteed loan portfolio to ensure that the lenders are adequately servicing the...

  4. Planning Schools for the Future. Publication No. BM-1.

    Science.gov (United States)

    Weinberger, JoAnn

    In a three-year study, Research for Better Schools (RBS) was asked by the National Institute of Education to identify, analyze, and verify definitive social changes forecast for the decades ahead, and to project their implications for schools of the future. RBS reviewed the literature to extract future planning needs relevant to educational…

  5. Assessment of Safety Culture within the Pakistan Nuclear Regulatory Authority (PNRA)

    Energy Technology Data Exchange (ETDEWEB)

    Afzal, Muhammad [Pakistan Nuclear Regulatory Authority, Islamabad (Pakistan); Choi, Kwang Sik [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-10-15

    The objective of this study is to assess the SC of the Pakistan Nuclear Regulatory Authority (PNRA) by developing a performance indicator-based questionnaire. Aspects that potentially play important roles in developing perceptions of SC, including age, type of job, gender and duty hours of regulatory staff, are given due importance in this study. The study also identifies the strengths and weaknesses in the SC of the PNRA and can be used as a model study to assess the SC of other RBs. The questionnaire, developed to assess the SC of the PNRA, was in line with the PNRA's own defined attributes for SC. In the past, significant efforts have been made to ensure the safe operation of NPPs by improving designs and operating procedures; however, the nuclear accident at the Fukushima NPP in Japan in March 2011 revealed that the currently allotted hardware safety margins are not sufficient, and much work is needed to improve safety management in terms of SC. Initially, the concept of SC was introduced for operating organizations to ensure safe operation of NPPs; nonetheless, more recent investigations of nuclear events and accidents, especially Fukushima, and at Davis-Besse, in the US, have revealed that a strong focus is required to address and improve the SC of Regulatory Bodies (RBs). Strong SC is considered a vital tool for RBs to achieve their objectives and discharge their responsibilities in an effective and efficient manner. Though the relationship between the SC of RBs and that of operating organizations is not straight forward, it is believed that the former has a strong influence over the latter. The questionnaire was consistent in terms of the credible nature of its questions, and the response group covered different levels of PNRA staff, from managers to lower level staff. The results show that the PNRA staff have a very good understanding of the nature and significance of attributes of SC and are doing their best to exercise the same within the

  6. Assessment of Safety Culture within the Pakistan Nuclear Regulatory Authority (PNRA)

    International Nuclear Information System (INIS)

    Afzal, Muhammad; Choi, Kwang Sik

    2015-01-01

    The objective of this study is to assess the SC of the Pakistan Nuclear Regulatory Authority (PNRA) by developing a performance indicator-based questionnaire. Aspects that potentially play important roles in developing perceptions of SC, including age, type of job, gender and duty hours of regulatory staff, are given due importance in this study. The study also identifies the strengths and weaknesses in the SC of the PNRA and can be used as a model study to assess the SC of other RBs. The questionnaire, developed to assess the SC of the PNRA, was in line with the PNRA's own defined attributes for SC. In the past, significant efforts have been made to ensure the safe operation of NPPs by improving designs and operating procedures; however, the nuclear accident at the Fukushima NPP in Japan in March 2011 revealed that the currently allotted hardware safety margins are not sufficient, and much work is needed to improve safety management in terms of SC. Initially, the concept of SC was introduced for operating organizations to ensure safe operation of NPPs; nonetheless, more recent investigations of nuclear events and accidents, especially Fukushima, and at Davis-Besse, in the US, have revealed that a strong focus is required to address and improve the SC of Regulatory Bodies (RBs). Strong SC is considered a vital tool for RBs to achieve their objectives and discharge their responsibilities in an effective and efficient manner. Though the relationship between the SC of RBs and that of operating organizations is not straight forward, it is believed that the former has a strong influence over the latter. The questionnaire was consistent in terms of the credible nature of its questions, and the response group covered different levels of PNRA staff, from managers to lower level staff. The results show that the PNRA staff have a very good understanding of the nature and significance of attributes of SC and are doing their best to exercise the same within the

  7. Incidence and causes of iatrogenic retinal breaks in idiopathic macular hole and epiretinal membrane.

    Science.gov (United States)

    Yagi, Fumihiko; Takagi, Seiji; Tomita, Goji

    2014-03-01

    To evaluate the incidence and cause of iatrogenic retinal breaks (RBs) and postoperative retinal detachment (RD) in cases of idiopathic macular hole (MH) and epiretinal membrane (ERM). We analyzed 79 eyes with MH and 41 eyes with ERM, the relationship between the incidence of RBs and RD, and the frequency of posterior vitreous detachment (PVD) and lattice degeneration (LD). The incidence of RBs related to the operation was significantly higher in eyes with MH. The frequency of PVD was significantly higher in eyes with ERM. The frequency of LD did not differ between groups. In the MH group, the incidence of RBs related to the operation was high in eyes without PVD, but with LD. We observed four cases of RD in the MH group. The MH group had higher incidence of RBs related to the operation, especially in eyes without PVD or with LD.

  8. Radiation-damage recovery in undoped and oxidized Li doped Mg O crystals implanted with lithium ions

    Energy Technology Data Exchange (ETDEWEB)

    Alves, E. E-mail: ealves@itn.pt; Silva, R.C. da; Pinto, J.V.; Monteiro, T.; Savoini, B.; Caceres, D.; Gonzalez, R.; Chen, Y

    2003-05-01

    Undoped MgO and oxidized Li-doped MgO single crystals were implanted with 1 x 10{sup 17} Li{sup +}/cm{sup 2} at 175 keV. The Rutherford backscattering spectrometry (RBS)/channeling data obtained after implantation shows that damage was produced throughout the entire range of the implanted ions. Optical absorption measurements indicate that after implantation the most intense band occurs at {approx}5.0 eV, which has been associated with anion vacancies. After annealing at 450 K the intensity of the oxygen-vacancy band decreases monotonically with temperature and completely disappears at 950 K. A broad extinction band centered at {approx}2.14 eV associated with lithium precipitates emerges gradually and anneals out at 1250 K. RBS/channeling shows that recovery of the implantation damage is completed after annealing the oxidized samples at 1250 K.

  9. Sub-monolayer growth of Ag on flat and nanorippled SiO{sub 2} surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Bhatnagar, Mukul; Ranjan, Mukesh; Mukherjee, Subroto [FCIPT, Institute for Plasma Research, Gandhinagar 382428, Gujarat (India); Nirma University, Ahmedabad 382481, Gujarat (India); Jolley, Kenny; Smith, Roger [Department of Mathematical Sciences, Loughborough University, Leicestershire LE11 3TU (United Kingdom)

    2016-05-30

    In-situ Rutherford Backscattering Spectrometry (RBS) and Molecular Dynamics (MD) simulations have been used to investigate the growth dynamics of silver on a flat and the rippled silica surface. The calculated sticking coefficient of silver over a range of incidence angles shows a similar behaviour to the experimental results for an average surface binding energy of a silver adatom of 0.2 eV. This value was used to parameterise the MD model of the cumulative deposition of silver in order to understand the growth mechanisms. Both the model and the RBS results show marginal difference between the atomic concentration of silver on the flat and the rippled silica surface, for the same growth conditions. For oblique incidence, cluster growth occurs mainly on the leading edge of the rippled structure.

  10. Russell body apical periodontitis: an unusual case report.

    Science.gov (United States)

    Dos Santos, Jean Nunes; Ramos, Eduardo Antônio Gonçalves; Gurgel, Clarissa Araújo Silva; Barros, Adna Conceição; de Freitas, André Carlos; Crusoé-Rebello, Iêda Maria

    2008-12-01

    Russell bodies (RBs) changes in chronic apical lesions have rarely been reported in the literature. We describe a case of a periapical lesion abundantly and extensively composed of RB. Microscopic examination showed accumulation of plasma cells containing globular, spherical, polygonal, and eosinophilic structures against fibrous connective tissue. Initial diagnostic considerations based on a smaller magnification included hypersecretory plasmocytoma, although there was no evidence of infiltrative growth, mitotic activity, nuclear atypia, or cellular pleomorphism. Then, a panel of immunohistochemical markers was applied and the cells showed positivity with both kappa and lambda chains demonstrating their polyclonal origin. The extensive accumulation of RBs involving the periapical region represents an unreported and significant histologic change, as it was mimicking a malignant neoplasm.

  11. Yttrium implantation effects on extra low carbon steel and pure iron

    Energy Technology Data Exchange (ETDEWEB)

    Caudron, E.; Buscail, H. [Clermont-Ferrand-2 Univ., Le Puy en Velay (France). Lab. Vellave d`Elaboration; Jacob, Y.P.; Stroosnijder, M.F. [Institute for Advanced Materials, Joint Research Center, The European Commission, 21020, Ispra (Vatican City State, Holy See) (Italy); Josse-Courty, C. [Laboratoire de Recherche sur la Reactivite des Solides, UMR 56-13 CNRS, UFR Sciences et Techniques, 9 Avenue A. Savary, B.P. 400, 21011, Dijon Cedex (France)

    1999-05-25

    Extra low carbon steel and pure electrolytic iron samples were yttrium implanted using ion implantation technique. Compositions and structures of pure iron and steel samples were investigated before and after yttrium implantation by several analytical and structural techniques (RBS, SIMS, RHEED and XRD) to observe the yttrium implantation depth profiles in the samples. This paper shows the different effects of yttrium implantations (compositions and structures) according to the implanted sample nature. (orig.) 23 refs.

  12. Effect of thermal annealing on the optical and structural properties of silicon implanted with a high hydrogen fluence

    International Nuclear Information System (INIS)

    Kling, A.; Soares, J.C.; Rodriguez, A.; Rodriguez, T.; Avella, M.; Jimenez, J.

    2006-01-01

    Silicon capped by thermal oxide has been implanted with 1 x 10 17 H/cm 2 and the implant profile peaking at the interface. Samples were subjected to thermal annealing and characterized by ERD, FTIR, RBS/channeling, UV/VIS reflectance and cathodoluminescence regarding H-content, crystalline quality and light emission. The results show that the luminescent properties are independent of the hydrogen content but are strongly related with the present damage

  13. Structural disorder in sapphire induced by 90.3 MeV xenon ions

    International Nuclear Information System (INIS)

    Kabir, A.; Meftah, A.; Stoquert, J.P.; Toulemonde, M.; Monnet, I.; Izerrouken, M.

    2010-01-01

    In our previous work , we have evidenced, using RBS-C, two effects in the aluminium sublattice of sapphire irradiated with 90.3 MeV xenon ions: a partial disorder creation that saturates at ∼40% followed above a threshold fluence by a highly disordered layer appearing behind the surface. In this work, by RBS-C analysis of the oxygen sublattice, we have observed only one regime of partial disorder creation that saturates at ∼60% in tracks of cross-section double of that found for the aluminium sublattice. Complementary analysis by X-ray diffraction shows that the lattice strain increases with the fluence until a maximum is reached about 7.5 x 10 12 ions/cm 2 . For higher fluences, strain decreases first indicating a little stress relaxation in the material and tends afterwards, to remain constant. This stress relaxation is found to be related to the aluminium sublattice high disorder.

  14. Roles of the sister chromatid cohesion apparatus in gene expression, development, and human syndromes

    Science.gov (United States)

    Dorsett, Dale

    2006-01-01

    The sister chromatid cohesion apparatus mediates physical pairing of duplicated chromosomes. This pairing is essential for appropriate distribution of chromosomes into the daughter cells upon cell division. Recent evidence shows that the cohesion apparatus, which is a significant structural component of chromosomes during interphase, also affects gene expression and development. The Cornelia de Lange (CdLS) and Roberts/SC phocomelia (RBS/SC) genetic syndromes in humans are caused by mutations affecting components of the cohesion apparatus. Studies in Drosophila suggest that effects on gene expression are most likely responsible for developmental alterations in CdLS. Effects on chromatid cohesion are apparent in RBS/SC syndrome, but data from yeast and Drosophila point to the likelihood that changes in expression of genes located in heterochromatin could contribute to the developmental deficits. PMID:16819604

  15. IBA of iridescent Art Nouveau glass - comparative studies

    International Nuclear Information System (INIS)

    Maeder, M.; Jembrih-Simbuerger, D.; Neelmeijer, C.; Schreiner, Manfred

    2005-01-01

    Simultaneous PIXE, PIGE, and RBS in air were employed to characterise the surface structure of iridescent Art Nouveau glass artefacts produced around 1900 by Tiffany, USA and Loetz, Austria. Using PIXE and PIGE, the chemical composition of the bulk glass and the overlays was determined in a non-destructive manner. Furthermore, the combination of PIXE and RBS enabled the layer structure of the analysed glasses (bulk, overlays, and iridescent layers) and the thicknesses of the thin layers in the near-surface domain to be determined. The measurement and evaluation procedure is demonstrated on blue iridescent glass fragments of Tiffany and Loetz by way of example. The initial results showing similarities but also differences in the layered glass structure of Tiffany and Loetz objects are presented

  16. Formation and characterization of ZnO : Tm+ optical waveguides fabricated by Tm+ and O+ ion implantation

    International Nuclear Information System (INIS)

    Ming Xianbing; Lu Fei; Liu Hanping; Chen Ming; Wang Lei

    2009-01-01

    Planar optical waveguides were formed in ZnO crystal by Tm + and O + ion implantation. The distributions of Tm + in as-implanted and annealed ZnO samples were investigated by the RBS technique. A shift of the Tm + peak towards the sample surface and out diffusion were observed after thermal treatment and subsequent O + ion implantation. Waveguide formation was determined after O + implantation in Tm + -implanted ZnO crystal. By using the prism-coupling method two guided modes were detected. The refractive index profile in the implanted waveguide was reconstructed according to the SRIM and RCM simulation. The RBS/channelling measurements show that the lattice structure of ZnO did not suffer detectable damage after O + implantation.

  17. Bovine Blood Constituents as Fat Replacers in Ham Pâté

    Directory of Open Access Journals (Sweden)

    Fabiana Ribeiro Viana

    2004-01-01

    Full Text Available Some tests were carried out in this work with the aim of evaluating a partial replacement of fat in the raw batter of ham pâté by using bovine blood constituents, such as globin (GL, plasma (PL or 1:1 globin and plasma (GP. Plasma was separated from red cells by blood centrifugation, and globin was extracted by the carboxymethylcellulose method. The salt-soluble protein content (SSP and the binding properties including water holding capacity (WHC and raw batter stability (RBS were estimated. The results indicated that among the 3 treatments studied, the use of globin showed to be a little more advantageous for the quality of the raw batter of ham pâté, since its incorporation as fat replacer led to an increase in RBS but no change of SSP was observed.

  18. Au-nanoparticles grafted on plasma treated PE

    International Nuclear Information System (INIS)

    Svorcik, V.; Chaloupka, A.; Rezanka, P.; Slepicka, P.; Kolska, Z.; Kasalkova, N.; Hubacek, T.; Siegel, J.

    2010-01-01

    Polyethylene (PE) surface was treated with Ar plasma. Activated surface was grafted from methanol solution of 1,2-ethanedithiol. Then the sample was immersed into freshly prepared colloid solution of Au-nanoparticles. Finally Au layer was sputtered on the samples. Properties of the modified PE were studied using various methods: AFM, EPR, RBS and nanoindentation. It was shown that the plasma treatment results in degradation of polymer chain (AFM) and creation of free radicals by EPR. After grafting with dithiol, the concentration of free radicals declines. The presence of Au and S in the surface layer after the coating with Au-nanoparticles was proved by RBS. Plasma treatment changes PE surface morphology and increases surface roughness, too. Another significant change in surface morphology and roughness was observed after deposition of Au-nanoparticles. Nanoindentation measurements show that the grafting with Au-nanoparticles increases adhesion of subsequently sputtered Au layer.

  19. Characterisation of magnetron sputtered SmCo5 thin films

    International Nuclear Information System (INIS)

    Wang, Y.; Sood, D.K.; Kothari

    1999-01-01

    SmCo 5 thin films were deposited using DC magnetron sputtering on single crystal silicon substrate with chromium and SiO 2 top layers. Deposition was carried out at three different substrate temperatures: room temperature, 400 deg C and 600 deg C. Films were characterised by using Rutherford Backscattering Spectroscopy (RBS), X-ray Diffraction (XRD), Secondary Ion Mass Spectrometry (SIMS) and SQUID magnetometer. RBS analysis indicated that the films have excellent stoichiometry with the Sm to Co ratio of 1:5. This analysis also showed that the films deposited or annealed at high temperatures (≥600 deg C) indicated significant inter-diffusion at the interface between the barrier layer and the film. Oxygen was found to be the major impurity in the films. XRD data indicated that the films formed 1:5 and 2:17 phases under different deposition conditions. The preliminary studies of these films using magnetic force microscopy revealed the presence of magnetic domains

  20. Ratiometric two-photon excited photoluminescence of quantum dots triggered by near-infrared-light for real-time detection of nitric oxide release in situ

    International Nuclear Information System (INIS)

    Jin, Hui; Gui, Rijun; Sun, Jie; Wang, Yanfeng

    2016-01-01

    Probe-donor integrated nanocomposites were developed from conjugating silica-coated Mn"2"+:ZnS quantum dots (QDs) with MoS_2 QDs and photosensitive nitric oxide (NO) donors (Fe_4S_3(NO)_7"−, RBS). Under excitation with near-infrared (NIR) light at 808 nm, the Mn"2"+:ZnS@SiO_2/MoS_2-RBS nanocomposites showed the dual-emissive two-photon excited photoluminescence (TPEPL) that induced RBS photolysis to release NO in situ. NO caused TPEPL quenching of Mn"2"+:ZnS QDs, but it produced almost no impact on the TPEPL of MoS_2 QDs. Hence, the nanocomposites were developed as a novel QDs-based ratiometric TPEPL probe for real-time detection of NO release in situ. The ratiometric TPEPL intensity is nearly linear (R"2 = 0.9901) with NO concentration in the range of 0.01∼0.8 μM, which corresponds to the range of NO release time (0∼15 min). The detection limit was calculated to be approximately 4 nM of NO. Experimental results confirmed that this novel ratiometric TPEPL probe possessed high selectivity and sensitivity for the detection of NO against potential competitors, and especially showed high detection performance for NIR-light triggered NO release in tumor intracellular microenvironments. These results would promote the development of versatile probe-donor integrated systems, also providing a facile and efficient strategy to real-time detect the highly controllable drug release in situ, especially in physiological microenvironments. - Highlights: • Mn"2"+:ZnS@SiO_2/MoS_2-RBS nanocomposites were developed as a novel ratiometric two-photon excited fluorescence probe. • This probe could conduct real-time detection of nitric oxide release in situ. • High feasibility of this probe was confirmed in tumor intracellular microenvironments.

  1. L-leucine partially rescues translational and developmental defects associated with zebrafish models of Cornelia de Lange syndrome.

    Science.gov (United States)

    Xu, Baoshan; Sowa, Nenja; Cardenas, Maria E; Gerton, Jennifer L

    2015-03-15

    Cohesinopathies are human genetic disorders that include Cornelia de Lange syndrome (CdLS) and Roberts syndrome (RBS) and are characterized by defects in limb and craniofacial development as well as mental retardation. The developmental phenotypes of CdLS and other cohesinopathies suggest that mutations in the structure and regulation of the cohesin complex during embryogenesis interfere with gene regulation. In a previous project, we showed that RBS was associated with highly fragmented nucleoli and defects in both ribosome biogenesis and protein translation. l-leucine stimulation of the mTOR pathway partially rescued translation in human RBS cells and development in zebrafish models of RBS. In this study, we investigate protein translation in zebrafish models of CdLS. Our results show that phosphorylation of RPS6 as well as 4E-binding protein 1 (4EBP1) was reduced in nipbla/b, rad21 and smc3-morphant embryos, a pattern indicating reduced translation. Moreover, protein biosynthesis and rRNA production were decreased in the cohesin morphant embryo cells. l-leucine partly rescued protein synthesis and rRNA production in the cohesin morphants and partially restored phosphorylation of RPS6 and 4EBP1. Concomitantly, l-leucine treatment partially improved cohesinopathy embryo development including the formation of craniofacial cartilage. Interestingly, we observed that alpha-ketoisocaproate (α-KIC), which is a keto derivative of leucine, also partially rescued the development of rad21 and nipbla/b morphants by boosting mTOR-dependent translation. In summary, our results suggest that cohesinopathies are caused in part by defective protein synthesis, and stimulation of the mTOR pathway through l-leucine or its metabolite α-KIC can partially rescue development in zebrafish models for CdLS. © The Author 2014. Published by Oxford University Press.

  2. Unjuk Kerja Jaringan Seluler 2G dan 3G PT. XL Axiata di Area Jawa Tengah Bagian Utara setelah Proyek Swap dan Modernisasi

    Directory of Open Access Journals (Sweden)

    Eva Yovita Dwi Utami

    2015-04-01

    Full Text Available The increasing number of customers and the need for reliable communication require the availability of coverage, sufficient capacity and good quality of mobile communications networks. New BTS implementation is required to cover a wider area with good network quality. However, it often requires high cost and long time to get permission from the government and local residents. Swap and Modernization Project is a project that swap the previous 3G equipment using BTS 3900 Huawei with Ericsson RBS 6000 and modernize the 2G RBS 2000 to RBS 6000 and then carry out parameter settings to optimize the network. In this paper, we report the results of mobile network performance after Swap and Modernization projects had been done in terms of the signal strength improvements, which are showed by Rx Level, RSCP and CDD Dump parameters. The study was conducted in PT XL Axiata Northern Areas of Central Java with D5 cluster as a sample. The results show improvement of Rx Level that increased by 89.93 %, and RSCP value increased by 58.36 %. The swap and modernization of the BTS and parameter settings are able to improve CDD Dump parameters. These improvements are able to expand the coverage area of cluster D5 sites.

  3. [Analysis of acid rain characteristics of Lin'an Regional Background Station using long-term observation data].

    Science.gov (United States)

    Li, Zheng-Quan; Ma, Hao; Mao, Yu-Ding; Feng, Tao

    2014-02-01

    Using long-term observation data of acid rain at Lin'an Regional Background Station (Lin'an RBS), this paper studied the interannual and monthly variations of acid rain, the reasons for the variations, and the relationships between acid rain and meteorological factors. The results showed that interannual variation of acid rain at Lin'an RBS had a general increasing trend in which there were two obvious intensifying processes and two distinct weakening processes, during the period ranging from 1985 to 2012. In last two decades, the monthly variation of acid rain at Lin'an RBS indicated that rain acidity and frequency of severe acid rain were increasing but the frequency of weak acid rain was decreasing when moving towards bilateral side months of July. Acid rain occurrence was affected by rainfall intensity, wind speed and wind direction. High frequency of severe acid rain and low frequency of weak acid rain were on days with drizzle, but high frequency of weak acid rain and low frequency of severe acid rain occurred on rainstorm days. With wind speed upgrading, the frequency of acid rain and the proportion of severe acid rain were declining, the pH value of precipitation was reducing too. Another character is that daily dominant wind direction of weak acid rain majorly converged in S-W section ,however that of severe acid rain was more likely distributed in N-E section. The monthly variation of acid rain at Lin'an RBS was mainly attributed to precipitation variation, the increasing and decreasing of monthly incoming wind from SSE-WSW and NWN-ENE sections of wind direction. The interannual variation of acid rain could be due to the effects of energy consumption raising and significant green policies conducted in Zhejiang, Jiangsu and Shanghai.

  4. Radiation effects in ion implanted β-Ga_2O_3

    International Nuclear Information System (INIS)

    Wendler, E.; Treiber, E.; Baldauf, J.; Wolf, S.; Ronning, C.; Kuramata, A.

    2015-01-01

    Ion implantation induced effects are studied in β-Ga_2O_3 at room temperature. The main technique applied is Rutherford backscattering spectrometry in channelling configuration (RBS) using He ions. Additionally, selected samples were investigated by optical spectroscopy and transmission electron microscopy (TEM). For the implanted P, Ar or Sn ions clear damage peaks are visible in the RBS spectra. The concentration of displaced lattice atoms in the maximum of the distribution (as deduced from the channelling spectra) increases almost continuously up to a saturation value of about 90% with increasing ion fluence. Once this level is reached in the maximum of the distribution, during further implantation a broadening of the distribution occurs with the concentration remaining at this level. RBS measurements performed with different energy of the analysing He ions reveal that the damage produced is characterized by randomly distributed lattice atoms. This indicates point defects, point defect complexes or amorphous zones. As the channelling spectra of the implanted layers do not reach the random level, complete amorphisation can be excluded. Furthermore, the applied optical techniques do not exhibit significant changes in comparison to the signal measured for the unimplanted sample even though these studies were performed for the highest ion fluences implanted. Cross sectional TEM confirms this result. The diffraction pattern shows clear spots as for the unimplanted material and extended defects are almost not visible. The β-Ga_2O_3 layers ion implanted at room temperature contain mainly point defects the strong influence of which on the dechannelling of the He ions in the RBS analysis is not yet understood. (authors)

  5. Governing equations of multi-component rigid body-spring discrete element models of reinforced concrete columns

    International Nuclear Information System (INIS)

    Guan, P B; Tingatinga, E A; Longalong, R E; Saguid, J

    2016-01-01

    During the past decades, the complexity of conventional methods to perform seismic performance assessment of buildings led to the development of more effective approaches. The rigid body spring-discrete element method (RBS-DEM) is one of these approaches and has recently been applied to the study of the behavior of reinforced concrete (RC) buildings subjected to strong earthquakes. In this paper, the governing equations of RBS-DEM planar elements subjected to lateral loads and horizontal ground motion are presented and used to replicate the hysteretic behavior of experimental RC columns. The RBS-DEM models of columns are made up of rigid components connected by systems of springs that simulate axial, shear, and bending behavior of an RC section. The parameters of springs were obtained using Response-2000 software and the hysteretic response of the models of select columns from the Pacific Earthquake Engineering Research (PEER) Structural Performance Database were computed numerically. Numerical examples show that one-component models were able to simulate the initial stiffness reasonably, while the displacement capacity of actual columns undergoing large displacements were underestimated. (paper)

  6. Quantitative analysis of chemical elements in single cells using nuclear microprobe and nano-probe

    International Nuclear Information System (INIS)

    Deves, Guillaume

    2010-01-01

    The study of the role of trace elements at cellular level requires the use of state-of-the-art analytical tools that could achieve enough sensitivity and spatial resolution. We developed a new methodology for the accurate quantification of chemical element distribution in single cells based on a combination of ion beam analysis techniques STIM, PIXE and RBS. The quantification procedure relies on the development of a STIM data analysis software (Paparamborde). Validity of this methodology and limits are discussed here. The method allows the quantification of trace elements (μg/g) with a 19.8 % uncertainty in cellular compartments with mass below 0.1 ng. The main limit of the method lies in the poor number of samples that can be analyzed, due to long irradiation times required and limited access to ion beam analysis facilities. This is the reason why we developed a database for cellular chemical composition capitalization (BDC4). BDC4 has been designed in order to use cellular chemical composition as a tracer for biological activities and is expected to provide in the future reference chemical compositions for any cellular type or compartment. Application of the STIM-PIXE-RBS methodology to the study of nuclear toxicology of cobalt compounds is presented here showing that STIM analysis is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. (author)

  7. Damage recovery in ZnO by post-implantation annealing

    International Nuclear Information System (INIS)

    Audren, A.; Hallen, A.; Linnarsson, M.K.; Possnert, G.

    2010-01-01

    ZnO bulk samples were implanted with 200 keV-Co ions at room temperature with two fluences, 1 x 10 16 and 8 x 10 16 cm -2 , and then annealed in air for 30 min at different temperatures up to 900 o C. After the implantation and each annealing step, the samples were analyzed by Rutherford backscattering spectrometry (RBS) in random and channeling directions to follow the evolution of the disorder profile. The RBS spectra reveal that disorder is created during implantation in proportion to the Co fluence. The thermal treatments induce a disorder recovery, which is however, not complete after annealing at 900 o C, where about 15% of the damage remains. To study the Co profile evolution during annealing, the samples were, in addition to RBS, characterized by secondary ion mass spectrometry (SIMS). The results show that Co diffusion starts at 800 o C, but also that a very different behavior is seen for Co concentrations below and above the solubility limit.

  8. Thermal annealing behavior of niobium-implanted {alpha}-Al{sub 2}O{sub 3} under reducing environment

    Energy Technology Data Exchange (ETDEWEB)

    Jianer, Zeng; Naramoto, Hiroshi; Aoki, Yasushi; Yamamoto, Shunya; Mingle, Gan; Takeshita, Hidefumi [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    1997-03-01

    Thermal annealing behavior is studied in {alpha}-Al{sub 2}O{sub 3} implanted with {sup 93}Nb{sup +} using RBS/channeling technique and optical absorption spectrometry. The samples with <0001> and <112-bar0> orientations are implanted with 300 keV and 400 keV {sup 93}Nb{sup +} ions. Thermal annealing under reducing environment (Ar+3%H{sub 2}) is employed in the temperature range from 600 to 1000degC to explore unusual materials phase. The annealing up to 1000degC for an hour does not show any essential change in RBS/channeling spectra in two kinds of samples but the significant decrease in the visible region is observed in optical absorption spectra. After annealing at 1000degC for 10 hours, the recovery of the lattice damage is detected by RBS/channeling analysis especially in (112-bar0) sample. In the optical absorption spectra, new absorption envelope appears in the ultraviolet region. The results are related to the formation of niobium metal fine particles, and the sharp distribution is realized especially in (0001) sample. (author)

  9. The distribution of InCl sub x compounds in model polymeric LEDs A combined low and high-energy ion beam analysis study

    CERN Document Server

    Reijme, M A; Simons, D P L; Schok, M; Ijzendoorn, L J V; Brongersma, H H; De Voigt, M J A

    2002-01-01

    A combination of low- and high-energy ion beam analysis techniques was used to determine the distribution of indium chloride compounds in model polymeric light-emitting diodes (p-LEDs). Parts of polymeric LEDs (polydialkoxyphenylenevinylene (OC sub 1 C sub 1 sub 0 -PPV) on indium-tin-oxide (ITO) substrates) were exposed to a HCl/Ar flow to simulate the processes occurring during conversion of precursor PPVs and acid treatment of polymers. Samples with variable exposure times as well as pristine samples were studied with Rutherford backscattering spectrometry (RBS), low energy ion scattering (LEIS), X-ray photoelectron spectroscopy (XPS) and particle induced X-ray emission (PIXE). The RBS measurements show that after HCl exposure indium is distributed throughout the OC sub 1 C sub 1 sub 0 -PPV layer. LEIS and XPS measurements indicate that the indium and chlorine are present at the outermost surface of the OC sub 1 C sub 1 sub 0 -PPV layer. PIXE measurements in combination with the RBS data demonstrate that th...

  10. Establishment and characterization of Roberts syndrome and SC phocomelia model medaka (Oryzias latipes).

    Science.gov (United States)

    Morita, Akihiro; Nakahira, Kumiko; Hasegawa, Taeko; Uchida, Kaoru; Taniguchi, Yoshihito; Takeda, Shunichi; Toyoda, Atsushi; Sakaki, Yoshiyuki; Shimada, Atsuko; Takeda, Hiroyuki; Yanagihara, Itaru

    2012-06-01

    Roberts syndrome and SC phocomelia (RBS/SC) are genetic autosomal recessive syndromes caused by establishment of cohesion 1 homolog 2 ( ESCO 2) mutation. RBS/SC appear to have a variety of clinical features, even with the same mutation of the ESCO2 gene. Here, we established and genetically characterized a medaka model of RBS/SC by reverse genetics. The RBS/SC model was screened from a mutant medaka library produced by the Targeting Induced Local Lesions in Genomes method. The medaka mutant carrying the homozygous mutation at R80S in the conserved region of ESCO2 exhibited clinical variety (i.e. developmental arrest with craniofacial and chromosomal abnormalities and embryonic lethality) as characterized in RBS/SC. Moreover, widespread apoptosis and downregulation of some gene expression, including notch1a, were detected in the R80S mutant. The R80S mutant is the animal model for RBS/SC and a valuable resource that provides the opportunity to extend knowledge of ESCO2. Downregulation of some gene expression in the R80S mutant is an important clue explaining non-correlation between genotype and phenotype in RBS/SC. © 2012 The Authors Development, Growth & Differentiation © 2012 Japanese Society of Developmental Biologists.

  11. Regenerative braking failures in battery electric vehicles and their impact on the driver.

    Science.gov (United States)

    Cocron, Peter; Neumann, Isabel; Kreußlein, Maria; Wanner, Daniel; Bierbach, Maxim; Krems, Josef F

    2018-09-01

    A unique feature of battery electric vehicles (BEV) is their regenerative braking system (RBS) to recapture kinetic energy in deceleration maneuvers. If such a system is triggered via gas pedal, most deceleration maneuvers can be executed by just using this pedal. This impacts the driving task as different deceleration strategies can be applied. Previous research has indicated that a RBS failure leading to a sudden reduced deceleration represents an adverse event for BEV drivers. In the present study, we investigated such a failure's impact on the driver's evaluation and behavior. We conducted an experiment on a closed-off test track using a modified BEV that could temporarily switch off the RBS. One half of the 44 participants in the study received information about an upcoming RBS failure whereas the other half did not. While 91% of the drivers receiving prior information noticed the RBS failure, only 48% recognized it in the "uniformed" group. In general, the failure and the perception of its occurrence influenced the driver's evaluation and behavior more than receiving prior information. Nevertheless, under the tested conditions, drivers kept control and were able to compensate for the RBS failure. As the participants drove quite simple maneuvers in our experiment, further studies are needed to validate our findings using more complex driving settings. Given that RBS failures could have severe consequences, appropriate information and warning strategies for drivers are necessary. Copyright © 2018 Elsevier Ltd. All rights reserved.

  12. Spontaneous intracranial hemorrhage and multiple intracranial aneurysms in a patient with Roberts/SC phocomelia syndrome.

    Science.gov (United States)

    Wang, Anthony C; Gemmete, Joseph J; Keegan, Catherine E; Witt, Cordelie E; Muraszko, Karin M; Than, Khoi D; Maher, Cormac O

    2011-11-01

    Roberts/SC phocomelia syndrome (RBS) is a rare but distinct genetic disorder with an autosomal recessive inheritance pattern. It has been associated with microcephaly, craniofacial malformation, cavernous hemangioma, encephalocele, and hydrocephalus. There are no previously reported cases of RBS with intracranial aneurysms. The authors report on a patient with a history of RBS who presented with a spontaneous posterior fossa hemorrhage. Multiple small intracranial aneurysms were noted on a preoperative CT angiogram. The patient underwent emergency craniotomy for evacuation of the hemorrhage. A postoperative angiogram confirmed the presence of multiple, distal small intracranial aneurysms.

  13. Treatment and prognosis of patients with late rectal bleeding after intensity-modulated radiation therapy for prostate cancer

    International Nuclear Information System (INIS)

    Takemoto, Shinya; Kataoka, Hiromi; Mimura, Mikio; Shibamoto, Yuta; Ayakawa, Shiho; Nagai, Aiko; Hayashi, Akihiro; Ogino, Hiroyuki; Baba, Fumiya; Yanagi, Takeshi; Sugie, Chikao

    2012-01-01

    Radiation proctitis after intensity-modulated radiation therapy (IMRT) differs from that seen after pelvic irradiation in that this adverse event is a result of high-dose radiation to a very small area in the rectum. We evaluated the results of treatment for hemorrhagic proctitis after IMRT for prostate cancer. Between November 2004 and February 2010, 403 patients with prostate cancer were treated with IMRT at 2 institutions. Among these patients, 64 patients who developed late rectal bleeding were evaluated. Forty patients had received IMRT using a linear accelerator and 24 by tomotherapy. Their median age was 72 years. Each patient was assessed clinically and/or endoscopically. Depending on the severity, steroid suppositories or enemas were administered up to twice daily and Argon plasma coagulation (APC) was performed up to 3 times. Response to treatment was evaluated using the Rectal Bleeding Score (RBS), which is the sum of Frequency Score (graded from 1 to 3 by frequency of bleeding) and Amount Score (graded from 1 to 3 by amount of bleeding). Stoppage of bleeding over 3 months was scored as RBS 1. The median follow-up period for treatment of rectal bleeding was 35 months (range, 12–69 months). Grade of bleeding was 1 in 31 patients, 2 in 26, and 3 in 7. Nineteen of 45 patients (42%) observed without treatment showed improvement and bleeding stopped in 17 (38%), although mean RBS did not change significantly. Eighteen of 29 patients (62%) treated with steroid suppositories or enemas showed improvement (mean RBS, from 4.1 ± 1.0 to 3.0 ± 1.8, p = 0.003) and bleeding stopped in 9 (31%). One patient treated with steroid enema 0.5-2 times a day for 12 months developed septic shock and died of multiple organ failure. All 12 patients treated with APC showed improvement (mean RBS, 4.7 ± 1.2 to 2.3 ± 1.4, p < 0.001) and bleeding stopped in 5 (42%). After adequate periods of observation, steroid suppositories/enemas are expected to be effective. However, short

  14. Treatment and prognosis of patients with late rectal bleeding after intensity-modulated radiation therapy for prostate cancer

    Directory of Open Access Journals (Sweden)

    Takemoto Shinya

    2012-06-01

    Full Text Available Abstract Background Radiation proctitis after intensity-modulated radiation therapy (IMRT differs from that seen after pelvic irradiation in that this adverse event is a result of high-dose radiation to a very small area in the rectum. We evaluated the results of treatment for hemorrhagic proctitis after IMRT for prostate cancer. Methods Between November 2004 and February 2010, 403 patients with prostate cancer were treated with IMRT at 2 institutions. Among these patients, 64 patients who developed late rectal bleeding were evaluated. Forty patients had received IMRT using a linear accelerator and 24 by tomotherapy. Their median age was 72 years. Each patient was assessed clinically and/or endoscopically. Depending on the severity, steroid suppositories or enemas were administered up to twice daily and Argon plasma coagulation (APC was performed up to 3 times. Response to treatment was evaluated using the Rectal Bleeding Score (RBS, which is the sum of Frequency Score (graded from 1 to 3 by frequency of bleeding and Amount Score (graded from 1 to 3 by amount of bleeding. Stoppage of bleeding over 3 months was scored as RBS 1. Results The median follow-up period for treatment of rectal bleeding was 35 months (range, 12–69 months. Grade of bleeding was 1 in 31 patients, 2 in 26, and 3 in 7. Nineteen of 45 patients (42% observed without treatment showed improvement and bleeding stopped in 17 (38%, although mean RBS did not change significantly. Eighteen of 29 patients (62% treated with steroid suppositories or enemas showed improvement (mean RBS, from 4.1 ± 1.0 to 3.0 ± 1.8, p = 0.003 and bleeding stopped in 9 (31%. One patient treated with steroid enema 0.5-2 times a day for 12 months developed septic shock and died of multiple organ failure. All 12 patients treated with APC showed improvement (mean RBS, 4.7 ± 1.2 to 2.3 ± 1.4, p  Conclusions After adequate periods of observation, steroid suppositories

  15. Risk Aversion in Game Shows

    DEFF Research Database (Denmark)

    Andersen, Steffen; Harrison, Glenn W.; Lau, Morten I.

    2008-01-01

    We review the use of behavior from television game shows to infer risk attitudes. These shows provide evidence when contestants are making decisions over very large stakes, and in a replicated, structured way. Inferences are generally confounded by the subjective assessment of skill in some games......, and the dynamic nature of the task in most games. We consider the game shows Card Sharks, Jeopardy!, Lingo, and finally Deal Or No Deal. We provide a detailed case study of the analyses of Deal Or No Deal, since it is suitable for inference about risk attitudes and has attracted considerable attention....

  16. Measuring performance at trade shows

    DEFF Research Database (Denmark)

    Hansen, Kåre

    2004-01-01

    Trade shows is an increasingly important marketing activity to many companies, but current measures of trade show performance do not adequately capture dimensions important to exhibitors. Based on the marketing literature's outcome and behavior-based control system taxonomy, a model is built...... that captures a outcome-based sales dimension and four behavior-based dimensions (i.e. information-gathering, relationship building, image building, and motivation activities). A 16-item instrument is developed for assessing exhibitors perceptions of their trade show performance. The paper presents evidence...

  17. Tokyo Motor Show 2003; Tokyo Motor Show 2003

    Energy Technology Data Exchange (ETDEWEB)

    Joly, E.

    2004-01-01

    The text which follows present the different techniques exposed during the 37. Tokyo Motor Show. The report points out the great tendencies of developments of the Japanese automobile industry. The hybrid electric-powered vehicles or those equipped with fuel cells have been highlighted by the Japanese manufacturers which allow considerable budgets in the research of less polluting vehicles. The exposed models, although being all different according to the manufacturer, use always a hybrid system: fuel cell/battery. The manufacturers have stressed too on the intelligent systems for navigation and safety as well as on the design and comfort. (O.M.)

  18. Reality show: um paradoxo nietzschiano

    Directory of Open Access Journals (Sweden)

    Ilana Feldman

    2011-01-01

    Full Text Available

    O fenômeno dos reality shows - e a subseqüente relação entre imagem e verdade - assenta-se sobre uma série de paradoxos. Tais paradoxos podem ser compreendidos à luz do pensamento do filósofo alemão Friedrich Nietzsche, que, através dos usos de formulações paradoxais, concebia a realidade como um mundo de pura aparência e a verdade como um acréscimo ficcional, como um efeito. A ficção é então tomada, na filosofia de Nietzsche, não em seu aspecto falsificante e desrealizador - como sempre pleiteou nossa tradição metafísica -, mas como condição necessária para que certa espécie de invenção possa operar como verdade. Sendo assim, a própria expressão reality show, através de sua formulação paradoxal, engendra explicitamente um mundo de pura aparência, em que a verdade, a parte reality da proposição, é da ordem do suplemento, daquilo que se acrescenta ficcionalmente - como um adjetivo - a show. O ornamento, nesse caso, passa a ocupar o lugar central, apontando para o efeito produzido: o efeito-de-verdade. Seguindo, então, o pensamento nietzschiano e sua atualização na contemporaneidade, investigaremos de que forma os televisivos “shows de realidade” operam paradoxalmente, em consonância com nossas paradoxais práticas culturais.

  19. 75 FR 61219 - Entergy Operations, Inc.; River Bend Station, Unit 1; Environmental Assessment and Finding of No...

    Science.gov (United States)

    2010-10-04

    ... Corrective Actions,'' and Table 13.3-17, ``Shift Staffing and Augmentation Capabilities,'' of the RBS... proposed action will not have a significant effect on the quality of the human environment. Accordingly...

  20. 77 FR 59888 - Notice of Request for Revision of a Currently Approved Information Collection

    Science.gov (United States)

    2012-10-01

    ... announces the Rural Business-Cooperative Service's (RBS) intention to request an extension for a currently... small businesses for the purchase of renewable energy systems and the implementation of energy...

  1. Spectroscopy in catalysis : an introduction

    NARCIS (Netherlands)

    Niemantsverdriet, J.W.

    2000-01-01

    Spectroscopy in Catalysis describes the most important modern analytical techniques used to investigate catalytic surfaces. These include electron spectroscopy (XPS, UPS, AES, EELS), ion spectroscopy (SIMS, SNMS, RBS, LEIS), vibrational spectroscopy (infrared, Raman, EELS), temperature-programmed

  2. New layout of time resolved beam energy spectrum measurement for dragon-I

    International Nuclear Information System (INIS)

    Liao Shuqing; Zhang Kaizhi; Shi Jinshui

    2010-01-01

    A new layout of time resolved beam energy spectrum measurement is proposed for Dragon-I by a new method named RBS (rotating beams in solenoids). The basic theory of RBS and the new layout are presented and the measuring error is also discussed. The derived time resolved beam energy spectrum is discrete and is determined by measuring the beam's rotating angle and expanding width through a group of solenoids at the export of Dragon-I. (authors)

  3. Laser annealing of ion implanted silicon by the aid of a Q-switched neodymium glass laser

    International Nuclear Information System (INIS)

    Exner, H.; Laemmel, B.; Zscherpe, G.

    1984-01-01

    Experimental results of laser annealing of arsenic implanted silicon are presented. Different depths of melting are obtained by varying the energy flux density of the Q-switched neodymium glass laser. The annealed samples are studied by the aid of optical microscopy, scanning electron microscopy, Rutherford backscattering spectrometry (RBS) combined with ion channeling, and of resistance measurements. Not any defect could be found by RBS and no surface structure could be determined by microscopy

  4. A comparison of the structural changes and optical properties of LiNbO3, Al2O3 and ZnO after Er+ ion implantation

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Pupíková, Hana; Nekvindová, P.; Cajzl, J.; Švecová, B.; Oswald, Jiří; Wilhelm, R. A.; Kolitsch, A.

    2014-01-01

    Roč. 331, JUL (2014), s. 182-186 ISSN 0168-583X R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk(XE) LM2011019 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : Er ion implantation * crystals * depth profiles * RBS * RBS channelling * photoluminescence Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.124, year: 2014

  5. Complementarities of nuclear-based analytical techniques for the characterization of thin film technological materials

    International Nuclear Information System (INIS)

    Bamford, Samuel; Kregsamer, Peter; Fazinic, Stjepko; Jaksic, Milko; Wegrzynek, Dariusz; Chinea-Cano, Ernesto; Markowicz, Andrzej

    2007-01-01

    Two thin film technological materials (A/B) from the aerospace industry have been characterized for their elemental composition, for the purpose of determining their purity and trace element distribution. The results contribute to the assessment of the materials' suitability as part of a spacecraft's thermal hardware. Analysis was done using a combination of PIXE/RBS and energy dispersive X-ray fluorescence (EDXRF) analytical techniques. Samples of the materials were analyzed with PIXE/RBS system using 2 MeV proton beam from a 1 MV Tandetron accelerator and also with separate EDXRF systems employing Am-241 and Mo-secondary target as excitation sources. PIXE/RBS measurements enabled identification of the elemental composition and elucidation of the layer structure of the materials. From the PIXE/RBS results, Am-241-excited EDXRF technique was selected for quantitative determination of indium (In) and tin (Sn) by their K-X-rays, after reasonable absorption corrections. A comparison has been made of the results obtained from EDXRF and PIXE/RBS. Material A has been found to be a thin film with three layers, while material B is a thin film comprised of four layers. Thicknesses and compositions (including trace elements) of all layers have been determined. The limitation of EDXRF in the analysis of inhomogeneously distributed elements was overcome by using PIXE/RBS as an appropriate complimentary technique

  6. Stoichiometry, thickness and crystallinity of MOCVD grown Hg{sub 1x-y}Cd{sub x}Mn{sub y}Te determined by nuclear techniques of analysis

    Energy Technology Data Exchange (ETDEWEB)

    Studd, W B; Johnston, P N; Bubb, I F [Royal Melbourne Inst. of Tech., VIC (Australia); Leech, P W [Applied Research and Developement, Telecom Australia, Clayton, VIC (Australia)

    1994-12-31

    The quaternary semi-conductor Hg{sub 1-x-y}Cd{sub x}Mn{sub y}Te has been grown by Metal Organic Chemical Vapour Deposition using the Interdiffused Multi-layer Process. The layers have been analysed by Ion beam (PIXE, RBS, channeling) and related analytical techniques (EDXRF, XRD, RHEED) to obtain stoichiometric and structural information. The analysis shows that all four elements are present throughout the layer and that the elemental concentrations and thickness of the layer vary considerably over the film. Channeling, XRD and RHEED have been combined to show that the layer is polycrystalline. 14 refs., 3 figs.

  7. Stoichiometry, thickness and crystallinity of MOCVD grown Hg{sub 1x-y}Cd{sub x}Mn{sub y}Te determined by nuclear techniques of analysis

    Energy Technology Data Exchange (ETDEWEB)

    Studd, W.B.; Johnston, P.N.; Bubb, I.F. [Royal Melbourne Inst. of Tech., VIC (Australia); Leech, P.W. [Applied Research and Developement, Telecom Australia, Clayton, VIC (Australia)

    1993-12-31

    The quaternary semi-conductor Hg{sub 1-x-y}Cd{sub x}Mn{sub y}Te has been grown by Metal Organic Chemical Vapour Deposition using the Interdiffused Multi-layer Process. The layers have been analysed by Ion beam (PIXE, RBS, channeling) and related analytical techniques (EDXRF, XRD, RHEED) to obtain stoichiometric and structural information. The analysis shows that all four elements are present throughout the layer and that the elemental concentrations and thickness of the layer vary considerably over the film. Channeling, XRD and RHEED have been combined to show that the layer is polycrystalline. 14 refs., 3 figs.

  8. Interaction mechanisms of europium and nickel with calcite

    International Nuclear Information System (INIS)

    Sabau, Andrea

    2015-01-01

    In the context of the safety assessment of an underground repository for nuclear waste, sorption reactions are one of the main processes to take into account to predict the migration of the radionuclides which might be transferred from the waste canisters to underground waters over geological time scales. Sorption of aqueous species on minerals can include adsorption processes, surface (co)-precipitation, and even incorporation in the bulk of the material, which can lead to the irreversibility of some sorption reactions. This work is focused on two elements: Eu(III) as an analogue of trivalent actinides and Ni(II) as activation product. Calcite was chosen as adsorbent due to its presence in Callovian-Oxfordian clay rocks. Our study combines batch experiments with spectroscopic techniques (TRLFS, RBS and SEM-EDXS) to elucidate the mechanisms occurring at Eu(III)/Ni(II) calcite interface. To obtain a better understanding on the systems, before starting sorption experiments, aqueous chemistry of Eu(III) and Ni(II) was carefully investigated. Macroscopic results showed a strong retention of Eu(III) on calcite, no matter the initial concentration, contact time and CO 2 partial pressure. Ni(II) was also readily sorbed by calcite, but the retention was influenced by contact time and concentration. Time-dependent sorption experiments showed a marked and slow increase of retention upon a long time range (up to 4 months).Desorption results indicated a partly reversible sorption for Ni(II). TRLFS highlighted the influence of initial concentration and contact time on the interaction of Eu(III) with calcite. With the help of RBS and SEM-EDXS, it enabled to discriminate between different mechanisms like surface precipitation, inner-sphere complexation and incorporation. RBS showed incorporation of Eu(III) into calcite up to 250 nm, contrary to Ni(II) which was located at the surface. (author) [fr

  9. Penicillin kills Chlamydia following the fusion of bacteria with lysosomes and prevents genital inflammatory lesions in C. muridarum-infected mice.

    Directory of Open Access Journals (Sweden)

    Maud Dumoux

    Full Text Available The obligate intracellular bacterium Chlamydia exists as two distinct forms. Elementary bodies (EBs are infectious and extra-cellular, whereas reticulate bodies (RBs replicate within a specialized intracellular compartment termed an 'inclusion'. Alternative persistent intra-cellular forms can be induced in culture by diverse stimuli such as IFNγ or adenosine/EHNA. They do not grow or divide but revive upon withdrawal of the stimulus and are implicated in several widespread human diseases through ill-defined in vivo mechanisms. β-Lactam antibiotics have also been claimed to induce persistence in vitro. The present report shows that upon penicillin G (pG treatment, inclusions grow as fast as those in infected control cells. After removal of pG, Chlamydia do not revert to RBs. These effects are independent of host cell type, serovar, biovar and species of Chlamydia. Time-course experiments demonstrated that only RBs were susceptible to pG. pG-treated bacteria lost their control over host cell apoptotic pathways and no longer expressed pre-16S rRNA, in contrast to persistent bacteria induced with adenosine/EHNA. Confocal and live-video microscopy showed that bacteria within the inclusion fused with lysosomal compartments in pG-treated cells. That leads to recruitment of cathepsin D as early as 3 h post pG treatment, an event preceding bacterial death by several hours. These data demonstrate that pG treatment of cultured cells infected with Chlamydia results in the degradation of the bacteria. In addition we show that pG is significantly more efficient than doxycycline at preventing genital inflammatory lesions in C. muridarum-C57Bl/6 infected mice. These in vivo results support the physiological relevance of our findings and their potential therapeutic applications.

  10. Composition and structural analysis of Sm-Co thin films on (100)Si

    International Nuclear Information System (INIS)

    Ghantasala, M.; Sood, D.K.; Mohan, S.

    1998-01-01

    Full text: The necessity of integration of magnetics with silicon processing technology became essential with the advent of Micro Electromechanical Systems (MEMS). The need to control the crystalline and magnetic properties of the magnetic thin films on silicon substrates has been the primary motivation for this work. The major objective of this work is to prepare the stoichiometric and crystalline SmCo 5 thin films with good magnetic properties on single crystal silicon substrate. We have prepared the SmCo think films on single crystal (100) silicon substrates using DC magnetron sputtering. Films have been prepared in pure argon as the sputter media at two different pressures 2 x 10 -2 torr and 2 x 10 3 torr with the substrates kept at room temperature, 500 and 700 deg C separately. These films have been characterised using RBS, XRD and SEM. RBS analysis showed that the films are nearly stoichiometric (1:4.9) and have significant amounts of oxygen as impurity. But XRD studies indicated that the as deposited films (at all substrate temperatures) are yet to form the crystalline structure. Some of the films have been subjected to rapid thermal annealing at two different temperatures at 800 and 1000 deg C for 30 secs in an effort to crystallise the films. RBS analysis of these films indicated that the room temperature and post annealed films at 1000 deg C resulted in considerable interdiffusion characteristics, whereas the high temperature deposited (500 and 700 deg C) and annealed films showed relatively very stable characteristics with minimal diffusion between the film and the substrate. XRD and SEM analysis of the films is in progress. The detailed results of these investigations will be presented

  11. Characterisation of candidate reference materials by PIXE analysis and nuclear microprobe PIXE imaging

    International Nuclear Information System (INIS)

    Jaksic, M.; Pastuovic, Z.; Bogdanovic, I.; Tadic, T.

    2002-01-01

    In order to test whether some candidate reference materials show homogeneity that can satisfy quality control of the PIXE technique, six bottles of each of the two Candidate RM's - Lichen (IAEA 338) and Algae (IAEA 413) were tested. Four different tests were performed. First, two pellets from each bottle were prepared and analysed using broad beam (φ = 5 mm) PIXE. Second and third was analysis of homogeneity using scanning focussed beam at the nuclear microprobe. Scans of 50x50 μm 2 and 240x260 μm 2 were performed. Finally, individual grains with composition differing from the rest of the sample, were analysed using PIXE and RBS. (author)

  12. Oxide layers of Zr-1% Nb under PWR primary circuit conditions

    International Nuclear Information System (INIS)

    Nagy, Gabor; Kerner, Zsolt; Battistig, Gabor; Pinter-Csordas, Anna; Balogh, Janos; Pajkossy, Tamas

    2001-01-01

    Oxide layers were grown on Zr-1% Nb under conditions simulating those in VVER-type pressurised water reactors (PWRs), viz. in borate solutions in an autoclave at 290 deg. C. The layers were characterised by various methods: their respective thickness values were determined by weight gain measurements, Rutherford backscattering (RBS), nuclear reaction analysis (NRA) and scanning electron microscopy (SEM); the electrical properties were tested by electrochemical impedance spectroscopy. The results show that the oxide layer on Zr-1% Nb is homogeneous and somewhat thicker than that on Zircaloy-4

  13. Improvements in technique for determining the surfactant penetration in hair fibres using scanning ion beam analyses

    International Nuclear Information System (INIS)

    Hollands, R.; Clough, A.S.; Meredith, P.

    1999-01-01

    The penetration abilities of surfactants need to be known by companies manufacturing hair-care products. In this work three complementary techniques were used simultaneously - PIXE, NRA and RBS - to measure the penetration of a surfactant, which had been deuterated, into permed hair fibres. Using a scanning micro-beam of 2 MeV 3 He ions 2-dimensional concentration maps were obtained which showed whether the surfactant penetrated the fibre or just stayed on the surface. This is the first report of the use of three simultaneous scattering techniques with a scanning micro-beam. (author)

  14. Influenza human monoclonal antibody 1F1 interacts with three major antigenic sites and residues mediating human receptor specificity in H1N1 viruses.

    Directory of Open Access Journals (Sweden)

    Tshidi Tsibane

    Full Text Available Most monoclonal antibodies (mAbs to the influenza A virus hemagglutinin (HA head domain exhibit very limited breadth of inhibitory activity due to antigenic drift in field strains. However, mAb 1F1, isolated from a 1918 influenza pandemic survivor, inhibits select human H1 viruses (1918, 1943, 1947, and 1977 isolates. The crystal structure of 1F1 in complex with the 1918 HA shows that 1F1 contacts residues that are classically defined as belonging to three distinct antigenic sites, Sa, Sb and Ca(2. The 1F1 heavy chain also reaches into the receptor binding site (RBS and interacts with residues that contact sialoglycan receptors and determine HA receptor specificity. The 1F1 epitope is remarkably similar to the previously described murine HC63 H3 epitope, despite significant sequence differences between H1 and H3 HAs. Both antibodies potently inhibit receptor binding, but only HC63 can block the pH-induced conformational changes in HA that drive membrane fusion. Contacts within the RBS suggested that 1F1 may be sensitive to changes that alter HA receptor binding activity. Affinity assays confirmed that sequence changes that switch the HA to avian receptor specificity affect binding of 1F1 and a mAb possessing a closely related heavy chain, 1I20. To characterize 1F1 cross-reactivity, additional escape mutant selection and site-directed mutagenesis were performed. Residues 190 and 227 in the 1F1 epitope were found to be critical for 1F1 reactivity towards 1918, 1943 and 1977 HAs, as well as for 1I20 reactivity towards the 1918 HA. Therefore, 1F1 heavy-chain interactions with conserved RBS residues likely contribute to its ability to inhibit divergent HAs.

  15. Imaging of brain TSPO expression in a mouse model of amyotrophic lateral sclerosis with 18F-DPA-714 and micro-PET/CT

    International Nuclear Information System (INIS)

    Gargiulo, S.; Gramanzini, M.; Anzilotti, S.; Salvatore, M.; Coda, A.R.D.; Panico, M.; Zannetti, A.; Vicidomini, C.; Quarantelli, M.; Pappata, S.; Greco, A.; Brunetti, A.; Vinciguerra, A.; Pignataro, G.; Dolle, F.; Annunziato, L.

    2016-01-01

    To evaluate the feasibility and sensitivity of 18 F-DPA-714 for the study of microglial activation in the brain and spinal cord of transgenic SOD1 G93A mice using high-resolution PET/CT and to evaluate the Iba1 and TSPO expression with immunohistochemistry. Nine symptomatic SOD1 G93A mice (aged 117 ± 12.7 days, clinical score range 1 - 4) and five WT SOD1 control mice (aged 108 ± 28.5 days) underwent 18 F-DPA-714 PET/CT. SUV ratios were calculated by normalizing the cerebellar (rCRB), brainstem (rBS), motor cortex (rMCX) and cervical spinal cord (rCSC) activities to that of the frontal association cortex. Two WT SOD1 and six symptomatic SOD1 G93A mice were studied by immunohistochemistry. In the symptomatic SOD1 G93A mice, rCRB, rBS and rCSC were increased as compared to the values in WT SOD1 mice, with a statistically significantly difference in rBS (2.340 ± 0.784 vs 1.576 ± 0.287, p = 0.014). Immunofluorescence studies showed that TSPO expression was increased in the trigeminal, facial, ambiguus and hypoglossal nuclei, as well as in the spinal cord, of symptomatic SOD1 G93A mice and was colocalized with increased Iba1 staining. Increased 18 F-DPA-714 uptake can be detected with high-resolution PET/CT in the brainstem of transgenic SOD1 G93A mice, a region known to be a site of degeneration and increased microglial activation in amyotrophic lateral sclerosis, in agreement with increased TSPO expression in the brainstem nuclei shown by immunostaining. Therefore, 18 F-DPA-714 PET/CT might be a suitable tool to evaluate microglial activation in the SOD1 G93A mouse model. (orig.)

  16. Ratiometric two-photon excited photoluminescence of quantum dots triggered by near-infrared-light for real-time detection of nitric oxide release in situ

    Energy Technology Data Exchange (ETDEWEB)

    Jin, Hui [Shandong Sino-Japanese Center for Collaborative Research of Carbon Nanomaterials, Collaborative Innovation Center for Marine Biomass Fiber Materials and Textiles, College of Chemistry and Chemical Engineering, Laboratory of Fiber Materials and Modern Textile, The Growing Base for State Key Laboratory, Qingdao University, Shandong 266071 (China); Gui, Rijun, E-mail: guirijun@qdu.edu.cn [Shandong Sino-Japanese Center for Collaborative Research of Carbon Nanomaterials, Collaborative Innovation Center for Marine Biomass Fiber Materials and Textiles, College of Chemistry and Chemical Engineering, Laboratory of Fiber Materials and Modern Textile, The Growing Base for State Key Laboratory, Qingdao University, Shandong 266071 (China); Sun, Jie; Wang, Yanfeng [Institute of Materia Medica, Shandong Academy of Medical Sciences, Jinan 250062 (China)

    2016-05-30

    Probe-donor integrated nanocomposites were developed from conjugating silica-coated Mn{sup 2+}:ZnS quantum dots (QDs) with MoS{sub 2} QDs and photosensitive nitric oxide (NO) donors (Fe{sub 4}S{sub 3}(NO){sub 7}{sup −}, RBS). Under excitation with near-infrared (NIR) light at 808 nm, the Mn{sup 2+}:ZnS@SiO{sub 2}/MoS{sub 2}-RBS nanocomposites showed the dual-emissive two-photon excited photoluminescence (TPEPL) that induced RBS photolysis to release NO in situ. NO caused TPEPL quenching of Mn{sup 2+}:ZnS QDs, but it produced almost no impact on the TPEPL of MoS{sub 2} QDs. Hence, the nanocomposites were developed as a novel QDs-based ratiometric TPEPL probe for real-time detection of NO release in situ. The ratiometric TPEPL intensity is nearly linear (R{sup 2} = 0.9901) with NO concentration in the range of 0.01∼0.8 μM, which corresponds to the range of NO release time (0∼15 min). The detection limit was calculated to be approximately 4 nM of NO. Experimental results confirmed that this novel ratiometric TPEPL probe possessed high selectivity and sensitivity for the detection of NO against potential competitors, and especially showed high detection performance for NIR-light triggered NO release in tumor intracellular microenvironments. These results would promote the development of versatile probe-donor integrated systems, also providing a facile and efficient strategy to real-time detect the highly controllable drug release in situ, especially in physiological microenvironments. - Highlights: • Mn{sup 2+}:ZnS@SiO{sub 2}/MoS{sub 2}-RBS nanocomposites were developed as a novel ratiometric two-photon excited fluorescence probe. • This probe could conduct real-time detection of nitric oxide release in situ. • High feasibility of this probe was confirmed in tumor intracellular microenvironments.

  17. Characterization of a minimal pKW2124 replicon from Weissella cibaria KLC140 and its application for the construction of the Weissella expression vector pKUCm1

    Science.gov (United States)

    Ku, Hye-Jin; Park, Myeong Soo; Lee, Ju-Hoon

    2015-01-01

    A 2.1-kb plasmid was previously isolated from Weissella cibaria KLC140 in kimchi and cloned into pUC19 along with the slpA and gfp genes, resulting in an 8.6-kb pKWCSLGFP construct for use as a novel surface display vector. To reduce the size of the vector, the minimal replicon of pKW2124 was determined. The pKW2124 plasmid contains a putative origin of replication (ori), a potential ribosomal binding site (RBS), and the repA gene encoding a plasmid replication protein. To conduct the minimal replicon experiment, four different PCR products (MR1, ori+RBS+repA; MR2, RBS+repA; MR2’, repA; MR3, fragment of repA) were obtained and cloned into pUC19 (pKUCm1, pKUCm2, pKUCm2’, and pKUCm3, respectively) containing the chloramphenicol acetyltransferase (CAT) gene. These constructed vectors were electroporated into W. confusa ATCC 10881 with different transformation efficiencies of 1.5 × 105 CFU/μg, 1.3 × 101 CFU/μg, and no transformation, respectively, suggesting that the putative ori, RBS, and repA gene are essential for optimum plasmid replication. Subsequent segregational plasmid stability testing of pKUCm1 and pKUCm2 showed that the vector pKUCm1 is highly stable up to 100 generations but pKUCm2 was completely lost after 60 generations, suggesting that the putative ori may be important for plasmid stability in the host strain. In addition, a host range test of pKUCm1 revealed that it has a broad host range spectrum including Weissella, Lactococcus, Leuconostoc, and even Lactobacillus. To verify the application of pKUCm1, the β-galactosidase gene and its promoter region from W. cibaria KSD1 were cloned in the vector, resulting in pKUGal. Expression of the β-galactosidase gene was confirmed using blue-white screening after IPTG induction. The small and stable pKUGal vector will be useful for gene transfer, expression, and manipulation in the Weissella genome and in other lactic acid bacteria. PMID:25691882

  18. Effect of the growth temperature and the AlN mole fraction on In incorporation and properties of quaternary III-nitride layers grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    Fernandez-Garrido, S.; Pereiro, J.; Munoz, E.; Calleja, E.; Redondo-Cubero, A.; Gago, R.; Bertram, F.; Christen, J.; Luna, E.; Trampert, A.

    2008-01-01

    Indium incorporation into wurtzite (0001)-oriented In x Al y Ga 1-x-y N layers grown by plasma-assisted molecular beam epitaxy was studied as a function of the growth temperature (565-635 deg. C) and the AlN mole fraction (0.01< y<0.27). The layer stoichiometry was determined by Rutherford backscattering spectrometry (RBS). RBS shows that indium incorporation decreased continuously with increasing growth temperature due to thermally enhanced dissociation of In-N bonds and for increasing AlN mole fractions. High resolution x-ray diffraction and transmission electron microscopy (TEM) measurements did not show evidence of phase separation. The mosaicity of the quaternary layers was found to be mainly determined by the growth temperature and independent on alloy composition within the range studied. However, depending on the AlN mole fraction, nanometer-sized composition fluctuations were detected by TEM. Photoluminescence spectra showed a single broad emission at room temperature, with energy and bandwidth S- and W-shaped temperature dependences typical of exciton localization by alloy inhomogeneities. Cathodoluminescence measurements demonstrated that the alloy inhomogeneities, responsible of exciton localization, occur on a lateral length scale below 150 nm, which is corroborated by TEM

  19. UV Photography Shows Hidden Sun Damage

    Science.gov (United States)

    ... mcat1=de12", ]; for (var c = 0; c UV photography shows hidden sun damage A UV photograph gives ... developing skin cancer and prematurely aged skin. Normal photography UV photography 18 months of age: This boy's ...

  20. Determination of surface oxide compositions on Alloy 600 using Rutherford backscattering

    International Nuclear Information System (INIS)

    Hanson, A.L.; Kraner, H.W.

    1984-01-01

    The surface composition of oxides formed on Alloy 600 under conditions similar to those in the primary side of PWR heat exchangers has been studied as a function of potential using Rutherford backscattering and proton inelastic scattering. Electropolished samples of Alloy 600 were exposed at several potentials to a solution of 0.18M H 3 BO 3 (2000ppm B) with 0.21mM LiOH (1.5ppm Li) at 300 0 C for 450 hours. The potentials relative to an internal hydrogen electrode ranged from -.09 to 750 mV. RBS analysis showed little or no oxide formation on samples exposed at 0 mV. Above 0 mV oxide layers formed whose thicknesses increased with potential. In addition the RBS showed a significantly enhanced concentration of aluminum and silicon in oxide. Both the oxygen and the sum of the aluminum and silicon content appeared to maintain a fixed surface concentration independent of the oxide thickness. Boron and lithium concentrations were analyzed with proton inelastic scattering. No lithium was detected in any sample. The boron concentration was found to follow the thickness of the oxide

  1. Determination of surface oxide compositions on Alloy 600 using Rutherford backscattering

    International Nuclear Information System (INIS)

    Hanson, A.L.; Isaacs, H.S.; Kraner, H.W.

    1984-01-01

    The surface composition of oxides formed on Alloy 600 under conditions similar to those in the primary side of PWR heat exchangers has been studied as a function of potential using Rutherford backscattering and proton inelastic scattering. Electropolished samples of Alloy 600 were exposed at several potentials to a solution of 0.18M H 3 BO 3 (2000 ppM B) with 0.28M LiOH (1.4 ppM Li) at 300 0 C for 450 hours. The potentials relative to an internal hydrogen electrode ranged from -.09 to 750 mV. RBS analysis showed little or no oxide formation on samples exposed at 0 mV. Above 0 mV oxide layers formed whose thicknesses increased with potential. In addition the RBS showed a significantly enhanced concentration of aluminum and silicon in oxide. Both the oxygen and the sum of the aluminum and silicon content appeared to maintain a fixed surface concentration independent of the oxide thickness. Boron and lithium concentration were analyzed with proton inelastic scattering. No lithium was found in any sample. The boron concentration was found to follow the thickness of the oxide

  2. Effects of thermal annealing on the structural, mechanical, and tribological properties of hard fluorinated carbon films deposited by plasma enhanced chemical vapor deposition

    Science.gov (United States)

    Maia da Costa, M. E. H.; Baumvol, I. J. R.; Radke, C.; Jacobsohn, L. G.; Zamora, R. R. M.; Freire, F. L.

    2004-11-01

    Hard amorphous fluorinated carbon films (a-C:F) deposited by plasma enhanced chemical vapor deposition were annealed in vacuum for 30 min in the temperature range of 200-600 °C. The structural and compositional modifications were followed by several analytical techniques: Rutherford backscattering spectrometry (RBS), elastic recoil detection analysis (ERDA), x-ray photoelectron spectroscopy (XPS) and Raman spectroscopy. Nanoidentation measurements and lateral force microscopy experiments were carried out in order to provide the film hardness and the friction coefficient, respectively. The internal stress and contact angle were also measured. RBS, ERDA, and XPS results indicate that both fluorine and hydrogen losses occur for annealing temperatures higher than 300 °C. Raman spectroscopy shows a progressive graphitization upon annealing, while the surface became slightly more hydrophobic as revealed by the increase of the contact angle. Following the surface wettability reduction, a decrease of the friction coefficient was observed. These results highlight the influence of the capillary condensation on the nanoscale friction. The film hardness and the internal stress are constant up to 300 °C and decrease for higher annealing temperatures, showing a direct correlation with the atomic density of the films. Since the thickness variation is negligible, the mass loss upon thermal treatment results in amorphous structures with a lower degree of cross-linking, explaining the deterioration of the mechanical properties of the a-C:F films.

  3. Study of Organosilicon Plasma Polymer Used in Composite Layers with Biomedical Application

    International Nuclear Information System (INIS)

    Radeva, E.; Pramatarova, L.; Pecheva, E.; Hikov, T.; Fingarova, D.; Iacob, E.; Vanzetti, L.; Dimitrova, R.; Krasteva, N.; Spassov, T.

    2010-01-01

    In this work we study the ability of plasma polymer (PP) films obtained from hexamethyldisiloxane (HMDS) on silica glass (SG) to induce hydroxyapatite (HA)-based composite layers from a mixture of simulated body fluid (SBF) and clear solution of detonation nanodiamond (DND) by a biomimetic process. The grown composites (PPHMDS/HADND) were studied by scanning electron microscopy (SEM), Fourier transform infrared (FTIR) spectroscopy and Rutherford backscattering (RBS) techniques. FTIR spectra of the PPHMDS indicated diminishing of the polymer characteristic bands when the polymer is immersed in DND clear solution. Furthermore, after sample immersion in the SBF-DND mixture, the FTIR spectra showed the presence of carbonate-containing HA through the characteristic vibration modes of P-O in the phosphate group and C-O in the carbonate group. The formation of HA layers, rich in silica and/or carbon was confirmed by RBS and SEM. The cell viability measured after 7 days on the polymer surface is more then 95% for all samples. The results show that the PPHMDS is promising as a substrate for growing HA/DND layers and that the materials obtained are biocompatible. The variations of plasma polymerization conditions and modification of the composite layers will aid in using such materials for biomedical applications.

  4. Lattice damage induced by Tb-implanted AlN crystalline films

    International Nuclear Information System (INIS)

    Lu Fei; Hu Hui; Rizzi, A.

    2002-01-01

    AlN films with thickness from 100 to 1000 nm were grown on SiC substrate by MBE. AlN crystalline films were doped by implantation with 160 keV Tb ions to fluences of 5x10 14 , 1.5x10 15 , 3x10 15 and 6x10 15 ions/cm 2 , respectively. The damage profiles in AlN films induced by Tb implantation were investigated using RBS/channeling technique. A procedure developed by Feldman and Rodgers was used to extract damage profile by considering the dechanneling mechanism of multiple. The comparison of the extracted profile with TRIM prediction shows a significant difference in the shape and in the position of damage profile. The damage profile in AlN film is similar as Tb distribution. The RBS/channeling of Tb-implanted AlN film before and after 950 deg. C annealing treatments show a good consistency, which indicate that high temperature annealing cannot result in a significant change in both crystal damage and in Tb distribution

  5. Educational Outreach: The Space Science Road Show

    Science.gov (United States)

    Cox, N. L. J.

    2002-01-01

    The poster presented will give an overview of a study towards a "Space Road Show". The topic of this show is space science. The target group is adolescents, aged 12 to 15, at Dutch high schools. The show and its accompanying experiments would be supported with suitable educational material. Science teachers at schools can decide for themselves if they want to use this material in advance, afterwards or not at all. The aims of this outreach effort are: to motivate students for space science and engineering, to help them understand the importance of (space) research, to give them a positive feeling about the possibilities offered by space and in the process give them useful knowledge on space basics. The show revolves around three main themes: applications, science and society. First the students will get some historical background on the importance of space/astronomy to civilization. Secondly they will learn more about novel uses of space. On the one hand they will learn of "Views on Earth" involving technologies like Remote Sensing (or Spying), Communication, Broadcasting, GPS and Telemedicine. On the other hand they will experience "Views on Space" illustrated by past, present and future space research missions, like the space exploration missions (Cassini/Huygens, Mars Express and Rosetta) and the astronomy missions (Soho and XMM). Meanwhile, the students will learn more about the technology of launchers and satellites needed to accomplish these space missions. Throughout the show and especially towards the end attention will be paid to the third theme "Why go to space"? Other reasons for people to get into space will be explored. An important question in this is the commercial (manned) exploration of space. Thus, the questions of benefit of space to society are integrated in the entire show. It raises some fundamental questions about the effects of space travel on our environment, poverty and other moral issues. The show attempts to connect scientific with

  6. 2008 LHC Open Days Physics: the show

    CERN Multimedia

    2008-01-01

    A host of events and activities await visitors to the LHC Open Days on 5 and 6 April. A highlight will be the physics shows funded by the European Physical Society (EPS), which are set to surprise and challenge children and adults alike! School children use their experience of riding a bicycle to understand how planets move around the sun (Copyright : Circus Naturally) Participating in the Circus Naturally show could leave a strange taste in your mouth! (Copyright : Circus Naturally) The Rino Foundation’s experiments with liquid nitrogen can be pretty exciting! (Copyright: The Rino Foundation)What does a bicycle have in common with the solar system? Have you ever tried to weigh air or visualise sound? Ever heard of a vacuum bazooka? If you want to discover the answers to these questions and more then come to the Physics Shows taking place at the CERN O...

  7. Online Italian fandoms of American TV shows

    Directory of Open Access Journals (Sweden)

    Eleonora Benecchi

    2015-06-01

    Full Text Available The Internet has changed media fandom in two main ways: it helps fans connect with each other despite physical distance, leading to the formation of international fan communities; and it helps fans connect with the creators of the TV show, deepening the relationship between TV producers and international fandoms. To assess whether Italian fan communities active online are indeed part of transnational online communities and whether the Internet has actually altered their relationship with the creators of the original text they are devoted to, qualitative analysis and narrative interviews of 26 Italian fans of American TV shows were conducted to explore the fan-producer relationship. Results indicated that the online Italian fans surveyed preferred to stay local, rather than using geography-leveling online tools. Further, the sampled Italian fans' relationships with the show runners were mediated or even absent.

  8. Duchenne muscular dystrophy models show their age

    OpenAIRE

    Chamberlain, Jeffrey S.

    2010-01-01

    The lack of appropriate animal models has hampered efforts to develop therapies for Duchenne muscular dystrophy (DMD). A new mouse model lacking both dystrophin and telomerase (Sacco et al., 2010) closely mimics the pathological progression of human DMD and shows that muscle stem cell activity is a key determinant of disease severity.

  9. Show Them You Really Want the Job

    Science.gov (United States)

    Perlmutter, David D.

    2012-01-01

    Showing that one really "wants" the job entails more than just really wanting the job. An interview is part Broadway casting call, part intellectual dating game, part personality test, and part, well, job interview. When there are 300 applicants for a position, many of them will "fit" the required (and even the preferred) skills listed in the job…

  10. A Talk Show from the Past.

    Science.gov (United States)

    Gallagher, Arlene F.

    1991-01-01

    Describes a two-day activity in which elementary students examine voting rights, the right to assemble, and women's suffrage. Explains the game, "Assemble, Reassemble," and a student-produced talk show with five students playing the roles of leaders of the women's suffrage movement. Profiles Elizabeth Cady Stanton, Lucretia Mott, Susan…

  11. Laser entertainment and light shows in education

    Science.gov (United States)

    Sabaratnam, Andrew T.; Symons, Charles

    2002-05-01

    Laser shows and beam effects have been a source of entertainment since its first public performance May 9, 1969, at Mills College in Oakland, California. Since 1997, the Photonics Center, NgeeAnn Polytechnic, Singapore, has been using laser shows as a teaching tool. Students are able to exhibit their creative skills and learn at the same time how lasers are used in the entertainment industry. Students will acquire a number of skills including handling three- phase power supply, operation of cooling system, and laser alignment. Students also acquire an appreciation of the arts, learning about shapes and contours as they develop graphics for the shows. After holography, laser show animation provides a combination of the arts and technology. This paper aims to briefly describe how a krypton-argon laser, galvanometer scanners, a polychromatic acousto-optic modulator and related electronics are put together to develop a laser projector. The paper also describes how students are trained to make their own laser animation and beam effects with music, and at the same time have an appreciation of the operation of a Class IV laser and the handling of optical components.

  12. The Last Great American Picture Show

    NARCIS (Netherlands)

    Elsaesser, Thomas; King, Noel; Horwath, Alexander

    2004-01-01

    The Last Great American Picture Show brings together essays by scholars and writers who chart the changing evaluations of the American cinema of the 1970s, sometimes referred to as the decade of the lost generation, but now more and more recognized as the first New Hollywood, without which the

  13. Reality, ficción o show

    Directory of Open Access Journals (Sweden)

    Sandra Ruíz Moreno

    2002-01-01

    Full Text Available Para tener un punto de vista claro y objetivo frente a la polémica establecida en torno al programa “Protagonistas de novela” y la tendiente proliferación de los reality show en las parrillas de programación de la televisión colombiana, se realizó un análisis de texto y contenido de dicho programa, intentando definirlo desde sus posibilidades de realidad, ficción y show. Las unidades de análisis y el estudio de su tratamiento arrojaron un alto contenido que gira en torno a las emociones del ser humano relacionadas con la convivencia, tratadas a manera de show y con algunos aportes textuales de ficción, pero sin su elemento mediador básico, el actor, quitándole toda la posibilidad de tener un tratamiento con la profundidad, distancia y ética que requieren los temas de esta índole. El resultado es un formato que sólo busca altos índices de sintonía y que pertenece más a la denominada televisión “trash”, que a una búsqueda de realidad del hombre y mucho menos de sociedad.

  14. Prehispanic goldwork technology study by PIXE analysis

    Energy Technology Data Exchange (ETDEWEB)

    Zucchiatti, Alessandro, E-mail: alessandro.zucchiatti@uam.es [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, Calle de Faraday 3, Madrid 28049 (Spain); Climent Font, Aurelio [Centro de Micro Análisis de Materiales, Universidad Autónoma de Madrid, Calle de Faraday 3, Madrid 28049 (Spain); Gutierrez Neira, Patricia Carolina; Perea, Alicia [Centro de Ciencias Humanas y Sociales, CSIC, Calle Albasanz 26-28, Madrid 28037 (Spain); Fernandez Esquivel, Patricia [Fundación Museos, Banco Central de Costa Rica, San José (Costa Rica); Rovira Llorens, Salvador [Museo Arqueológico Nacional, Calle Serrano 13, Madrid 28006 (Spain); Ruvalcaba Sil, José Luis [Instituto de Física, Universidad Nacional Autónoma de Mexico, Mexici DF 28006 (Mexico); Verde, Ana [Museo de América, Avda. de los Reyes Católicos 6, Madrid 28040 (Spain)

    2014-08-01

    Technological characterization of pre-Hispanic gold metallurgy has still a wide deficit of analytical data. A set of 103 pieces from the so called “Quimbaya’s treasure” (QT) and the “Costa Rica collection” (CRC) of the Museo de America of Madrid were submitted to IBA analysis (PIXE and RBS) at the CMAM in three phases and the metal composition was determined. Only in a limited number of cases, due to the dramatic erosion of the gilded layer, produced by abrasive cleaning methods applied after the discovery and before the seventies, it was possible to determine also the sequence of layers, which gives information on the manufacture technology and the type and purity of the metals. PIXE results are reported and discussed. Data show that the CRC objects have very high gold levels (>80% in weight) while the QT have a more variable composition with significant Cu levels associated to the so called Tumbaga-alloy. In the cases where polishing had a tolerable effect, PIXE (and RBS), point to depletion gilding as a standard finishing process in the Costa Rica production, resulting in a gold rich surface alloy, while the variable composition of the QT objects may well be linked to deliberate colour choice.

  15. Diffusion and aggrigation of implanted Ag and Au in a lithia-alumina-silica glass

    International Nuclear Information System (INIS)

    Arnold, G.W.; Borders, J.A.

    1976-01-01

    Optical extinction and Rutherford backscattering (RBS) techniques have been employed to obtain information on the size and spatial distribution of Au and Ag colloids in implanted (Au + ,Ag + )lithia-alumina-silica glass. The formation of metallic aggregates (colloids), necessary for preparation of a glass-ceramic surface layer, proceeds readily with annealing temperature for Au-implanted samples but not for Ag-implanted material. The optical and RBS spectra show that the particle size and spatial distribution in Ag-implanted samples are sensitive to sample temperature and ion-beam heating effects, while these parameters for Au-implanted samples are relatively insensitive to temperature and beam current. It is suggested that this behaviour is related to differences in the dissolution energies of Ag and Au aggregates. A two-peaked spatial distribution for Ag implanted at room temperature at a dose rate of approximately 1 μA cm -2 is observed which may result from the trappings of Ag in the ion displacement damage region of the glass during implantation. (author)

  16. Synthesis of Au nanoparticles at the surface and embedded in carbonaceous matrix by 150 keV Ar ion irradiation

    International Nuclear Information System (INIS)

    Prakash, Jai; Tripathi, Jalaj; Tripathi, A; Kumar, P; Asokan, K; Avasthi, D K; Rigato, V; Pivin, J C; Chae, Keun Hwa; Gautam, Sanjeev

    2011-01-01

    We report on synthesis of spherical Au nanoparticles at the surface and embedded in carbonaceous matrix by 150 keV Ar ion irradiation of thin Au film on polyethyleneterepthlate (PET). The pristine and irradiated samples are characterized by Rutherford backscattering spectrometry (RBS), atomic force microscopy, scanning electron microscopy and transmission electron microscopy (TEM) techniques. RBS spectra reveal the sputtering of Au film and interface mixing, increasing with increasing fluence. Surface morphology shows that at the fluence of 5 x 10 15 ions cm -2 , dewetting of thin Au film begins and partially connected nanostructures are formed whereas, at the higher fluence of 5 x 10 16 ions cm -2 , isolated spherical Au nanoparticles (45 ± 20 nm) are formed at the surface. Cross-sectional TEM observations also evidence the Au nanoparticles at the surface and mixed metal-polymer region indicating the formation of nanocomposites with small Au nanoparticles. The results are explained by the crater formation, sputtering followed by dewetting of the thin Au film and interdiffusion at the interface, through molten zones due to thermal spike induced by Ar ions.

  17. Comparative analysis of textile metal threads from liturgical vestments and folk costumes in Croatia

    Science.gov (United States)

    Šimić, Kristina; Zamboni, Ivana; Fazinić, Stjepko; Mudronja, Domagoj; Sović, Lea; Gouasmia, Sabrina; Soljačić, Ivo

    2018-02-01

    Textile is essential for everyday life in all societies. It is used in clothes for protection and warmth but also to indicate class and position, show wealth and social status. Threads from precious metals have also been used in combination with fibres for decoration in order to create luxury fabrics for secular and religious elites. We performed elemental analysis of 17th to 20th century metal threads from various textile articles of liturgical vestments and festive folk costumes collected in the museums of northern, southern and central Croatian regions. In order to determine elemental concentrations in threads we performed comparative X-ray Spectroscopy measurements using: (i) Scanning Electron Microscopy with Energy Dispersive X-ray Spectroscopy (SEM-EDX) at the Faculty of Textile Technology, (ii) X-ray Fluorescence Spectroscopy (XRF) at the Croatian Conservation Institute and (iii) Particle Induced X-ray Spectroscopy (PIXE) at the Ruđer Bošković Institute Tandem Accelerator Facility using ion micro beam. Rutherford Backscattering Spectroscopy (RBS) was performed as well on selected samples. SEM-EDX investigations of cross-sections along with the surfaces were also performed. In this work we report and discuss the results obtained by the three X-ray methods and RBS for major (gold, silver, copper) and minor elements on different threads like stripes, wires and "srma" (metal thread wrapped around textile yarn).

  18. Oxide growth on aluminium alloys in the presence of ammonium fluoborate

    Energy Technology Data Exchange (ETDEWEB)

    Oliver, J.; Paterson, P.; Flavell, T. [Royal Melbourne Inst. of Tech., VIC (Australia); Biddle, G. [Alcoa Rolled Products (Australia)

    1996-12-31

    The aim of this study as to determine the mechanisms involved in using ammonium fluoborate as a reducing atmosphere when preheating a high magnesium content aluminium alloy. Rutherford Backscattering (RBS) has been the major technique used in the analysis of samples, it revealed significant reduction in both the diffusion of magnesium to the surface and the calculated oxide thickness in the presence of NH{sub 4}BF{sub 4}. At temperatures above 500 deg C in air, SEM images revealed depressions and voids due to incipient melting at various stages, around the grain boundaries. Grain boundaries effectively acted as pipes aiding the diffusion of magnesium to the surface. These results have been verified through compositional analysis with both RBS and auger electron spectroscopy (AES). Results from NH{sub 4}BF{sub 4} atmosphere preheat conditions showed significant improvements. It was verified experimentally that above 500 deg C , AA5182 alloys undergo incipient melting at the grain boundaries with magnesium diffusing through to the surface. 5 refs., 1 fig.

  19. The Effect of Ag and Ag+N Ion Implantation on Cell Attachment Properties

    International Nuclear Information System (INIS)

    Urkac, Emel Sokullu; Oztarhan, Ahmet; Gurhan, Ismet Deliloglu; Iz, Sultan Gulce; Tihminlioglu, Funda; Oks, Efim; Nikolaev, Alexey; Ila, Daryush

    2009-01-01

    Implanted biomedical prosthetic devices are intended to perform safely, reliably and effectively in the human body thus the materials used for orthopedic devices should have good biocompatibility. Ultra High Molecular Weight Poly Ethylene (UHMWPE) has been commonly used for total hip joint replacement because of its very good properties. In this work, UHMWPE samples were Ag and Ag+N ion implanted by using the Metal-Vapor Vacuum Arc (MEVVA) ion implantation technique. Samples were implanted with a fluency of 1017 ion/cm2 and extraction voltage of 30 kV. Rutherford Backscattering Spectrometry (RBS) was used for surface studies. RBS showed the presence of Ag and N on the surface. Cell attachment properties investigated with model cell lines (L929 mouse fibroblasts) to demonstrate that the effect of Ag and Ag+N ion implantation can favorably influence the surface of UHMWPE for biomedical applications. Scanning electron microscopy (SEM) was used to demonstrate the cell attachment on the surface. Study has shown that Ag+N ion implantation represents more effective cell attachment properties on the UHMWPE surfaces.

  20. 130 MeV Au ion irradiation induced dewetting on In2Te3 thin film

    International Nuclear Information System (INIS)

    Matheswaran, P.; Abhirami, K.M.; Gokul, B.; Sathyamoorthy, R.; Prakash, Jai; Asokan, K.; Kanjilal, D.

    2012-01-01

    Highlights: ► In 2 Te 3 phase formed from In/Te bilayer by 130 MeV Au ion irradiation. ► Lower fluence results mixed phases with initial state of dewetting. ► At higher fluence, In 2 Te 3 phase with complete dewetting pattern is formed. ► Thermal spike model is used to explain the inter face mixing phenomena. ► SHI irradiation may be used to functionalize the structural and surface properties of thin films. - Abstract: In/Te bilayer thin films were prepared by sequential thermal evaporation and subsequently irradiated by 130 MeV Au ions. The pristine and irradiated samples were characterized by X-ray diffraction (XRD), Rutherford backscattering spectrometry (RBS), scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDX) techniques. RBS spectra reveal the sputtering of Te film and interface mixing, with increasing fluence. The surface morphology showed the beginning of dewetting of Te thin film and formation of the partially connected with the mixed zones at the fluence of 1 × 10 13 ions/cm 2 . At the higher fluence of 3 × 10 13 ions/cm 2 , dewetted structures were isolated at the surface. Above results are explained based on the formation of craters, sputtering and dewetting followed by inter-diffusion at the interface of molten zones due to thermal spike induced by Au ions.

  1. Identifying New Small Proteins in Escherichia coli.

    Science.gov (United States)

    VanOrsdel, Caitlin E; Kelly, John P; Burke, Brittany N; Lein, Christina D; Oufiero, Christopher E; Sanchez, Joseph F; Wimmers, Larry E; Hearn, David J; Abuikhdair, Fatimeh J; Barnhart, Kathryn R; Duley, Michelle L; Ernst, Sarah E G; Kenerson, Briana A; Serafin, Aubrey J; Hemm, Matthew R

    2018-04-12

    The number of small proteins (SPs) encoded in the Escherichia coli genome is unknown, as current bioinformatics and biochemical techniques make short gene and small protein identification challenging. One method of small protein identification involves adding an epitope tag to the 3' end of a short open reading frame (sORF) on the chromosome, with synthesis confirmed by immunoblot assays. In this study, this strategy was used to identify new E. coli small proteins, tagging 80 sORFs in the E. coli genome, and assayed for protein synthesis. The selected sORFs represent diverse sequence characteristics, including degrees of sORF conservation, predicted transmembrane domains, sORF direction with respect to flanking genes, ribosome binding site (RBS) prediction, and ribosome profiling results. Of 80 sORFs, 36 resulted in encoded synthesized proteins-a 45% success rate. Modeling of detected versus non-detected small proteins analysis showed predictions based on RBS prediction, transcription data, and ribosome profiling had statistically-significant correlation with protein synthesis; however, there was no correlation between current sORF annotation and protein synthesis. These results suggest substantial numbers of small proteins remain undiscovered in E. coli, and existing bioinformatics techniques must continue to improve to facilitate identification. © 2018 The Authors. Proteomics Published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim, Towson University.

  2. Diagnostic Overlap between Fanconi Anemia and the Cohesinopathies: Roberts Syndrome and Warsaw Breakage Syndrome

    Directory of Open Access Journals (Sweden)

    Petra van der Lelij

    2010-01-01

    Full Text Available Fanconi anemia (FA is a recessively inherited disease characterized by multiple symptoms including growth retardation, skeletal abnormalities, and bone marrow failure. The FA diagnosis is complicated due to the fact that the clinical manifestations are both diverse and variable. A chromosomal breakage test using a DNA cross-linking agent, in which cells from an FA patient typically exhibit an extraordinarily sensitive response, has been considered the gold standard for the ultimate diagnosis of FA. In the majority of FA patients the test results are unambiguous, although in some cases the presence of hematopoietic mosaicism may complicate interpretation of the data. However, some diagnostic overlap with other syndromes has previously been noted in cases with Nijmegen breakage syndrome. Here we present results showing that misdiagnosis may also occur with patients suffering from two of the three currently known cohesinopathies, that is, Roberts syndrome (RBS and Warsaw breakage syndrome (WABS. This complication may be avoided by scoring metaphase chromosomes—in addition to chromosomal breakage—for spontaneously occurring premature centromere division, which is characteristic for RBS and WABS, but not for FA.

  3. Diffusion and aggregation of implanted Ag and Au in a lithia--alumina--silica glass

    International Nuclear Information System (INIS)

    Arnold, G.W.; Borders, J.A.

    1975-01-01

    Optical extinction and Rutherford backscattering (RBS) techniques were employed to obtain information on the size and spatial distribution of Au- and Ag-colloids in implanted (Au + , Ag + ) lithia-alumina-silica glass. The formation of metallic aggregates (colloids), necessary for preparation of a glass-ceramic surface layer, proceeds readily with annealing temperature for Au-implanted samples but not for Ag-implanted material. The optical and RBS spectra show that the particle size and spatial distribution in as-implanted samples are sensitive to sample temperature and ion-beam heating effects, while these parameters for Au-implanted samples are relatively insensitive to temperature and beam current. It is suggested that this behavior is related to differences in the dissolution energies of Ag and Au aggregates. A two-peaked spatial distribution for Ag implanted at room temperature at a dose rate of approximately 1 μA/cm 2 is observed which may result from the trapping of Ag in the compacted damage region of the glass during implantation. (auth)

  4. Silicide formation by Ar/sup +/ ion bombardment of Pd/Si

    Energy Technology Data Exchange (ETDEWEB)

    Lee, R Y; Whang, C N; Kim, H K; Smith, R J

    1988-08-01

    Palladium films, 45 nm thick, evaporated on to Si(111) were irradiated to various doses with 78 keV Ar/sup +/ ions to promote silicide formation. Rutherford backscattering spectroscopy (RBS) shows that intermixing has occurred across the Pd/Si interface at room temperature. The mixing behaviour is increased with dose which coincides well with the theoretical model of cascade mixing. The absence of deep RBS tails for palladium and the small area of this for silicon spectra indicate that short-range mixing occurs. From the calculated damage profiles computed with TRIM code, the dominant diffusion species is found to be silicon atoms in the Pd/Si system. It is also found that the initial compound formed by Ar/sup +/ irradiation is Pd/sub 2/Si which increases with dose. At a dose of 1 x 10/sup 16/ Ar/sup +/ cm/sup -2/, a 48 nm thickness of Pd/sub 2/Si was formed by ion-beam mixing at room temperature.

  5. Impurities and Electronic Property Variations of Natural MoS 2 Crystal Surfaces

    KAUST Repository

    Addou, Rafik; McDonnell, Stephen; Barrera, Diego; Guo, Zaibing; Azcatl, Angelica; Wang, Jian; Zhu, Hui; Hinkle, Christopher L.; Quevedo-Lopez, Manuel; Alshareef, Husam N.; Colombo, Luigi; Hsu, Julia W P; Wallace, Robert M.

    2015-01-01

    Room temperature X-ray photoelectron spectroscopy (XPS), inductively coupled plasma mass spectrometry (ICPMS), high resolution Rutherford backscattering spectrometry (HR-RBS), Kelvin probe method, and scanning tunneling microscopy (STM) are employed to study the properties of a freshly exfoliated surface of geological MoS2 crystals. Our findings reveal that the semiconductor 2H-MoS2 exhibits both n- and p-type behavior, and the work function as measured by the Kelvin probe is found to vary from 4.4 to 5.3 eV. The presence of impurities in parts-per-million (ppm) and a surface defect density of up to 8% of the total area could explain the variation of the Fermi level position. High resolution RBS data also show a large variation in the MoSx composition (1.8 < x < 2.05) at the surface. Thus, the variation in the conductivity, the work function, and stoichiometry across small areas of MoS2 will have to be controlled during crystal growth in order to provide high quality uniform materials for future device fabrication. © 2015 American Chemical Society.

  6. Formation of iron disilicide on amorphous silicon

    Science.gov (United States)

    Erlesand, U.; Östling, M.; Bodén, K.

    1991-11-01

    Thin films of iron disilicide, β-FeSi 2 were formed on both amorphous silicon and on crystalline silicon. The β-phase is reported to be semiconducting with a direct band-gap of about 0.85-0.89 eV. This phase is known to form via a nucleation-controlled growth process on crystalline silicon and as a consequence a rather rough silicon/silicide interface is usually formed. In order to improve the interface a bilayer structure of amorphous silicon and iron was sequentially deposited on Czochralski silicon in an e-gun evaporation system. Secondary ion mass spectrometry profiling (SIMS) and scanning electron micrographs revealed an improvement of the interface sharpness. Rutherford backscattering spectrometry (RBS) and X-ray diffractiometry showed β-FeSi 2 formation already at 525°C. It was also observed that the silicide growth was diffusion-controlled, similar to what has been reported for example in the formation of NiSi 2 for the reaction of nickel on amorphous silicon. The kinetics of the FeSi 2 formation in the temperature range 525-625°C was studied by RBS and the activation energy was found to be 1.5 ± 0.1 eV.

  7. Synthesis and analysis of gold nanoclusters on silicon substrates by ion beams

    International Nuclear Information System (INIS)

    Sood, D.K.; Venkatachalam, D.K.; Bhargava, S.K.; Evans, P.J.

    2005-01-01

    To facilitate the growth of silica nanowires on silicon substrates, two different seeding techniques: 1) ion implantation and 2) chemical deposition of as-synthesised gold colloids have been compared for the formation of catalysing gold nanoclusters. The prepared substrates of both types were analysed using Rutherford backscattering spectrometry at ANSTO to determine the amount of gold and its depth distribution. The topography of the substrates deposited with chemically synthesised gold nanoparticles were studied under SEM. The preliminary ion beam (RBS) analysis has shown ion implantation as a novel technique for seeding Au nanoclusters on silicon substrates facilitating growth of nanowires. This method holds a great potential for using any metal across the periodic table that can act as catalysing seed nanoclusters for nanowire growth. The use of chemical deposition as a seeding technique to deposit as-synthesised gold nanoparticles requires further investigations. RBS results show significant difference in the depth distribution of the gold nanoparticles on silicon substrates seeded by two different techniques. (author). 6 refs., 4 figs

  8. Oxide growth on aluminium alloys in the presence of ammonium fluoborate

    Energy Technology Data Exchange (ETDEWEB)

    Oliver, J; Paterson, P; Flavell, T [Royal Melbourne Inst. of Tech., VIC (Australia); Biddle, G [Alcoa Rolled Products (Australia)

    1997-12-31

    The aim of this study as to determine the mechanisms involved in using ammonium fluoborate as a reducing atmosphere when preheating a high magnesium content aluminium alloy. Rutherford Backscattering (RBS) has been the major technique used in the analysis of samples, it revealed significant reduction in both the diffusion of magnesium to the surface and the calculated oxide thickness in the presence of NH{sub 4}BF{sub 4}. At temperatures above 500 deg C in air, SEM images revealed depressions and voids due to incipient melting at various stages, around the grain boundaries. Grain boundaries effectively acted as pipes aiding the diffusion of magnesium to the surface. These results have been verified through compositional analysis with both RBS and auger electron spectroscopy (AES). Results from NH{sub 4}BF{sub 4} atmosphere preheat conditions showed significant improvements. It was verified experimentally that above 500 deg C , AA5182 alloys undergo incipient melting at the grain boundaries with magnesium diffusing through to the surface. 5 refs., 1 fig.

  9. Efficient Resource Scheduling by Exploiting Relay Cache for Cellular Networks

    Directory of Open Access Journals (Sweden)

    Chun He

    2015-01-01

    Full Text Available In relay-enhanced cellular systems, throughput of User Equipment (UE is constrained by the bottleneck of the two-hop link, backhaul link (or the first hop link, and access link (the second hop link. To maximize the throughput, resource allocation should be coordinated between these two hops. A common resource scheduling algorithm, Adaptive Distributed Proportional Fair, only ensures that the throughput of the first hop is greater than or equal to that of the second hop. But it cannot guarantee a good balance of the throughput and fairness between the two hops. In this paper, we propose a Two-Hop Balanced Distributed Scheduling (TBS algorithm by exploiting relay cache for non-real-time data traffic. The evolved Node Basestation (eNB adaptively adjusts the number of Resource Blocks (RBs allocated to the backhaul link and direct links based on the cache information of relays. Each relay allocates RBs for relay UEs based on the size of the relay UE’s Transport Block. We also design a relay UE’s ACK feedback mechanism to update the data at relay cache. Simulation results show that the proposed TBS can effectively improve resource utilization and achieve a good trade-off between system throughput and fairness by balancing the throughput of backhaul and access link.

  10. Investigation of the behavior of connection of reduced-beam-section steel beam to reinforced concrete column

    Directory of Open Access Journals (Sweden)

    Ali Babaeenezhad

    2017-11-01

    Full Text Available After recent earthquakes that caused major damages in beam-column connections, scientists and engineers proposed new types of connections to postpone such brittle failures. One of these new connections is the connection of steel beam to concrete column and connection of reduced- beam-section to steel column. However, these new connections have some defects. The aim of this paper is to investigate the combination of RCS and RBS connection and assess the behavior of new combined connection. In this type of connection, a beam with reduced section at the end is connected to a concrete column. In such a detail, the main defect of RCS and RBS connection disappears. The connection was modeled using Abaqus finite element package and the effect of cut of the flange, cover-plate thickness and stiffener thickness in the new system were investigated and compared with those in RCS connection.  The results show that cut of flange has a great influence on compressive damage and tensile damage. Furthermore, cut of flange decreases the stress in the cover-plate, stiffener and reinforcements. Increasing the thickness of cover-plate, reduces stress in cover-plate. The use of reduced-beam-section instead of ordinary connection improves the connection overall performance.

  11. Optical, structural, and nuclear scientific studies of AlGaN with high Al composition

    Science.gov (United States)

    Lin, Tse Yang; Chung, Yee Ling; Li, Lin; Yao, Shude; Lee, Y. C.; Feng, Zhe Chuan; Ferguson, Ian T.; Lu, Weijie

    2010-08-01

    AlGaN epilayers with higher Al-compositions were grown by Metalorganic Chemical Vapor Deposition (MOCVD) on (0001) sapphire. Trimethylgallium (TMGa), trimethylaluminium (TMAl) and NH3 were used as the source precursors for Ga, Al, and N, respectively. A 25 nm AlN nucleation layer was first grown at low-temperature of 590 °C at 300 Torr. Followed, AlxGa1-xN layers were grown at 1080 °C on low-temperature AlN nucleation layers. The heterostructures were characterized by a series of techniques, including x-ray diffraction (XRD), Rutherford backscattering (RBS), photoluminescence (PL), scanning electron microscopy (SEM) and Raman scattering. Precise Al compositions were determined through XRD, RBS, and SEM combined measurements. Room Temperature Raman Scattering spectra shows three major bands from AlGaN alloys, which are AlN-like, A1 longitudinal optical (LO) phonon modes, and E2 transverse optical (TO) band, respectively, plus several peak comes from the substrate. Raman spectral line shape analysis lead to an optical determination of the electrical property free carrier concentration of AlGaN. The optical properties of AlGaN with high Al composition were presented here.

  12. Oxide growth on aluminium alloys in the presence of ammonium fluoborate

    International Nuclear Information System (INIS)

    Oliver, J.; Paterson, P.; Flavell, T.; Biddle, G.

    1996-01-01

    The aim of this study as to determine the mechanisms involved in using ammonium fluoborate as a reducing atmosphere when preheating a high magnesium content aluminium alloy. Rutherford Backscattering (RBS) has been the major technique used in the analysis of samples, it revealed significant reduction in both the diffusion of magnesium to the surface and the calculated oxide thickness in the presence of NH 4 BF 4 . At temperatures above 500 deg C in air, SEM images revealed depressions and voids due to incipient melting at various stages, around the grain boundaries. Grain boundaries effectively acted as pipes aiding the diffusion of magnesium to the surface. These results have been verified through compositional analysis with both RBS and auger electron spectroscopy (AES). Results from NH 4 BF 4 atmosphere preheat conditions showed significant improvements. It was verified experimentally that above 500 deg C , AA5182 alloys undergo incipient melting at the grain boundaries with magnesium diffusing through to the surface. 5 refs., 1 fig

  13. Effect of Ion Irradiation in Cadmium Niobate Pyrochlores

    International Nuclear Information System (INIS)

    Jiang, Weilin; Weber, William J.; Thevuthasan, Suntharampillai; Boatner, Lynn A.

    2003-01-01

    Irradiation experiments have been performed for cadmium niobate pyrochlore (CdNb2O) single crystals at both 150 and 300 K using 1.0 MeV Au ions over fluences ranging from 0.01 to 0.10 ions/nm. In-situ 3.0 MeV He Rutherford backscattering spectrometry along the -axial channeling direction (RBS/C) has been applied to study the damage states ranging from small defect concentrations to a fully amorphous state. Results show that the crystal can be readily amorphized under the irradiation conditions. Room-temperature recovery of the defects produced at 150 K has been observed, while the defects produced at 300 K are thermally stable at room temperature. Results also indicate that the RBS/C analysis used in this study induced negligible damage in the near-surface regime. In addition, irradiation at and below room temperature using He and C3 ions leads to surface exfoliation at the corresponding damage peaks

  14. Ion beam synthesis of IrSi3 by implantation of 2 MeV Ir ions

    International Nuclear Information System (INIS)

    Sjoreen, T.P.; Chisholm, M.F.; Hinneberg, H.J.

    1992-11-01

    Formation of a buried IrSi 3 layer in (111) oriented Si by ion implantation and annealing has been studied at an implantation energy of 2 MeV for substrate temperatures of 450--550C. Rutherford backscattering (RBS), ion channeling and cross-sectional transmission electron microscopy showed that a buried epitaxial IrSi 3 layer is produced at 550C by implanting ≥ 3.4 x 10 17 Ir/cm 2 and subsequently annealing for 1 h at 1000C plus 5 h at 1100C. At a dose of 3.4 x 10 17 Ir/cm 2 , the thickness of the layer varied between 120 and 190 nm and many large IrSi 3 precipitates were present above and below the film. Increasing the dose to 4.4 x 10 17 Ir/cm 2 improved the layer uniformity at the expense of increased lattice damage in the overlying Si. RBS analysis of layer formation as a function of substrate temperature revealed the competition between the mechanisms for optimizing surface crystallinity vs. IrSi 3 layer formation. Little apparent substrate temperature dependence was evident in the as-implanted state but after annealing the crystallinity of the top Si layer was observed to deteriorate with increasing substrate temperature while the precipitate coarsening and coalescence improved

  15. Study of low energy Si5- and Cs- implantation induced amorphization effects in Si(1 0 0)

    International Nuclear Information System (INIS)

    Lenka, H P; Joseph, B; Kuiri, P K; Sahu, G; Mahapatra, D P; Mishra, P; Ghose, D

    2008-01-01

    The damage growth and surface modifications in Si(1 0 0), induced by 25 keV Si 5 - cluster ions, as a function of fluence, φ, has been studied using atomic force microscopy (AFM) and channelling Rutherford backscattering spectrometry (RBS/C). RBS/C results indicate a nonlinear growth in damage from which it has been possible to get a threshold fluence, φ 0 , for amorphization as 2.5 x 10 13 ions cm -2 . For φ below φ 0 , a growth in damage as well as surface roughness has been observed. At a φ of 1 x 10 14 ions cm -2 , damage saturation coupled with a much reduced surface roughness has been found. In this case a power spectrum analysis of AFM data showed a significant drop in spectral density, as compared with the same obtained for a fluence, φ 0 . This drop, together with damage saturation, can be correlated with a transition to a stress relaxed amorphous phase. Irradiation with similar mass Cs - ions, at the same energy and fluence, has been found to result in a reduced accumulation of defects in the near surface region leading to reduced surface features.

  16. Determination of ion track and shapes with damage simulations on the base of ellipsometric and backscattering spectrometric measurements

    Energy Technology Data Exchange (ETDEWEB)

    Polgar, O.; Fried, M.; Khanh, N.; Petrik, P.; Barsony, I. [Research Institute for Technical Phisycs and Materials Science, Budapest (Hungary)

    2008-05-15

    On the base of geometrical and statistical considerations a damage simulator was created in order to determine the ion track-radius and -shape of ion-implantation caused damage in single-crystalline Si. Damage vs. dose curves calculated by spectroscopic ellipsometry (SE) and Rutherford backscattering/channeling spectrometry (RBS/C) measurements, using different doses of 100 keV Xe implantation, gave information about the damage profile in depth. Both methods are required, because of dose-dependent discrepancies of SE compared with RBS/C [Fried et al., Thin Solid Films 455/456, 404 (2004)]. Different kinds of damage models were investigated to calculate the ion track-radius and to describe the damages in depth and the shape of ion track. Comparing directly the simulated and the measured damage vs. dose curves, the damage function and the other simulation parameters were optimized and hence the ion track size and even the shape can be determined. The dose dependent mean size of the unchanged crystalline regions, obtained from the simulation was correlated with the complex dielectric functions, obtained from the SE analysis. The results clearly show the effect of decreasing size of the unchanged crystalline regions. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  17. Study of Z > 18 elements concentration in tree rings from surroundings forests of the Mexico Valley using external beam PIXE

    International Nuclear Information System (INIS)

    Calva-Vazquez, G.; Razo-Angel, G.; Rodriguez-Fernandez, L.; Ruvalcaba-Sil, J.L.

    2006-01-01

    The concentration of elements with Z > 18 is measured in tree rings from forests at the surroundings of the Mexico Valley: El Chico National Park (ECP) and Desierto de los Leones National Park (DLP). The analysis was done by simultaneous PIXE-RBS using an external proton beam on tree rings of Pine and Sacred fir (species Pinus montezumae and Abies religiosa, respectively). This study provides information about the elemental concentration in trees of those parks during the years from 1965 to 2003. Typical elements such as K, Ca, Ti, V, Cr, Mn, Fe, Ni, Cu, Zn, Br, Sr and Pb were detected using PIXE technique while the wood matrix composition (mainly C and O) was determined by RBS. In general, elemental contents present large variations but concentrations oscillate around the mean value during this period of time. Nevertheless, the measurements showed some trends for Fe and Zn in the tree-rings elemental composition that may be correlated to recent volcanic activities in the region. The low Mn contents indicate soil acidification in DLP from 1968 and the forest decline in ECP during the last 15 years

  18. Influence of culture media on the physical and chemical properties of Ag-TiCN coatings

    Science.gov (United States)

    Carvalho, I.; Escobar Galindo, R.; Henriques, M.; Palacio, C.; Carvalho, S.

    2014-08-01

    The aim of this study was to verify the possible physical and chemical changes that may occur on the surface of Ag-TiCN coatings after exposure to the culture media used in microbiological and cytotoxic assays, respectively tryptic soy broth (TSB) and Dulbecco's modified eagle's medium (DMEM). After sample immersion for 24 h in the media, analyses were performed by glow discharge optical emission spectroscopy discharge radiation (GDOES), Rutherford backscattering spectroscopy (RBS) and x-ray photoelectron spectroscopy (XPS). The results of GDOES profile, RBS and XPS spectra, of samples immersed in TSB, demonstrated the formation of a thin layer of carbon, oxygen and nitrogen that could be due to the presence of proteins in TSB. After 24 h of immersion in DMEM, the results showed the formation of a thin layer of calcium phosphates on the surface, since the coatings displayed a highly oxidized surface in which calcium and phosphorus were detected. All these results suggested that the formation of a layer on the coating surface prevented the release of silver ions in concentrations that allow antibacterial activity.

  19. Impurities and Electronic Property Variations of Natural MoS 2 Crystal Surfaces

    KAUST Repository

    Addou, Rafik

    2015-09-22

    Room temperature X-ray photoelectron spectroscopy (XPS), inductively coupled plasma mass spectrometry (ICPMS), high resolution Rutherford backscattering spectrometry (HR-RBS), Kelvin probe method, and scanning tunneling microscopy (STM) are employed to study the properties of a freshly exfoliated surface of geological MoS2 crystals. Our findings reveal that the semiconductor 2H-MoS2 exhibits both n- and p-type behavior, and the work function as measured by the Kelvin probe is found to vary from 4.4 to 5.3 eV. The presence of impurities in parts-per-million (ppm) and a surface defect density of up to 8% of the total area could explain the variation of the Fermi level position. High resolution RBS data also show a large variation in the MoSx composition (1.8 < x < 2.05) at the surface. Thus, the variation in the conductivity, the work function, and stoichiometry across small areas of MoS2 will have to be controlled during crystal growth in order to provide high quality uniform materials for future device fabrication. © 2015 American Chemical Society.

  20. Ion beam analysis of the dry thermal oxidation of thin polycrystalline SiGe films

    International Nuclear Information System (INIS)

    Kling, A.; Soares, J.C.; Prieto, A.C.; Jimenez, J.; Rodriguez, A.; Sangrador, J.; Rodriguez, T.

    2005-01-01

    Nanoparticles of Ge embedded in a formed dielectric matrix appear as very promising systems for electronic and photonic applications. We present here an exhaustive characterization of the oxidation process of polycrystalline SiGe layers from the starting of its oxidation process to the total oxidation of it. We have characterized the process by RBS, FTIR and Raman spectroscopy, showing the necessity to use different techniques in order to get a full view of the process. First the Si-Si and Si-Ge bonds are oxidized growing SiO 2 , and Ge segregates from the SiO 2 . As soon as all Si is oxidized GeO 2 is growing gradually. RBS has demonstrated to be very useful to characterize the SiO 2 and the remaining non-oxidized poly-SiGe layer thickness, as well as for the determination of the Ge fraction, where the high sensitivity of this technique allows to explore its whole range. On the other hand, for the reliable determination of the GeO 2 thickness, information on the amount of Ge-O bonding had to be obtained from FTIR spectra. Raman spectroscopy yields detailed information about the oxidation processes for different bonds (Si-Si, Si-Ge, Ge-Ge)

  1. Extended solubility and martensitic hcp nickel formation in antimony implanted nickel

    International Nuclear Information System (INIS)

    Johnson, E.; Sarholt-Kristensen, L.; Johansen, A.

    1982-01-01

    Radiation damage microstructure and associated disorder have been investigated in antimony implanted nickel crystals using combined RBS and TEM analyses. In crystals implanted at and below room temperature with 80 keV Sb + ions to a fluence of 5x10 20 m -2 , the retained antimony concentration in the implantation zone is approaching 15 at.%, with nearly all the antimony located substitutionally. The associated disorder as seen in the RBS analysis is insignificant. Annealing up to 600 0 C has little influence on the antimony distribution, whilst the dechanneling level is reduced. TEM and diffraction analysis of room temperature implanted samples show that the radiation damage consists of dense distributions of dislocation clusters and tangles, superimposed on a rather homogeneous background of new phase particles, identified as hcp nickel. The particles have a size 0.1-0.2 μm. The high substitutional antimony concentration at and below room temperature, which exceeds the solubility limit, indicates that its formation is thermally diffusionless and rather an effect of radiation enhanced solubility. The diffusionless nature of the microstructure is also indicated from the presence of martensitic hcp nickel, believed to form due to relief of radiation induced internal stress. (Auth.)

  2. Development of evaluation method of fuel failure fraction during the High Temperature Engineering Test Reactor operation

    Energy Technology Data Exchange (ETDEWEB)

    Sawa, Kazuhiro; Yoshimuta, Shigeharu; Tobita, Tsutomu; Sato, Masashi [Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment

    1997-05-01

    The High Temperature Engineering Test Reactor (HTTR) uses coated particles as fuel. During normal operation, short-lived noble gases are mainly released by diffusion from fuel particles with defects in their coating layers (i.e., failed particle). Since noble gases do not plate out on the inner surfaces of primary cooling system, their activities in primary coolant reflect fuel failure fraction in the core. An evaluation method was developed to predict failure fraction of coated fuel particles during normal operation of the HTTR. The method predicts core-average and hot plenum regionwise failure fractions based on the fractional releases, (R/B)s, of noble gases. The (R/B)s are calculated by fission gas concentration measurements in the primary cooling system of the HTTR. Recent fabrication data show that through-coatings failure fraction is extremely low. Then, fractional release from matrix contamination uranium, which is background for accurate evaluation of the fuel failure fraction, should be precisely predicted. This report describes an evaluation method of fuel failure fraction from measurements in the HTTR together with a fission gas release model from fuel compact containing failed particles and matrix contamination uranium. (author)

  3. Ion microprobe analysis of metallic pigments

    International Nuclear Information System (INIS)

    Pelicon, P.; Simcic, J.; Budnar, M.; Klanjsek-Gunde, M.; Kunavaer, M.

    2001-01-01

    Full text: Metallic paints consist of metallic flakes dispersed m a resinous binder, i.e. a light-element polymer matrix. The spatial distribution and orientation of metallic flakes inside the matrix determines the covering efficiency of the paint, glossiness, and its angular-dependent properties such as lightness flop or color flop (two-tone). Such coatings are extensively used for a functional (i.e. security) as well as decorative purpose. The ion microbeam analysis of two types of silver paint with imbedded metallic flake has been performed to test the ability of the ion microbeam spectroscopic methods on this type of samples. The average sizes of the aluminium flakes were 23 (size distribution 10-37) and 49 (size distribution 34-75) micrometers, respectively. The proton beam with the size of 2x2 micrometers at Ljubljana ion microprobe has been used to scan the surface of the pigments. PIXE mapping of Al Kα map shows lateral distribution of the aluminum flakes, whereas the RBS slicing method reveals tomographic image of the flakes in uppermost 5 micrometers of the pigment layer. The flake distribution in the larger layer depths has been accessed by RBS analysis in a point mode. (author)

  4. Comparative study of as-implanted and pre-damaged ion-beam-synthesized ZnS nanocrystallites in SiO sub 2

    CERN Document Server

    Gao, K Y; Grosshans, I; Hipp, W; Stritzker, B

    2002-01-01

    The semiconducting ZnS nanocrystallites were synthesized by sequential high dose ion implantation of Zn and S in thermally grown SiO sub 2 on Si(1 0 0) and subsequent rapid thermal annealing (RTA). Some samples were pre-implanted with Ar ions in order to investigate the influence of radiation induced damage on the formation of ZnS nanocrystallites. The crystal structure of the ZnS crystallites, their size distribution and the concentration depth profile were analyzed by X-ray diffraction (XRD), Rutherford backscattering spectroscopy (RBS) and cross-sectional transmission-electron-microscopy (XTEM). The XRD results indicate, that the phase transition from cubic zinc blende to hexagonal wurtzite structure of ZnS nanocrystallites begins at temperatures below 1000 degree sign C. The RBS results show a clear redistribution of Zn and S after RTA annealing. The concentration of Zn is seriously reduced due to strong diffusion towards deeper regions and the surface, while Ar pre-implantation partially suppressed the c...

  5. Study on the depth profile analysis of Fe/Co intermixing in [SmCo{sub 5}/Fe]{sub 11} magnetic multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Saravanan, P., E-mail: psdrdo@gmail.com [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India); Department of Physics, National Taiwan University, Taipei 106, Taiwan (China); Hsu, Jen-Hwa, E-mail: jhhsu@phys.ntu.edu.tw [Department of Physics, National Taiwan University, Taipei 106, Taiwan (China); Perumal, A.; Gayen, Anabil [Department of Physics, Indian Institute of Technology Guwahati, Guwahati 781039 (India); Reddy, G.L.N.; Kumar, Sanjiv [National Centre for Compositional Characterization of Materials, Bhabha Atomic Research Centre, ECIL Post, Hyderabad 500062 (India); Kamat, S.V. [Defence Metallurgical Research Laboratory, Hyderabad 500058 (India)

    2014-09-01

    Multilayer films were sputtered on Si (1 0 0) substrate by following a layer sequence of Cr (10 nm)/[Fe (4 nm)/SmCo{sub 5} (20 nm)]{sub 11}/Cr (90 nm) at room temperature and subsequently, subjected to two-stage annealing. The phase composition, the extent of inter-diffusion at the SmCo{sub 5}/Fe interfaces and the magnetic properties of multilayered samples were investigated by X-ray diffraction (XRD), RBS and super-conducting quantum interference device (SQUID), respectively. The XRD studies showed the crystallization of SmCo{sub 5}-phase in the hard layer along with a bcc-Fe (Co)-phase in the soft layer, while the RBS depth profile analysis revealed the changes that occur in the effective Fe-layer thickness and diffused Co-content as minimal for the Fe-layer index, n{sub Fe}≤5. A single-phase behavior associated with strong in-plane anisotropy was evidenced with the SQUID measurements. The observed remanence enhancement (1020 kA/m) and energy product value (286 kJ/m{sup 3}) in these multilayers are discussed in the context of Fe-layer thickness and diffused Co-content.

  6. Applications of High Energy Ion Beam Techniques in Environmental Science: Investigation Associated with Glass and Ceramic Waste Forms

    Energy Technology Data Exchange (ETDEWEB)

    Thevuthasan, Suntharampillai; Shutthanandan, V; Zhang, Yanwen

    2006-02-01

    High energy ion beam capabilities including Rutherford backscattering spectrometry (RBS) and nuclear reaction analysis (NRA) have been very effectively used in environmental science to investigate the ion exchange mechanisms in glass waste forms and the effects of irradiation in glass and ceramic waste forms in the past. In this study, RBS and NRA along with SIMNRA simulations were used to monitor the Na depletion and D and 18O uptake in alumina silicate glasses, respectively, after the glass coupons were exposed to aqueous solution. These results show that the formation of a reaction layer and an establishment of a region where diffusion limited ion exchange occur in these glasses during exposure to silica-saturated solutions. Different regions including reaction and diffusion regions were identified on the basis of the depth distributions of these elements. In the case of ceramics, damage accumulation was studied as a function of ion dose at different irradiation temperatures. A sigmoidal dependence of relative disorder on the ion dose was observed. The defect dechanneling factors were calculated for two irradiated regions in SrTiO? using the critical angles determined from the angular yield curves. The dependence of defect dechanneling parameter on the incident energy was investigated and it was observed that the generated defects are mostly interstitial atoms and amorphous clusters. Thermal recovery experiments were performed to study the damage recovery processes up to a maximum temperature of 870 K.

  7. Interactions of U(VI), Nd, and Th(IV) at the Calcite-solution interface

    International Nuclear Information System (INIS)

    Carroll, S.A.; Dran, J.C.

    1992-01-01

    The interactions of U(VI), Nd, and Th(IV) at the calcite-solution interface at controlled pCO 2 (g) have been investigated by Rutherford backscattering (RBS), scanning electron microscopy (SEM) and energy dispersive (EDS) analyses of reacted calcite. Uranium precipitation at the calcite-solution interface was observed only for those experiments in which the initial [U(VI)] was greater than the solubility of rutherfordine, UO 2 CO 3 (s). At pH 8.0, flat radial uranium and calcium zoned precipitates form at the mineral-solution interface. At pH 4.3, uranium forms an anastomosing precipitate throughout the calcite surface. RBS analyses confirmed the SEM analyses showing that uranium forms a solid phase within the calcite surface, but formation of an uranium-calcium solid solution at depth is limited. In sharp contrast to U(VI), Nd is concentrated in the solid phase as individual neodymium-calcium carbonate crystals. Calcite and pure orthorhombic neodymium carbonate crystals dissolve at the expense of the formation of a more stable neodymium-calcium solid solution. In the presence of calcite, a thorium-calcium solid solution forms by exchanging Th for Ca in the calcite structure. Thorium precipitates in two linear trends which intersect each other at approximately 105deg C and 75deg C, parallel to calcite rhombohedral cleavage faces. (orig.)

  8. Myopes show increased susceptibility to nearwork aftereffects.

    Science.gov (United States)

    Ciuffreda, K J; Wallis, D M

    1998-09-01

    Some aspects of accommodation may be slightly abnormal (or different) in myopes, compared with accommodation in emmetropes and hyperopes. For example, the initial magnitude of accommodative adaptation in the dark after nearwork is greatest in myopes. However, the critical test is to assess this initial accommodative aftereffect and its subsequent decay in the light under more natural viewing conditions with blur-related visual feedback present, if a possible link between this phenomenon and clinical myopia is to be considered. Subjects consisted of adult late- (n = 11) and early-onset (n = 13) myopes, emmetropes (n = 11), and hyperopes (n = 9). The distance-refractive state was assessed objectively using an autorefractor immediately before and after a 10-minute binocular near task at 20 cm (5 diopters [D]). Group results showed that myopes were most susceptible to the nearwork aftereffect. It averaged 0.35 D in initial magnitude, with considerably faster posttask decay to baseline in the early-onset (35 seconds) versus late-onset (63 seconds) myopes. There was no myopic aftereffect in the remaining two refractive groups. The myopes showed particularly striking accommodatively related nearwork aftereffect susceptibility. As has been speculated and found by many others, transient pseudomyopia may cause or be a precursor to permanent myopia or myopic progression. Time-integrated increased retinal defocus causing axial elongation is proposed as a possible mechanism.

  9. Ancient bacteria show evidence of DNA repair

    DEFF Research Database (Denmark)

    Johnson, Sarah Stewart; Hebsgaard, Martin B; Christensen, Torben R

    2007-01-01

    -term survival of bacteria sealed in frozen conditions for up to one million years. Our results show evidence of bacterial survival in samples up to half a million years in age, making this the oldest independently authenticated DNA to date obtained from viable cells. Additionally, we find strong evidence...... geological timescales. There has been no direct evidence in ancient microbes for the most likely mechanism, active DNA repair, or for the metabolic activity necessary to sustain it. In this paper, we couple PCR and enzymatic treatment of DNA with direct respiration measurements to investigate long...... that this long-term survival is closely tied to cellular metabolic activity and DNA repair that over time proves to be superior to dormancy as a mechanism in sustaining bacteria viability....

  10. Microbiological and environmental issues in show caves.

    Science.gov (United States)

    Saiz-Jimenez, Cesareo

    2012-07-01

    Cultural tourism expanded in the last half of the twentieth century, and the interest of visitors has come to include caves containing archaeological remains. Some show caves attracted mass tourism, and economical interests prevailed over conservation, which led to a deterioration of the subterranean environment and the rock art. The presence and the role of microorganisms in caves is a topic that is often ignored in cave management. Knowledge of the colonisation patterns, the dispersion mechanisms, and the effect on human health and, when present, over rock art paintings of these microorganisms is of the utmost importance. In this review the most recent advances in the study of microorganisms in caves are presented, together with the environmental implications of the findings.

  11. vNet Zero Energy for Radio Base Stations- Balearic Scenario

    DEFF Research Database (Denmark)

    Sabater, Pere; Mihovska, Albena Dimitrova; Pol, Andreu Moia

    2016-01-01

    The Balearic Islands have one of the best telecommunications infrastructures in Spain, with more than 1500 Radio Base Stations (RBS) covering a total surface of 4.991,66 km². This archipelago has high energy consumption, with high CO2 emissions, due to an electrical energy production system mainly...... based on coal and fossil fuels which is not an environmentally sustainable scenario. The aim of this study is to identify the processes that would reduce the energy consumption and greenhouse gas emissions, designing a target scenario featuring "zero CO2 emissions" and "100% renewable energies" in RBS....... The energy costs, CO2 emissions and data traffic data used for the study are generated by a sample of RBS from the Balearic Islands. The results are shown in terms of energy performance for a normal and net zero emissions scenarios....

  12. SURFAN, a programme for surface analysis

    International Nuclear Information System (INIS)

    Negoita, F.; Borcan, C.; Pantelica, D.

    1997-01-01

    Possible alternatives to Rutherford backscattering spectrometry (RBS) method of material analysis, overcoming the poor sensitivity to light elements of RBS, are the nuclear resonant reaction analysis (NRA) and elastic recoil detection analysis (ERDA). The last one is especially useful in surface and thin film analysis. To simulate the spectra obtained with any of these methods a programme SURFAN was worked out. In comparison with the code RUMP, published by Doolittle, it allows to simply change the charge of the projectile nature, implies no limitation to the energy of incident projectiles and permits the use of any depth profile function. The basic ideas and the structure of SURFAN are presented. Its application to ERDA and RBS methods resulted in important information on the processes implied in special materials obtained by advanced technologies

  13. Using Rutherford Backscattering Spectroscopy to Characterize Targets for MTW

    Science.gov (United States)

    Brown, Gunnar; Stockler, Barak; Ward, Ryan; Freeman, Charlie; Padalino, Stephen; Stillman, Collin; Ivancic, Steven; Reagan, S. P.; Sangster, T. C.

    2017-10-01

    A study is underway to determine the composition and thickness of targets used at the Multiterawatt (MTW) laser facility at the Laboratory for Laser Energetics (LLE) using Rutherford backscattering spectroscopy (RBS). In RBS, an ion beam is incident on a sample and the scattered ions are detected with a surface barrier detector. The resulting energy spectra of the scattered ions can be analyzed to determine important parameters of the target including elemental composition and thickness. Proton, helium and deuterium beams from the 1.7 MV Pelletron accelerator at SUNY Geneseo have been used to characterize several different targets for MTW, including CH and aluminum foils of varying thickness. RBS spectra were also obtained for a cylindrical iron buried-layer target with aluminum dopant which was mounted on a silicon carbide stalk. The computer program SIMNRA is used to analyze the spectra. This work was funded in part by a Grant from the DOE through the Laboratory for Laser Energetics.

  14. The analysis of Rutherford scattering-channelling measurements of disorder production and annealing in ion irradiated semiconductors

    International Nuclear Information System (INIS)

    Carter, G.; Elliman, R.G.

    1983-01-01

    Rutherford scattering and channelling of light probe ions (e.g. He + ) has been extensively used for studies of disorder production in ion implanted semiconductors. Various authors have analysed models of amorphousness accumulation and Carter and Webb have indicated the general difficulties in assessing disorder production models from RBS/channelling studies if the production modes are complex and the manner in which the technique responds to different defect structures is unspecified. For less complex disorder production modes and by making reasonable assumptions about the technique response however, some insight into the form of backscattering yield - ion implant fluence functions can be obtained as is discussed in the present communication. It thus becomes possible to infer the importance of different disorder generation processes from RBS/channelling - ion influence studies. It will also be shown how simple annealing processes modify disorder accumulation and thus again how the operation of such processes may be inferred from RBS/channelling - ion fluence measurements. (author)

  15. Multiple scattering effects in depth resolution of elastic recoil detection

    International Nuclear Information System (INIS)

    Wielunski, L.S.; Harding, G.L.

    1998-01-01

    Elastic Recoil Detection (ERD) is used to profile hydrogen and other low mass elements in thin films at surface and interfaces in a similar way that Rutherford Backscattering Spectroscopy (RBS) is used to detect and profile heavy elements. It is often assumed that the depth resolutions of these two techniques are similar. However, in contrast to typical RBS, the depth resolution of ERD is limited substantially by multiple scattering. In experimental data analysis and/or spectra simulations of a typical RBS measurement multiple scattering effects are often ignored. Computer programs used in IBA, such as RUMP, HYPRA or RBX do not include multiple scattering effects at all. In this paper, using practical thin metal structures with films containing intentionally introduced hydrogen, we demonstrate experimental ERD depth resolution and sensitivity limitations. The effects of sample material and scattering angle are also discussed. (authors)

  16. Multiple scattering effects in depth resolution of elastic recoil detection

    Energy Technology Data Exchange (ETDEWEB)

    Wielunski, L.S.; Harding, G.L. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Lindfield, NSW (Australia). Telecommunications and Industrial Physics; Szilagyi, E. [KFKI Research Institute for Particle and Nuclear Physics, Budapest, (Hungary)

    1998-06-01

    Elastic Recoil Detection (ERD) is used to profile hydrogen and other low mass elements in thin films at surface and interfaces in a similar way that Rutherford Backscattering Spectroscopy (RBS) is used to detect and profile heavy elements. It is often assumed that the depth resolutions of these two techniques are similar. However, in contrast to typical RBS, the depth resolution of ERD is limited substantially by multiple scattering. In experimental data analysis and/or spectra simulations of a typical RBS measurement multiple scattering effects are often ignored. Computer programs used in IBA, such as RUMP, HYPRA or RBX do not include multiple scattering effects at all. In this paper, using practical thin metal structures with films containing intentionally introduced hydrogen, we demonstrate experimental ERD depth resolution and sensitivity limitations. The effects of sample material and scattering angle are also discussed. (authors). 19 refs., 4 figs.

  17. Micro- and macro-structure of implantation-induced disorder in Ge

    CERN Document Server

    Glover, C J; Byrne, A P; Yu, K M; Foran, G J; Clerc, C; Hansen, J L; Nylandsted-Larsen, A

    2000-01-01

    The structure of ion implantation-induced damage in Ge substrates has been investigated with a combination of ion- and photon-based techniques including Rutherford backscattering spectrometry (RBS), perturbed angular correlation (PAC) and extended X-ray absorption fine structure (EXAFS) spectroscopy. For MeV Ge ion implantation at -196 degrees C, the dose dependence of the decrease in local atomic order, determined from EXAFS and PAC, was compared to the number of displaced atoms determined from RBS measurements. An EXAFS determined damage fraction was shown to be a better estimate of amorphous fraction than the number of displaced atoms. PAC was used to elucidate the evolution of defective configurations, and was compared to the RBS and EXAFS results. A fit to the overlap model with the overlap of two ion cascades for complete amorphization best described the experimental results. (16 refs).

  18. NASA GIBS Use in Live Planetarium Shows

    Science.gov (United States)

    Emmart, C. B.

    2015-12-01

    The American Museum of Natural History's Hayden Planetarium was rebuilt in year 2000 as an immersive theater for scientific data visualization to show the universe in context to our planet. Specific astrophysical movie productions provide the main daily programming, but interactive control software, developed at AMNH allows immersive presentation within a data aggregation of astronomical catalogs called the Digital Universe 3D Atlas. Since 2006, WMS globe browsing capabilities have been built into a software development collaboration with Sweden's Linkoping University (LiU). The resulting Uniview software, now a product of the company SCISS, is operated by about fifty planetariums around that world with ability to network amongst the sites for global presentations. Public presentation of NASA GIBS has allowed authoritative narratives to be presented within the range of data available in context to other sources such as Science on a Sphere, NASA Earth Observatory and Google Earth KML resources. Specifically, the NOAA supported World Views Network conducted a series of presentations across the US that focused on local ecological issues that could then be expanded in the course of presentation to national and global scales of examination. NASA support of for GIBS resources in an easy access multi scale streaming format like WMS has tremendously enabled particularly facile presentations of global monitoring like never before. Global networking of theaters for distributed presentations broadens out the potential for impact of this medium. Archiving and refinement of these presentations has already begun to inform new types of documentary productions that examine pertinent, global interdependency topics.

  19. Geoscience is Important? Show Me Why

    Science.gov (United States)

    Boland, M. A.

    2017-12-01

    "The public" is not homogenous and no single message or form of messaging will connect the entire public with the geosciences. One approach to promoting trust in, and engagement with, the geosciences is to identify specific sectors of the public and then develop interactions and communication products that are immediately relevant to that sector's interests. If the content and delivery are appropriate, this approach empowers people to connect with the geosciences on their own terms and to understand the relevance of the geosciences to their own situation. Federal policy makers are a distinct and influential subgroup of the general public. In preparation for the 2016 presidential election, the American Geosciences Institute (AGI) in collaboration with its 51 member societies prepared Geoscience for America's Critical Needs: Invitation to a National Dialogue, a document that identified major geoscience policy issues that should be addressed in a national policy platform. Following the election, AGI worked with eight other geoscience societies to develop Geoscience Policy Recommendations for the New Administration and the 115th Congress, which outlines specific policy actions to address national issues. State and local decision makers are another important subgroup of the public. AGI has developed online content, factsheets, and case studies with different levels of technical complexity so people can explore societally-relevant geoscience topics at their level of technical proficiency. A related webinar series is attracting a growing worldwide audience from many employment sectors. Partnering with government agencies and other scientific and professional societies has increased the visibility and credibility of these information products with our target audience. Surveys and other feedback show that these products are raising awareness of the geosciences and helping to build reciprocal relationships between geoscientists and decision makers. The core message of all

  20. Bacteriophages show promise as antimicrobial agents.

    Science.gov (United States)

    Alisky, J; Iczkowski, K; Rapoport, A; Troitsky, N

    1998-01-01

    The emergence of antibiotic-resistant bacteria has prompted interest in alternatives to conventional drugs. One possible option is to use bacteriophages (phage) as antimicrobial agents. We have conducted a literature review of all Medline citations from 1966-1996 that dealt with the therapeutic use of phage. There were 27 papers from Poland, the Soviet Union, Britain and the U.S.A. The Polish and Soviets administered phage orally, topically or systemically to treat a wide variety of antibiotic-resistant pathogens in both adults and children. Infections included suppurative wound infections, gastroenteritis, sepsis, osteomyelitis, dermatitis, empyemas and pneumonia; pathogens included Staphylococcus, Streptococcus, Klebsiella, Escherichia, Proteus, Pseudomonas, Shigella and Salmonella spp. Overall, the Polish and Soviets reported success rates of 80-95% for phage therapy, with rare, reversible gastrointestinal or allergic side effects. However, efficacy of phage was determined almost exclusively by qualitative clinical assessment of patients, and details of dosages and clinical criteria were very sketchy. There were also six British reports describing controlled trials of phage in animal models (mice, guinea pigs and livestock), measuring survival rates and other objective criteria. All of the British studies raised phage against specific pathogens then used to create experimental infections. Demonstrable efficacy against Escherichia, Acinetobacter, Pseudomonas and Staphylococcus spp. was noted in these model systems. Two U.S. papers dealt with improving the bioavailability of phage. Phage is sequestered in the spleen and removed from circulation. This can be overcome by serial passage of phage through mice to isolate mutants that resist sequestration. In conclusion, bacteriophages may show promise for treating antibiotic resistant pathogens. To facilitate further progress, directions for future research are discussed and a directory of authors from the reviewed

  1. Relationship of extinction to perceptual thresholds for single stimuli.

    Science.gov (United States)

    Meador, K J; Ray, P G; Day, L J; Loring, D W

    2001-04-24

    To demonstrate the effects of target stimulus intensity on extinction to double simultaneous stimuli. Attentional deficits contribute to extinction in patients with brain lesions, but extinction (i.e., masking) can also be produced in healthy subjects. The relationship of extinction to perceptual thresholds for single stimuli remains uncertain. Brief electrical pulses were applied simultaneously to the left and right index fingers of 16 healthy volunteers (8 young and 8 elderly adults) and 4 patients with right brain stroke (RBS). The stimulus to be perceived (i.e., target stimulus) was given at the lowest perceptual threshold to perceive any single stimulus (i.e., Minimal) and at the threshold to perceive 100% of single stimuli. The mask stimulus (i.e., stimulus given to block the target) was applied to the contralateral hand at intensities just below discomfort. Extinction was less for target stimuli at 100% than Minimal threshold for healthy subjects. Extinction of left targets was greater in patients with RBS than elderly control subjects. Left targets were extinguished less than right in healthy subjects. In contrast, the majority of left targets were extinguished in patients with RBS even when right mask intensity was reduced below right 100% threshold for single stimuli. RBS patients had less extinction for right targets despite having greater left mask - threshold difference than control subjects. In patients with RBS, right "targets" at 100% threshold extinguished left "masks" (20%) almost as frequently as left masks extinguished right targets (32%). Subtle changes in target intensity affect extinction in healthy adults. Asymmetries in mask and target intensities (relative to single-stimulus perceptual thresholds) affect extinction in RBS patients less for left targets but more for right targets as compared with control subjects.

  2. A dedicated beam line for Rutherford backscattering analysis at IFIN-HH cyclotron

    International Nuclear Information System (INIS)

    Ivanov, E. A.; Dudu, D.; Plostinaru, D.; Catana, D.; Vata, I.

    2003-01-01

    Rutherford back-scattering technique (RBS) is an analytical tool that uses elastic scattering of 1-5 MeV charged particles for analysis of the surface and the outer few micrometers of solids. IFIN-HH RBS system consists of the U-120 Cyclotron, a dedicated beam line and a scattering chamber with sample manipulators and particle detectors. In our RBS system the samples are bombarded with 2-5 alpha particles accelerated by U-120 Cyclotron (in 3-rd subharmonic regime) while the scattered particles are detected by a surface barrier detector. The signal from the detector is processed by common nuclear electronics and the particle energy spectra are stored in a computer based multichannel analyser. The data evaluation is accomplished using standard procedures and computer codes. The necessary vacuum inside chamber is obtained with an oil-free turbo pump. The beam spot dimension on the target is 1x1 mm. The standard measurement are done at Θ = 165 angle. The samples are electrically insulated and can be rotated around a vertical axis. The advantage of the RBS technique lies in the quantitative analysis of major and minor constituents lying in the first 0.5 to 2.0 micrometers of a material. Depending on the sample structure and composition, the detection limits vary from 10 11 to 10 15 at. cm -2 for heavy and light elements, respectively. The depth distribution of constituents can be reconstructed with a depth resolution of 10-20 nm. The RBS technique is non-destructive since the erosion and the radiation degradation of the sample material by the particle impact is negligible. The most extensive use of the RBS technique is in the field of electronic and optical materials, special coatings and in the study of various physico-chemical processes on the solid surfaces. (authors)

  3. Application of Rutherford backscattering and nuclear reaction analysis techniques for investigation of thin films

    International Nuclear Information System (INIS)

    Kiss, A.Z.; Simon, A.; Elekes, Z.; Ditroi, F.; Meszaros, S.; Beke, D.L.; Langer, G.A.; Daroczy, L.

    2002-01-01

    A study of the intermixing of the elements in amorphous Si-Ge multilayers have been carried out using Rutherford backscattering Spectrometry (RBS) technique. Interdiffusion coefficient was determined by measuring the intensity of the first Ge peak (having best depth resolution) in the RBS spectrum as a function of annealing time. The oxygen content of the multilayer was measured by the resonance elastic scattering method in co-operation with Dubna. A cross comparison of multilayered films were performed between the laboratories in Debrecen, Dubna, Albany and Dhaka. An essay to determine the nitrogen content of CVD diamond by the deuteron induced gamma ray emission method has been done. (author)

  4. Investigation of high temperature reactions on graphite with Rutherford backscattering spectrometry: interaction of cadmium, lead and silver with a phosphate modifier

    Energy Technology Data Exchange (ETDEWEB)

    Eloi, C.; Robertson, J.D.; Majidi, V. (Kentucky Univ., Lexington, KY (United States))

    1993-03-01

    The depth-dependent concentration profiles of nitrate salts of Pb, Cd and Ag were observed with and without the addition of (NH[sub 4])H[sub 2]PO[sub 4] chemical modifier using Rutherford backscattering spectrometry (RBS). The RBS results demonstrate that the analytes, in all the systems investigated, readily migrate ([>=]3 [mu]m) into the pyrolytic graphite coated graphite substrate at room temperature. The stabilization of Cd and Pb with the phosphate modifier is proposed to be due to the formation of a phosphate glass. Silver did not extensively interact with the phosphate modifier and was, as a result, not stabilized. (author).

  5. Investigation of high temperature reactions on graphite with Rutherford backscattering spectrometry: interaction of cadmium, lead and silver with a phosphate modifier

    International Nuclear Information System (INIS)

    Eloi, C.; Robertson, J.D.; Majidi, V.

    1993-01-01

    The depth-dependent concentration profiles of nitrate salts of Pb, Cd and Ag were observed with and without the addition of (NH 4 )H 2 PO 4 chemical modifier using Rutherford backscattering spectrometry (RBS). The RBS results demonstrate that the analytes, in all the systems investigated, readily migrate (≥3 μm) into the pyrolytic graphite coated graphite substrate at room temperature. The stabilization of Cd and Pb with the phosphate modifier is proposed to be due to the formation of a phosphate glass. Silver did not extensively interact with the phosphate modifier and was, as a result, not stabilized. (author)

  6. Photoconductivity of Selenium and Sulphur Doped a-Si:H thin Films

    OpenAIRE

    SHARMA, Sanjeev Kumar; GUPTA, Himanshu

    2014-01-01

    The accurate estimation of tree biomass is crucial for the efficient management of forest resources. In this study, we used a subsampling method for unbiased estimates of above-ground tree biomass. The method consists of 2 stages: the first stage consists of randomized branch sampling (RBS) and the second stage uses importance sampling (IS). RBS is used to select a path from the butt of an object branch to a terminal segment. IS is used for selecting a disk that produces unbiased estimates of...

  7. Present and future role of ion beam analysis in the study of cultural heritage materials: The example of the AGLAE facility

    International Nuclear Information System (INIS)

    Salomon, J.; Dran, J.-C.; Guillou, T.; Moignard, B.; Pichon, L.; Walter, P.; Mathis, F.

    2008-01-01

    The application of IBA to cultural heritage mostly relies on the use of PIXE because of its high sensitivity and its ease of implementation at atmospheric pressure. The need for depth information not easily available with this technique has conducted to associate RBS also in external beam mode. We have progressively developed a set-up that permits such a combination of techniques either simultaneously or sequentially. The set-up is currently further improved to permit NRA measurement (depth profiles of light elements) in addition to PIXE and RBS. The coupling of all these techniques provides a wealth of information on cultural heritage objects, not easily attainable with any other single method

  8. Bismuth containing III-V quaternary alloy InGaAsBi grown by MBE

    International Nuclear Information System (INIS)

    Feng, G.; Oe, K.; Yoshimoto, M.

    2006-01-01

    InGaAsBi epilayers were created on InP substrates by molecular beam epitaxy for the first time. The high crystalline quality of the InGaAsBi epilayer with smooth interface was confirmed by high resolution X-ray diffraction measurements. Up to 2.5% Bi was incorporated in the film based on Rutherford back scattering (RBS) results. The RBS channeling spectra give clear evidence that the Bi atoms were substitutionally located in the InGaAs zinc-blende lattice sites. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  9. Simultaneous Analysis of Multiple Elements by Combined Ion-Beam Methods

    International Nuclear Information System (INIS)

    Jiang, Weilin; Weber, William J.; Thevuthasan, Theva; Shutthanandan, Shuttha; J. L. Duggan and I.L. Morgan

    2001-01-01

    Rutherford backscattering spectrometry (RBS) and nuclear reaction analysis (NRA) in channeling geometry have been combined to study the accumulation and recovery of Au2+-induced disorder on both sublattices in 6H-SiC. Conventional He+ RBS/channeling is used to analyze the Ga disorder and Au profiles in Au2+-implanted GaN and the disorder on both the Sr and Ti sublattices in Au2+-implanted SrTiO3. Results on the disorder accumulation in these materials, disorder recovery in 6H-SiC, as well as the mobility of Au implants in GaN are presented and discussed

  10. Rutherford backscattering spectrometry of thin NiCr layers

    International Nuclear Information System (INIS)

    Anklam, H.J.

    1984-01-01

    The possibilities and problems of characterizing thin films of NiCr by means of Rutherford backscattering spectrometry (RBS) are demonstrated. Thin resistor films of NiCr (10 to 30 nm thick) are deposited on SiO 2 by sputtering in air or oxygen. The electrical properties depend both on integral chemical composition of films and on local distribution of elements. The determination of composition (Ni-Cr ratio, oxygen content) and of depth profiles of elements by the aid of RBS is described. For solving special analytical problems different substrates as amorphous SiO 2 , Si monocrystals, and glassy carbon are used

  11. Ion Implantation in III-V Compound Semiconductors

    Science.gov (United States)

    1984-09-01

    340 keV H + -0 Ga P  O UES-723-292 !:• (H o>ray *P-K X - rayO Ga-K X -ray iii! RBS * ..I -iO.. 0 10I to1. 01 • .0 -. I0 1 LI =i, O I 0 01 0.J 10...Identity by blo ," pume) Ion Implantation, GaAs, Hall effect, electrical resistivity, Rutherford Backscattering (RBS), channeling, Proton induced x -ray...Mebility (jH) upon Aiinealing Temperature (TA) for 1 X 101 /cm• Dose Samples of GaAs:Mg with Three Different Capping Methods 33 p 14 Dependence of Surface

  12. Show Horse Welfare: Horse Show Competitors' Understanding, Awareness, and Perceptions of Equine Welfare.

    Science.gov (United States)

    Voigt, Melissa A; Hiney, Kristina; Richardson, Jennifer C; Waite, Karen; Borron, Abigail; Brady, Colleen M

    2016-01-01

    The purpose of this study was to gain a better understanding of stock-type horse show competitors' understanding of welfare and level of concern for stock-type show horses' welfare. Data were collected through an online questionnaire that included questions relating to (a) interest and general understanding of horse welfare, (b) welfare concerns of the horse show industry and specifically the stock-type horse show industry, (c) decision-making influences, and (d) level of empathic characteristics. The majority of respondents indicated they agree or strongly agree that physical metrics should be a factor when assessing horse welfare, while fewer agreed that behavioral and mental metrics should be a factor. Respondent empathy levels were moderate to high and were positively correlated with the belief that mental and behavioral metrics should be a factor in assessing horse welfare. Respondents indicated the inhumane practices that most often occur at stock-type shows include excessive jerking on reins, excessive spurring, and induced excessive unnatural movement. Additionally, respondents indicated association rules, hired trainers, and hired riding instructors are the most influential regarding the decisions they make related to their horses' care and treatment.

  13. Best in show but not best shape: a photographic assessment of show dog body condition.

    Science.gov (United States)

    Such, Z R; German, A J

    2015-08-01

    Previous studies suggest that owners often wrongly perceive overweight dogs to be in normal condition. The body shape of dogs attending shows might influence owners' perceptions, with online images of overweight show winners having a negative effect. This was an observational in silico study of canine body condition. 14 obese-prone breeds and 14 matched non-obese-probe breeds were first selected, and one operator then used an online search engine to identify 40 images, per breed, of dogs that had appeared at a major national UK show (Crufts). After images were anonymised and coded, a second observer subjectively assessed body condition, in a single sitting, using a previously validated method. Of 1120 photographs initially identified, 960 were suitable for assessing body condition, with all unsuitable images being from longhaired breeds. None of the dogs (0 per cent) were underweight, 708 (74 per cent) were in ideal condition and 252 (26 per cent) were overweight. Pugs, basset hounds and Labrador retrievers were most likely to be overweight, while standard poodles, Rhodesian ridgebacks, Hungarian vizslas and Dobermanns were least likely to be overweight. Given the proportion of show dogs from some breeds that are overweight, breed standards should be redefined to be consistent with a dog in optimal body condition. British Veterinary Association.

  14. Tomato Fruits Show Wide Phenomic Diversity but Fruit Developmental Genes Show Low Genomic Diversity.

    Directory of Open Access Journals (Sweden)

    Vijee Mohan

    Full Text Available Domestication of tomato has resulted in large diversity in fruit phenotypes. An intensive phenotyping of 127 tomato accessions from 20 countries revealed extensive morphological diversity in fruit traits. The diversity in fruit traits clustered the accessions into nine classes and identified certain promising lines having desirable traits pertaining to total soluble salts (TSS, carotenoids, ripening index, weight and shape. Factor analysis of the morphometric data from Tomato Analyzer showed that the fruit shape is a complex trait shared by several factors. The 100% variance between round and flat fruit shapes was explained by one discriminant function having a canonical correlation of 0.874 by stepwise discriminant analysis. A set of 10 genes (ACS2, COP1, CYC-B, RIN, MSH2, NAC-NOR, PHOT1, PHYA, PHYB and PSY1 involved in various plant developmental processes were screened for SNP polymorphism by EcoTILLING. The genetic diversity in these genes revealed a total of 36 non-synonymous and 18 synonymous changes leading to the identification of 28 haplotypes. The average frequency of polymorphism across the genes was 0.038/Kb. Significant negative Tajima'D statistic in two of the genes, ACS2 and PHOT1 indicated the presence of rare alleles in low frequency. Our study indicates that while there is low polymorphic diversity in the genes regulating plant development, the population shows wider phenotype diversity. Nonetheless, morphological and genetic diversity of the present collection can be further exploited as potential resources in future.

  15. Evaluation of a responsible beverage service and enforcement program: Effects on bar patron intoxication and potential impaired driving by young adults.

    Science.gov (United States)

    Fell, James C; Fisher, Deborah A; Yao, Jie; McKnight, A Scott

    2017-08-18

    Studies of alcohol-related harm (violence, injury, illness) suggest that the most significant risk factors are the amount of alcohol consumed and whether obviously intoxicated patrons continue to be served. This study's objective was to investigate the effects of a responsible beverage service (RBS)/enhanced alcohol enforcement intervention on bars, bar patrons, and impaired driving. Two communities-Monroe County, New York, and Cleveland, Ohio-participated in a demonstration program and evaluation. The intervention applied RBS training, targeted enforcement, and corrective actions by law enforcement to a random sample of 10 identified problem bars in each community compared to 10 matched nonintervention problem bars. Data were collected over 3 waves on bar serving practices, bar patron intoxication, drinking and driving, and other alcohol-related harm from intervention and control bars and treatment and comparison communities. In Monroe County, New York, of the 14 outcome measures analyzed, 7 measures showed statistically significant differences from pre- to postintervention. Six of those measures indicated changes in the desired or positive direction and 2 measures were in the undesired or negative direction. Of note in the positive direction, the percentage of intervention bar patrons who were intoxicated decreased from 44 to 27% and the average blood alcohol concentration of patrons decreased from 0.097 to 0.059 g/dL pre- to postintervention. In Cleveland, Ohio, 6 of the 14 measures showed statistically significant changes pre- to postintervention with 6 in the positive direction and 4 in the negative direction. Of note, the percentage of pseudo-intoxicated patrons denied service in intervention bars increased from 6 to 29%. Of the 14 outcome measures that were analyzed in each community, most indicated positive changes associated with the intervention, but others showed negative associations. About half of the measures showed no significance, the sample sizes

  16. Calibration of straight TXRF analysis - results of an European Round Robin test

    International Nuclear Information System (INIS)

    Rink, I.; Wortelboer, R.; Gendt, S. de; Horn, M.; Steiner, J.; Neumann, C.; Knoth, J.; Schwenke, H.; Dobler, M.; Erdmann, V.; Rostam-Khani, P.; Kolbesen, B.O.; Metz, S.; Pahlke, S.; Fabry, L.; Gonchond, J.P.; Weiss, C.; Comin, F.

    2000-01-01

    Calibration of spot measurements pose in general less problems than calibration of straight TXRF measurements as several Round Robin tests show. This is at least matter of discussion for those TXRF users who apply a droplet standard for straight TXRF measurements at the angle of incident where particle and film-type contamination show the same fluorescence intensity - the so-called iso-angle. In order to gain more insight in the differences between several TXRF-equipment types and calibration methods we started an European Round Robin test in 1998 in which twelve firms participated using twenty different TXRF-tools, one RBS- and one Synchrotron-TXRF equipment. In contrast to earlier global Round Robin tests e.g. in 1996 (ISO/TC201/WG2) direct comparison of measurements of the same wafers is possible, because the same wafers were sent to several participants and additional reference measurements were performed at Philips as well. Wafer preparation has been performed by spin-coating of Ni (5 concentrations) and by dipping in Fe-spiked SCI-solution (1 blank, 2 spiking concentrations). From this eight sets were formed containing eight wafers with varying Ni-and Fe-concentrations. All wafers were firstly measured at Philips as reference and then sent to certain participant-groups. The results of this first measurement show that the sets were almost comparable to each other with a standard deviation of < 15 % for the variants Ni-3, Ni-4, Ni-5 and Fe-2, with exception of few single concentrations of some sets. After normalization it is possible to compare all results of these variants with one reference value. The results can be divided in three groups with similar results and one extreme outlier: group 1: RBS-results and those results based on correction with Fit-program from GKSS, calibration with spin-coated wafers (RBS, Radio tracer) and results of one XSA 8000 and of one Rigaku 3750; group 2: Results of all Atomika TXRF 8030, three Atomika TXRF 8010, one TREX630S

  17. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The folded tandem ion accelerator (FOTIA) project at BARC has been commissioned. The analysed carbon beams of 40 nA(3+) and 25 nA(4+), at terminal voltage of 2.5 MV with N2 + CO2 as insulating gas, were obtained. The beams were characterized by performing the Rutherford back scattering (RBS) on gold, tin and ...

  18. Characterization of thin films and surfaces by ion-beam analytical techniques

    International Nuclear Information System (INIS)

    Pelicon, P.; Budnar, M.; Zorko, B.; Razpet, A.

    1999-01-01

    The optimization of Rutherford Backscattering Spectroscopy (RBS) and Elastic Recoil Detection Analysis (ERDA) at the tandetron facility of J. Stefan Inst.e is reported. The most recent applications of these techniques for the analysis of thin films and surfaces are presented. The construction of the isotope - resolved Time-Of-Flight ERDA telescope for depth profiling of light elements is reviewed.(author)

  19. Sequential application of non-pharmacological interventions reduces the severity of labour pain, delays use of pharmacological analgesia, and improves some obstetric outcomes: a randomised trial

    Directory of Open Access Journals (Sweden)

    Rubneide Barreto Silva Gallo

    2018-01-01

    Trial registration: NCT01389128. [Gallo RBS, Santana LS, Marcolin AC, Duarte G, Quintana SM (2018 Sequential application of non-pharmacological interventions reduces the severity of labour pain, delays use of pharmacological analgesia, and improves some obstetric outcomes: a randomised trial. Journal of Physiotherapy 64: 33–40

  20. 75 FR 63846 - Meeting of the Task Force on Community Preventive Services

    Science.gov (United States)

    2010-10-18

    ... Product Distribution to Improve Health Behaviors; Responsible Beverage Service (RBS) Training to Decrease..., environmental, population, and healthcare system interventions in public health and health promotion. During... Prevention. Agenda items are subject to change as priorities dictate. Meeting Accessibility: This meeting is...

  1. Nuclear analysis of a rare earth containing protective oxide on aluminium

    Energy Technology Data Exchange (ETDEWEB)

    Gorman, J.D.; Paterson, P.J.K. [Royal Melbourne Inst. of Tech., VIC (Australia); Hughes, A.E. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Melbourne, VIC (Australia). Div. of Materials Science

    1996-12-31

    The aim is study was to examine the thickness of the conversion coating as well as the elemental depth distribution of cerium and molybdenum using Rutherford Backscattering Spectroscopy (RBS), Scanning Electron Microscopy (SEM), Scanning Auger Electron Spectroscopy and Forward Recoil Spectroscopy (FRS). In addition, RBS has been used to examine how changes in processing conditions, particularly the treatment temperatures, influences the coating thickness and Ce distribution at each process step. SEM established that a crazed oxide structure was developed over the matrix of the alloy using the above process steps. RBS was chosen to provide elemental concentration versus depth information on these samples since it is largely insensitive to surface topography when the detector is set to high scattering angles. A other advantage of using RBS for this particular system is that the heavy elements incorporated into the coating such as Ce and Mo because of their high atomic number compared to the aluminium oxide, are well separated from aluminium and oxygen at their higher recoil energies. Forward Recoil Spectroscopy is capable of detecting hydrogen and it has been used to confirm that the coating is hydrated and to establish the hydrogen distribution within the final oxide coating on each alloy. 7 refs., 1 tab., 4 figs.

  2. Au implantation into various types of silicate glasses

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Macková, Anna; Bočan, Jiří; Švecová, B.; Nekvindová, P.

    2009-01-01

    Roč. 267, - (2009), s. 1575-1578 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : Au+ ion implantation * Glass es * RBS Depth profiling Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009

  3. 75 FR 11836 - Bioenergy Program for Advanced Biofuels

    Science.gov (United States)

    2010-03-12

    ... Biofuels AGENCY: Rural Business-Cooperative Service (RBS), USDA. ACTION: Notice of Contract for Proposal... Year 2009 for the Bioenergy Program for Advanced Biofuels under criteria established in the prior NOCP... Bioenergy Program for Advanced Biofuels. In response to the previously published NOCP, approximately $14.5...

  4. Nuclear analysis of a rare earth containing protective oxide on aluminium

    Energy Technology Data Exchange (ETDEWEB)

    Gorman, J D; Paterson, P J.K. [Royal Melbourne Inst. of Tech., VIC (Australia); Hughes, A E [Commonwealth Scientific and Industrial Research Organisation (CSIRO), Melbourne, VIC (Australia). Div. of Materials Science

    1997-12-31

    The aim is study was to examine the thickness of the conversion coating as well as the elemental depth distribution of cerium and molybdenum using Rutherford Backscattering Spectroscopy (RBS), Scanning Electron Microscopy (SEM), Scanning Auger Electron Spectroscopy and Forward Recoil Spectroscopy (FRS). In addition, RBS has been used to examine how changes in processing conditions, particularly the treatment temperatures, influences the coating thickness and Ce distribution at each process step. SEM established that a crazed oxide structure was developed over the matrix of the alloy using the above process steps. RBS was chosen to provide elemental concentration versus depth information on these samples since it is largely insensitive to surface topography when the detector is set to high scattering angles. A other advantage of using RBS for this particular system is that the heavy elements incorporated into the coating such as Ce and Mo because of their high atomic number compared to the aluminium oxide, are well separated from aluminium and oxygen at their higher recoil energies. Forward Recoil Spectroscopy is capable of detecting hydrogen and it has been used to confirm that the coating is hydrated and to establish the hydrogen distribution within the final oxide coating on each alloy. 7 refs., 1 tab., 4 figs.

  5. Phenotypic variability in 49 cases of ESCO2 mutations, including novel missense and codon deletion in the acetyltransferase domain, correlates with ESCO2 expression and establishes the clinical criteria for Roberts syndrome

    DEFF Research Database (Denmark)

    Vega, H; Trainer, A H; Gordillo, M

    2010-01-01

    Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be truncating...

  6. The Roberts syndrome/SC phocomelia spectrum--a case report of an adult with review of the literature.

    Science.gov (United States)

    Goh, Elaine Suk-Ying; Li, Chumei; Horsburgh, Sheri; Kasai, Yumi; Kolomietz, Elena; Morel, Chantal France

    2010-02-01

    Roberts syndrome (RBS) (OMIM #268300) is a rare autosomal recessive disorder characterized by tetraphocomelia (symmetrical limb reduction), craniofacial anomalies, growth retardation, mental retardation, cardiac and renal abnormalities. The syndrome is caused by mutations in the ESCO2 (establishment of cohesion 1 homolog 2) (Entrez 609353) gene, which is located at 8p21.1, and encodes a protein essential in establishing sister chromatid cohesion during S phase. SC phocomelia (SC) (OMIM #269000), has less severe symmetric limb reduction, flexion contractures of various joints, minor facial anomalies, growth retardation and occasionally, mental retardation. These two syndromes can be considered part of a spectrum, with RBS at the most severe range in which severely affected infants may be stillborn or die in the post-natal period, while individuals with SC phocomelia represent the milder end of the spectrum and typically survive to adulthood. In both presentations, karyotype investigations characteristically reveal premature centromere separation (PCS), otherwise known as heterochromatin repulsion or puffing. There is little literature about the follow-up of adults with the spectrum of RBS/SC phocomelia or their recommended management. We report on an adult presentation of RBS/SC phocomelia spectrum disorder with a history of major cardiac malformation in childhood, normal limbs on physical examination, mild facial anomalies, mild learning difficulties, and PCS. Molecular studies of ESCO2 have confirmed the diagnosis. A literature review, focussing on adult manifestations of this condition and a discussion of follow-up guidelines are presented. Copyright 2010 Wiley-Liss, Inc.

  7. Phenotypic variability in 49 cases of ESCO2 mutations, including novel missense and codon deletion in the acetyltransferase domain, correlates with ESCO2 expression and establishes the clinical criteria for Roberts syndrome

    NARCIS (Netherlands)

    Vega, H.; Trainer, A.H.; Gordillo, M.; Crosier, M.; Kayserili, H.; Skovby, F.; Uzielli, M.L.G.; Schnur, R.E.; Manouvrier, S.; Blair, E.; Hurst, J.A.; Forzano, F.; Meins, M.; Simola, K.O.J.; Raas-Rothschild, A; Hennekam, R.C.M.; Jabs, E.W.

    2010-01-01

    Background Roberts syndrome (RBS) and SC phocomelia are caused by mutations in ESCO2, which codes for an acetyltransferase involved in the regulation of sister chromatid cohesion. Of 26 mutations described to date, only one missense mutation has been reported and all others are predicted to be

  8. Study of Ag and PE interface after plasma treatment

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Malinský, Petr; Bočan, Jiří; Švorčík, V.; Pavlík, J.; Strýhal, Z.; Sajdl, P.

    2008-01-01

    Roč. 5, č. 4 (2008), s. 964-967 ISSN 1610-1634 R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : metal/polymer interfacerface * metallized polymers * RBS Subject RIV: JJ - Other Materials

  9. Preparation and characterization of tempered tungsten layers on single crystalline silicon

    International Nuclear Information System (INIS)

    Nitzsche, K.; Knedlik, C.; Tippmann, H.; Spiess, L.; Harman, R.; Vanek, O.; Tvarozek, V.

    1984-01-01

    Tungsten layers have been deposited on single crystalline silicon by sputtering and characterized by measurements of the sheet resistance by a linear four point method and the van der Pauw method. The influence of tempering under argon on the resistance has been studied. By means of the RBS spectroscopy it was found that the increase in the specific resistance is caused by interdiffusion

  10. Thin Film Materials and Devices for Resistive Temperature Sensing Applications

    Science.gov (United States)

    2015-05-21

    Rutherford backscattering spectroscopy (RBS), Raman spectroscopy, scanning electron microscopy (SEM), TEM, and atomic force microscopy (AFM) did...composition and structure by real time spectroscopic ellipsometry," Physica Status Solidi A, vol. 205, pp. 892-895, 2008. [92] H. Fujiwara, J. Koh , P. I

  11. Merksi Läti konkurendi juht läheb altkäemaksu andmise eest vangi / Silvia Kruusmaa

    Index Scriptorium Estoniae

    Kruusmaa, Silvia

    2008-01-01

    Läti rahvusraamatukogu ehitusega seotud ehitusettevõtte RBS Skalsi juhatuse liige Andris Treijs mõisteti altkäemaksu andmise eest vangi. Raamatukogu ehitusest on korruptsiooni tõttu kõrvale tõrjutud ka Merko Ehituse tütarfirma Merks

  12. A part toolbox to tune genetic expression in Bacillus subtilis

    Science.gov (United States)

    Guiziou, Sarah; Sauveplane, Vincent; Chang, Hung-Ju; Clerté, Caroline; Declerck, Nathalie; Jules, Matthieu; Bonnet, Jerome

    2016-01-01

    Libraries of well-characterised components regulating gene expression levels are essential to many synthetic biology applications. While widely available for the Gram-negative model bacterium Escherichia coli, such libraries are lacking for the Gram-positive model Bacillus subtilis, a key organism for basic research and biotechnological applications. Here, we engineered a genetic toolbox comprising libraries of promoters, Ribosome Binding Sites (RBS), and protein degradation tags to precisely tune gene expression in B. subtilis. We first designed a modular Expression Operating Unit (EOU) facilitating parts assembly and modifications and providing a standard genetic context for gene circuits implementation. We then selected native, constitutive promoters of B. subtilis and efficient RBS sequences from which we engineered three promoters and three RBS sequence libraries exhibiting ∼14 000-fold dynamic range in gene expression levels. We also designed a collection of SsrA proteolysis tags of variable strength. Finally, by using fluorescence fluctuation methods coupled with two-photon microscopy, we quantified the absolute concentration of GFP in a subset of strains from the library. Our complete promoters and RBS sequences library comprising over 135 constructs enables tuning of GFP concentration over five orders of magnitude, from 0.05 to 700 μM. This toolbox of regulatory components will support many research and engineering applications in B. subtilis. PMID:27402159

  13. Atomic mixing effects on high fluence Ge implantation into Si at 40 keV

    International Nuclear Information System (INIS)

    Gras-Marti, A.; Jimenez-Rodriguez, J.J.; Peon-Fernandez, J.; Rodriguez-Vidal, M.; Tognetti, N.P.; Carter, G.; Nobes, M.J.; Armour, D.G.

    1982-01-01

    Ion implanted profiles of 40 keV Ge + into Si at fluences ranging from approx. equal to 10 15 ions/cm 2 up to saturation have been measured using the RBS technique. The profiles compare well with the predictions of an analytical model encompasing sputter erosion plus atomic relocation. (orig.)

  14. Extraction of ISOLDE parameters from CALS, streaming of pressure data through web-services and visual target documentation

    CERN Document Server

    Rakhmatov, Eradzh

    2017-01-01

    This report gives a short description of the projects I have been involved in during my stay as a Non Member State Summer Student at the European Organization for Nuclear Research (CERN). All my work took place within ISOLDE collaboration, in the EN-STI-RBS section.

  15. IBA techniques: Examples of useful combinations for the characterisation of cultural heritage materials

    Science.gov (United States)

    Beck, L.; Pichon, L.; Moignard, B.; Guillou, T.; Walter, P.

    2011-12-01

    For many years, ion beam analysis techniques have successfully been used to the study of cultural heritage objects. The chemical composition of work art is usually determined by PIXE, but in many cases, RBS and/or PIGE can provide useful complementary information. RBS gives information about the depth distribution and concentration in light elements, such as carbon and oxygen. In the past years, the experimental facilities at the AGLAE (Accélérateur Grand Louvre d'Analyse Élémentaire) accelerator has been progressively developed in order to apply simultaneously PIXE, PIGE and RBS under optimal conditions using an external beam. This combination is now routinely used for point analyses or mappings. In this contribution, we present several examples of applications: manufacturing technology of lustre-decorated ceramics and silver plating, control of altered or restored surfaces, and quantification of organic phase in painting and bone. The final conclusion is that the association of PIXE with RBS is very attractive for the investigation of cultural heritage objects, in particular of materials containing both mineral and organic components or possessing a multilayered structure. The first results of the production of monochromatic X-rays for radiography purposes by PIXE are also presented.

  16. Optical, electrical and thermoelectric power studies of Al–Sb thin film ...

    Indian Academy of Sciences (India)

    Unknown

    (Al–Sb), with a energy gap of 1⋅62 eV, is potentially a high efficiency solar material ... The RBS analysis was carried out at the Institute of. Physics, Bhubaneswar, to .... under a minor research project grant of UGC. References. Agrawal A ...

  17. Further Validation of the MMPI-2 And MMPI-2-RF Response Bias Scale: Findings from Disability and Criminal Forensic Settings

    Science.gov (United States)

    Wygant, Dustin B.; Sellbom, Martin; Gervais, Roger O.; Ben-Porath, Yossef S.; Stafford, Kathleen P.; Freeman, David B.; Heilbronner, Robert L.

    2010-01-01

    The present study extends the validation of the Minnesota Multiphasic Personality Inventory-2 (MMPI-2) and the Minnesota Multiphasic Personality Inventory-2 Restructured Form (MMPI-2-RF) Response Bias Scale (RBS; R. O. Gervais, Y. S. Ben-Porath, D. B. Wygant, & P. Green, 2007) in separate forensic samples composed of disability claimants and…

  18. The study of an aluminium-alloy distributed ion pump

    International Nuclear Information System (INIS)

    Liu, Y.C.; Lin, W.J.; Chen, J.R.; National Tsinghua Univ., Hsinchu, Taiwan

    1990-01-01

    A distribution ion pump with aluminum chamber, aluminum anodes and titanium cathodes has been studied. It was observed from AES and RBS analyses that a titanium layer with oxygen and nitrogen atoms (with a ratio T i /N + 0 ≅ 0.7) was deposited on the surface of the aluminum anode. (author)

  19. Responsible Hospitality. Prevention Updates

    Science.gov (United States)

    Colthurst, Tom

    2004-01-01

    Responsible Hospitality (RH)--also called Responsible Beverage Service (RBS)--encompasses a variety of strategies for reducing risks associated with the sale and service of alcoholic beverages. RH programs have three goals: (1) to prevent illegal alcohol service to minors; (2) to reduce the likelihood of drinkers becoming intoxicated; and (3) to…

  20. 5373 Volume 11 No. 6 October 2011 TRUST, CELL PHONES ...

    African Journals Online (AJOL)

    Khanjan Mehta

    2011-10-06

    Oct 6, 2011 ... entrepreneurship, social networks and cell phones that is crucial for the establishment ... relationships to each other and to individuals and organizations related to their area of ..... www.rurdev.usda.gov/RBS/pub/cir1sec3.pdf.

  1. Standardizing Ammunition Distribution within the United States Navy as either a Push or Pull Methodology

    Science.gov (United States)

    2012-06-01

    and free transportation if they ordered full truckloads of pasta , and sales representatives earned larger salaries and commissions based on the...Requirements Based Load Plan IUID Item Unique Identification JDDOC Joint Deployment And Distribution Operations Center JIT Just In Time JITD Just...Information System RBS Readiness Based Sparing RFID Radio Frequency Identification SCM Supply Chain Management SLCM Submarine Launched Cruise Missile

  2. Electrical properties of epitaxially grown VOx thin films

    NARCIS (Netherlands)

    Rata, A.D.; Chezan, A.R; Presura, C.N.; Hibma, T

    2003-01-01

    High quality VOx thin films on MgO(100) substrates were prepared and studied from the structural and electronic point of view. Epitaxial growth was confirmed by RHEED and XRD techniques. The oxygen content of VOx thin films as a function of oxygen flux was determined using RBS. The upper and lower

  3. 75 FR 50983 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-08-18

    ... creation projects such as business start- up costs, business expansion, community development, and business... number. Rural Business-Cooperative Service Title: Rural Economic Development Loan and Grant Program. OMB... program. Rural Business Service (RBS) mission is to improve the quality of life in rural America by...

  4. 78 FR 67099 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-11-08

    ..., business expansion, community development, and business incubator projects. Need and Use of the Information... it displays a currently valid OMB control number. Rural Business--Cooperative Service Title: Rural.... 940(c)) that established a loan and grant program. Rural Business Service (RBS) mission is to improve...

  5. Micro-PIXE for the quantitative imaging of chemical elements in single cells

    International Nuclear Information System (INIS)

    Ortega, R.

    2013-01-01

    Full text: The knowledge of the intracellular distribution of biological relevant metals is important to understand their mechanisms of action in cells, either for physiological, toxicological or pathological processes. However, the direct detection of trace metals in single cells is a challenging task that requires sophisticated analytical developments. The aim of this seminar will be to present the recent achievements in this field using micro-PIXE analysis. The combination of micro-PIXE with RBS (Rutherford Backscattering Spectrometry) and STIM (Scanning Transmission lon Microscopy) allows the quantitative determination of trace metal content within sub-cellular compartments. The application of STlM analysis will be more specifically highlighted as it provides high spatial resolution imaging (<200 nm) and excellent mass sensitivity (<0.1 ng). Application of the STIM-PIXE-RBS methodology is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. This combination of STIM-PIXE-RBS provides fully quantitative determination of trace element content, expressed in μg/g, which is a quite unique capability for micro-PIXE compared to other micro-analytical methods such as the electron and synchrotron X-ray fluorescence or the techniques based on mass spectrometry. Examples of micro-PIXE studies for subcellular imaging of trace elements in the various fields of interest will be presented such as metal-based toxicology, pharmacology, and neuro degeneration [1] R. Ortega, G. Devés, A. Carmona. J. R. Soc. Interface, 6, (2009) S649-S658. (author)

  6. Abstract

    African Journals Online (AJOL)

    UDS-CAPTURED

    examines the extent of women farmers' access to credit from Rural Banks (RBs) in the Upper East. Region of Ghana. .... In this regard, anybody who does not attempt to get credit from formal, semi-formal/endogenous or ... District and the Builsa Community Rural Bank with its headquarters at Sandema in the Builsa. District.

  7. Numerical Study on the Behaviour of Reduced Beam Section Presence in Rectangular Concrete Filled Tubes Connection

    Science.gov (United States)

    Amalia, A. R.; Suswanto, B.; Kristijanto, H.; Irawan, D.

    2018-01-01

    This paper discusses about the behaviour of two types of RCFT column connections with steel beams due to cyclic loads using software based on finite element method ABAQUS 6.14. This comparison involves modelling RCFT connections with rigid connection that do not allow any deformation and rotation in the joint. There are two types of model to be compared: BB and BRBS which include RCFT connections to ordinary beam without RBS (BB) and to Reduce Beam Section Beam (BRBS). The models behaviour can be discussed in this study are stress value, von misses stress pattern and rotational degree of each model. From the von misses stress pattern value, it found that the highest regions of stress occurs in vicinity of beam flange near column face for connection without RBS (BB). For earthquake resistant building, that behaviour needs to be avoided because sudden collapse often happen in that joint connection. Moreover, the connection with the presence of RBS (BRBS), the highest regions of stress occurs in reduced beam section of the beam, it means that the failure might be happen as proposed plan. The ultimate force that can be restrained by BB model (402 kN) is higher than BRBS model (257,18 kN) because of reducing of flange area. BRBS model has higher rotation angle (0,057 rad) than BB model (0,045 rad). The analysis results also observed that cyclic performances of the moment connection with RBS (BRBS) were more ductile than the connection with ordinary beam (BB).

  8. Micro-PIXE for single cell analysis

    International Nuclear Information System (INIS)

    Ortega, Richard

    2012-01-01

    The knowledge of the intracellular distribution of biological relevant metals is important to understand their mechanisms of action in cells, either for physiological, toxicological or pathological processes. However, the direct detection of trace metals in single cells is a challenging task that requires sophisticated analytical developments. The combination of micro-PIXE with RBS and STIM (Scanning Transmission Ion Microscopy) allows the quantitative determination of trace metal content within sub-cellular compartments. The application of STIM analysis provides high spatial resolution imaging (< 200 nm) and excellent mass sensitivity (< 0.1 ng). Application of the STIM-PIXE-RBS methodology is absolutely needed when organic mass loss appears during PIXE-RBS irradiation. This combination of STIM-PIXE-RBS provides fully quantitative determination of trace element content, expressed in μg/g, which is a quite unique capability for micro-PIXE compared to other micro-analytical methods such as the electron and synchrotron x-ray fluorescence. Examples of micro-PIXE studies for sub-cellular imaging of trace elements in various fields of interest will be presented: in patho-physiology of trace elements involved in neurodegenerative diseases such as Parkinson's disease, and in toxicology of metals such as cobalt. (author)

  9. Nuclear and conventional techniques applied to the analysis of Purhepecha metals of the Pareyon collection

    International Nuclear Information System (INIS)

    Mendez, U.; Tenorio C, D.; Ruvalcaba, J.L.; Lopez, J.A.

    2005-01-01

    The main objective of this investigation was to determine the composition and microstructure of 13 metallic devices by means of the nuclear techniques of PIXE, RBS and conventional; which were elaborated starting from copper and gold, and they were in the offering of a tarasc personage located in the 'Matamoros' porch in Uruapan, Michoacan, Mexico. (Author)

  10. Collaboration for the design of an irradiation line in the Tandetron area

    International Nuclear Information System (INIS)

    Quezada G, A.

    2006-01-01

    Presently work is sought to contribute in the design of a new line for the Tandetron accelerator that allows the application of other analytical techniques as its are: Rutherford backscattering analysis (RBS), elastic setback scattering analysis (ERDA) elastic scattering toward ahead (EFA) and materials modification by means of the particle beams application. (Author)

  11. Use of an ultra-high resolution magnetic spectrograph for materials research

    NARCIS (Netherlands)

    Boerma, DO; Arnoldbik, WM; Wolfswinkel, W; Balogh, AG; Walter, G

    1997-01-01

    A brief description is given of a magnetic spectrograph for RBS and ERD analysis with MeV beams, delivered by a Tandem accelerator. With a number of examples of thin layer analysis it is shown that the spectrograph is uniquely suited for the measurement of concentration depth profiles up to a depth

  12. 75 FR 3197 - Notice of a Public Meeting on Administration of the Business and Industry Guaranteed Loan Program

    Science.gov (United States)

    2010-01-20

    ... DEPARTMENT OF AGRICULTURE Rural Business-Cooperative Service Notice of a Public Meeting on Administration of the Business and Industry Guaranteed Loan Program AGENCY: Rural Business-Cooperative Service, USDA. ACTION: Notice of public meeting. SUMMARY: The Rural Business-Cooperative Service (RBS), an...

  13. Study of oxide facing at silicone detectors of ionization detectors

    International Nuclear Information System (INIS)

    Kopestansky, J.; Tykva, R.

    1999-01-01

    Formation of oxide facing on silicone in discrete phases of technological preparation of detectors and interaction of gold (aluminium) steamed with SiO x layer were studied. The homogeneity of Au and Si) x layers and interface Au-SiO x and SiO x -Si were examined. The methods SIMS, and partially XPS, AES and RBS were used

  14. Comparison of estimated and experimental subaqueous seed transport.

    Science.gov (United States)

    Scott Markwith; David Leigh

    2011-01-01

    We compare the estimates from the relative bed stability (RBS) equation that indicates incipient bed movement, and the inertial settling (‘Impact’) law and Wu and Wang (2006) settling velocity equations that indicate suspended particle movement, to flume and settling velocity observations to confirm the utility of the equations for subaqueous hydrochory analyses, and...

  15. Cohesinopathies of a feather flock together.

    Directory of Open Access Journals (Sweden)

    Robert V Skibbens

    Full Text Available Roberts Syndrome (RBS and Cornelia de Lange Syndrome (CdLS are severe developmental maladies that present with nearly an identical suite of multi-spectrum birth defects. Not surprisingly, RBS and CdLS arise from mutations within a single pathway--here involving cohesion. Sister chromatid tethering reactions that comprise cohesion are required for high fidelity chromosome segregation, but cohesin tethers also regulate gene transcription, promote DNA repair, and impact DNA replication. Currently, RBS is thought to arise from elevated levels of apoptosis, mitotic failure, and limited progenitor cell proliferation, while CdLS is thought to arise, instead, from transcription dysregulation. Here, we review new information that implicates RBS gene mutations in altered transcription profiles. We propose that cohesin-dependent transcription dysregulation may extend to other developmental maladies; the diagnoses of which are complicated through multi-functional proteins that manifest a sliding scale of diverse and severe phenotypes. We further review evidence that cohesinopathies are more common than currently posited.

  16. IBA techniques: Examples of useful combinations for the characterisation of cultural heritage materials

    International Nuclear Information System (INIS)

    Beck, L.; Pichon, L.; Moignard, B.; Guillou, T.; Walter, P.

    2011-01-01

    For many years, ion beam analysis techniques have successfully been used to the study of cultural heritage objects. The chemical composition of work art is usually determined by PIXE, but in many cases, RBS and/or PIGE can provide useful complementary information. RBS gives information about the depth distribution and concentration in light elements, such as carbon and oxygen. In the past years, the experimental facilities at the AGLAE (Accélérateur Grand Louvre d’Analyse Élémentaire) accelerator has been progressively developed in order to apply simultaneously PIXE, PIGE and RBS under optimal conditions using an external beam. This combination is now routinely used for point analyses or mappings. In this contribution, we present several examples of applications: manufacturing technology of lustre-decorated ceramics and silver plating, control of altered or restored surfaces, and quantification of organic phase in painting and bone. The final conclusion is that the association of PIXE with RBS is very attractive for the investigation of cultural heritage objects, in particular of materials containing both mineral and organic components or possessing a multilayered structure. The first results of the production of monochromatic X-rays for radiography purposes by PIXE are also presented.

  17. Degradation effects and Si-depth profiling in photoresists using ion beam analysis

    NARCIS (Netherlands)

    IJzendoorn, van L.J.; Schellekens, J.P.W.

    1989-01-01

    The reaction of silicon-containing vapour with a photoresist layer, as used in dry developable lithographic processes, was studied with Rutherford backscattering spectrometry (RBS). Degradation of the polymer layer was observed, but the total amount of incorporated Si was found to be constant during

  18. Some peculiarity of element analysis using charged particle beams

    International Nuclear Information System (INIS)

    Kobzev, A.P.; Abu-Alazm, S.M.; Helal, A.I.; Zahran, N.F.

    2002-01-01

    Multilayer structures, SiC -layers at Si substrate, have been analyzed by RBS, NR, ERD and PIXE methods using the charged particle beams from EG-5 Van de Graaff accelerator of JINR. The depth profiles of the based deposited layers were obtained for the multilayer structures

  19. India mainstreams medicinal plants | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The program is partly sponsored by IDRC's Medicinal and Aromatic Plants Program in Asia (MAPPA). IDRC has supported medicinal plant research in the region since 1992. Improving quality control. R.B.S. Rawat, CEO of India's National Medicinal Plants Board, said people in Chhattisgarh and other states stand to benefit ...

  20. 77 FR 75969 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-12-26

    ... Development Act, as amended. The purpose of the program is to improve, develop, or finance businesses..., electronic, mechanical, or other technological collection techniques or other forms of information technology... it displays a currently valid OMB control number. Rural Business Service (RBS) Title: 7 CFR 4279-A...

  1. Rhizosphere microorganisms affected by soil solarization and cover cropping in Capsicum annuum and Phaseolus lunatus agroecosystems

    Science.gov (United States)

    Field experiments were conducted to evaluate the effects of soil solarization or cover cropping on bell pepper (Capsicum annuum) and lima bean (Phaseolus lunatus, L.) rhizosphere microorganisms. In Experiment I, flat surface solarization (FSS), raised bed solarization (RBS), cowpea (Vigna unguiculat...

  2. Ecological correlates of relative brain size in some South African ...

    African Journals Online (AJOL)

    1992-07-02

    Jul 2, 1992 ... species of rodent from South Africa and is shown to vary with six species having a positive RBS (that is a ... Arboreal species such as Paraxerus cepapi and ... large brains can be linked to the complex behavioural patterns ...

  3. Co-digestion of wheat and rye bread suspensions with source-sorted municipal biowaste

    International Nuclear Information System (INIS)

    Li, Chaoran; Mörtelmaier, Christoph; Winter, Josef; Gallert, Claudia

    2015-01-01

    Graphical abstract: Volatile fatty acid spectra of acidified WBS, RBS or FBS differ, but methanogenesis is similar. Display Omitted - Highlights: • Biogas improvement by co-digestion of wheat and rye bread. • Increased population density at high organic loading rates. • Less Pelotomaculum but increased numbers of Syntrophobacter and Smithella found in rye bread reactor. • Replacement of Methanosarcinales by acetate-oxidizers in rye bread co-digestion. • Increasing proportion of Methanomicrobiales in biowaste + rye bread reactor. - Abstract: Acidification of wheat bread (WBS), rye bread (RBS) and fresh biowaste suspensions (FBS), leading to lactate+acetate, lactate+acetate+n-buyrate, and acetate+propionate+n-butyrate, respectively, and biogas production as well as population dynamics were investigated. Co-fermentation of FBS (14 kg m −3 d −1 organic loading rate (OLR)) with WBS or RBS was stable up to an OLR of 22 kg m −3 d −1 and resulted in up to 3 times as much biogas. During co-fermentation at more than 20 kg m −3 d −1 OLR the total population increased more than 2-fold, but the originally low share of propionate-oxidizing bacteria significantly decreased. The proportion of methanogens also decreased. Whereas the proportion of Methanosarcinales to Methanomicrobiales in biowaste and biowaste+WBS remained constant, Methanosarcinales and in particular Methanosaeta spec. in the biowaste+RBS assay almost completely disappeared. Methanomicrobiales increased instead, indicating propionate oxidation via acetate cleavage to CO 2 and hydrogen

  4. The Factor Structure of the Polish-Language Version of the Romantic Beliefs Scale

    Directory of Open Access Journals (Sweden)

    Katarzyna Adamczyk

    2014-07-01

    Full Text Available The aim of the present study was to investigate the factor structure and psychometric properties of the Polish adaptation of Romantic Beliefs Scale (RBS; Sprecher & Metts, 1989. In a sample of 414 Polish university students aged 19-25 (227 females and 187 males, the factor structure of the original English version was confirmed for the four subscales: Love Finds a Way, One and Only, Idealization, and Love at First Sight. The present study provides evidence that the 15-item version of the Polish adaptation of the (RBS possesses a factor structure and psychometric properties comparable to the English-language version of RBS. It was shown to be a reliable self-report measure for romantic beliefs within a sample of the Polish population. The development of a new Polish measure of romantic beliefs has provided further validation for the RBS, and provided evidence in support of the ideology of romanticism in various populations, and indicated the importance of differentiating between the different types of romantic beliefs.

  5. Conference on instrumental activation analysis IAA 92

    International Nuclear Information System (INIS)

    Frana, J.; Obrusnik, I.

    1992-05-01

    The publication contains 26 abstracts primarily concerned with neutron activation analysis, although other analytical techniques based on X-ray fluorescence analysis, PIXE, PIGE, RBS are also included. Some contributions deal with aspects of quality practice and assurance in radioanalytical laboratories, with marketing of instrumental neutron activation analysis services, with hard- and software aspects of radiation detection, etc. (Z.S.)

  6. SwissProt search result: AK068266 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068266 J013149A10 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 1e-32 ...

  7. SwissProt search result: AK068555 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068555 J013156H12 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 6e-34 ...

  8. SwissProt search result: AK070257 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070257 J023042N11 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 5e-33 ...

  9. SwissProt search result: AK061611 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061611 001-032-F07 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 4e-33 ...

  10. SwissProt search result: AK099574 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK099574 J013036G21 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 8e-34 ...

  11. SwissProt search result: AK121444 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121444 J023141B14 (P16881) Ribulose bisphosphate carboxylase small chains, chloro...plast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 6e-33 ...

  12. SwissProt search result: AK119219 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119219 001-046-F11 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 4e-33 ...

  13. SwissProt search result: AK059909 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059909 006-209-C06 (P16881) Ribulose bisphosphate carboxylase small chains, chlor...oplast precursor (EC 4.1.1.39) (RuBisCO small subunits) [Contains: Ribulose bisphosphate carboxylase small chain P1; Ribulos...e bisphosphate carboxylase small chain P2; Ribulose bispho RBS_EUGGR 2e-33 ...

  14. Mycobacterium fortuitum Infection following Reconstructive Breast Surgery: Differentiation from Classically Described Red Breast Syndrome

    Directory of Open Access Journals (Sweden)

    Orlando J. Cicilioni, Jr, MD, FACS

    2013-10-01

    Conclusions: When presented with possible RBS, surgeons must rule out cellulitis, culture for acid-fast bacilli such as mycobacterium species, and then determine the best course of treatment. Patient counseling regarding potential household sources of infection is warranted to minimize postoperative infection risk.

  15. Ultrafast Approximation for Phylogenetic Bootstrap

    NARCIS (Netherlands)

    Bui Quang Minh, [No Value; Nguyen, Thi; von Haeseler, Arndt

    Nonparametric bootstrap has been a widely used tool in phylogenetic analysis to assess the clade support of phylogenetic trees. However, with the rapidly growing amount of data, this task remains a computational bottleneck. Recently, approximation methods such as the RAxML rapid bootstrap (RBS) and

  16. Knock-in/Knock-out (KIKO) vectors for rapid integration of large DNA sequences, including whole metabolic pathways, onto the Escherichia coli chromosome at well-characterised loci.

    Science.gov (United States)

    Sabri, Suriana; Steen, Jennifer A; Bongers, Mareike; Nielsen, Lars K; Vickers, Claudia E

    2013-06-24

    Metabolic engineering projects often require integration of multiple genes in order to control the desired phenotype. However, this often requires iterative rounds of engineering because many current insertion approaches are limited by the size of the DNA that can be transferred onto the chromosome. Consequently, construction of highly engineered strains is very time-consuming. A lack of well-characterised insertion loci is also problematic. A series of knock-in/knock-out (KIKO) vectors was constructed for integration of large DNA sequences onto the E. coli chromosome at well-defined loci. The KIKO plasmids target three nonessential genes/operons as insertion sites: arsB (an arsenite transporter); lacZ (β-galactosidase); and rbsA-rbsR (a ribose metabolism operon). Two homologous 'arms' target each insertion locus; insertion is mediated by λ Red recombinase through these arms. Between the arms is a multiple cloning site for the introduction of exogenous sequences and an antibiotic resistance marker (either chloramphenicol or kanamycin) for selection of positive recombinants. The resistance marker can subsequently be removed by flippase-mediated recombination. The insertion cassette is flanked by hairpin loops to isolate it from the effects of external transcription at the integration locus. To characterize each target locus, a xylanase reporter gene (xynA) was integrated onto the chromosomes of E. coli strains W and K-12 using the KIKO vectors. Expression levels varied between loci, with the arsB locus consistently showing the highest level of expression. To demonstrate the simultaneous use of all three loci in one strain, xynA, green fluorescent protein (gfp) and a sucrose catabolic operon (cscAKB) were introduced into lacZ, arsB and rbsAR respectively, and shown to be functional. The KIKO plasmids are a useful tool for efficient integration of large DNA fragments (including multiple genes and pathways) into E. coli. Chromosomal insertion provides stable

  17. Understanding the Influence of Retention Basin on Tidal Dynamics in Tidal Estuaries

    Science.gov (United States)

    Kumar, Mohit; Schuttelaars, Henk; Roos, Pieter

    2014-05-01

    Both the tidal motion and suspended sediment concentration (SSC) in tidal embayments and estuaries are influenced by anthropogenic (e.g. deepening ) and natural changes. An example of such an estuary is the Ems estuary, situated on the border of the Netherlands and Germany. The mean tidal range towards the end of the Ems estuary has increased from 1.5m in the 1950s to more than 3m in the 1990s while the suspended concentration has increased by a factor 10. To possibly reduce these negative effects, the construction of retention basin(s) (RB) is considered. In this contribution, the influence of location and geometry of RBs on tidal dynamics and SSC is investigated. For this purpose, a three-dimensional semi-analytic idealized model is developed. This model is an extension of the model proposed by Winant (2007) to arbitrary domain and realistic bathymetry with partial slip boundary condition at the bottom. The sea surface elevation (SSE) is calculated numerically using a finite element method. Next, the three-dimensional velocities are calculated by combining the analytically calculated vertical profiles and the gradients of the SSE which are obtained numerically. Firstly, the influence of a RB on the tidal dynamics in an infinitely long, rectangular, frictionless estuary is considered. The SSE decreases when the RB is located between a node and a landward antinode, consistent with the work of Alebregtse et al. (2013). Secondly, an estuary of finite length is connected to a sea. By varying the width of the sea, not only the effect of the distance of the RB to the landward end plays a role, but also the distance to the open sea becomes important. Finally, we discuss the influence of a RB on the tidal motion and initial sediment transport, considering the Ems estuary with realistic bathymetry. Results show that the SSE at the landward end of the Ems estuary decreases for all locations of the RBs. This decrease is most pronounced for the RB which is closest to the end

  18. High-throughput, signature-tagged mutagenic approach to identify novel virulence factors of Yersinia pestis CO92 in a mouse model of infection.

    Science.gov (United States)

    Ponnusamy, Duraisamy; Fitts, Eric C; Sha, Jian; Erova, Tatiana E; Kozlova, Elena V; Kirtley, Michelle L; Tiner, Bethany L; Andersson, Jourdan A; Chopra, Ashok K

    2015-05-01

    The identification of new virulence factors in Yersinia pestis and understanding their molecular mechanisms during an infection process are necessary in designing a better vaccine or to formulate an appropriate therapeutic intervention. By using a high-throughput, signature-tagged mutagenic approach, we created 5,088 mutants of Y. pestis strain CO92 and screened them in a mouse model of pneumonic plague at a dose equivalent to 5 50% lethal doses (LD50) of wild-type (WT) CO92. From this screen, we obtained 118 clones showing impairment in disseminating to the spleen, based on hybridization of input versus output DNA from mutant pools with 53 unique signature tags. In the subsequent screen, 20/118 mutants exhibited attenuation at 8 LD50 when tested in a mouse model of bubonic plague, with infection by 10/20 of the aforementioned mutants resulting in 40% or higher survival rates at an infectious dose of 40 LD50. Upon sequencing, six of the attenuated mutants were found to carry interruptions in genes encoding hypothetical proteins or proteins with putative functions. Mutants with in-frame deletion mutations of two of the genes identified from the screen, namely, rbsA, which codes for a putative sugar transport system ATP-binding protein, and vasK, a component of the type VI secretion system, were also found to exhibit some attenuation at 11 or 12 LD50 in a mouse model of pneumonic plague. Likewise, among the remaining 18 signature-tagged mutants, 9 were also attenuated (40 to 100%) at 12 LD50 in a pneumonic plague mouse model. Previously, we found that deleting genes encoding Braun lipoprotein (Lpp) and acyltransferase (MsbB), the latter of which modifies lipopolysaccharide function, reduced the virulence of Y. pestis CO92 in mouse models of bubonic and pneumonic plague. Deletion of rbsA and vasK genes from either the Δlpp single or the Δlpp ΔmsbB double mutant augmented the attenuation to provide 90 to 100% survivability to mice in a pneumonic plague model at 20

  19. Imaging of brain TSPO expression in a mouse model of amyotrophic lateral sclerosis with {sup 18}F-DPA-714 and micro-PET/CT

    Energy Technology Data Exchange (ETDEWEB)

    Gargiulo, S.; Gramanzini, M. [National Research Council, Institute of Biostructure and Bioimaging, Naples (Italy); Ceinge Biotecnologie Avanzate s.c. a r.l., Naples (Italy); Anzilotti, S.; Salvatore, M. [IRCCS SDN, Naples (Italy); Coda, A.R.D.; Panico, M.; Zannetti, A.; Vicidomini, C.; Quarantelli, M.; Pappata, S. [National Research Council, Institute of Biostructure and Bioimaging, Naples (Italy); Greco, A.; Brunetti, A. [University ' ' Federico II' ' , Department of Advanced Biomedical Sciences, Naples (Italy); Ceinge Biotecnologie Avanzate s.c. a r.l., Naples (Italy); Vinciguerra, A.; Pignataro, G. [University ' ' Federico II' ' , Division of Pharmacology, Department of Neuroscience, Reproductive and Dentistry Sciences, School of Medicine, Naples (Italy); Dolle, F. [CEA, Institute for Biomedical Imaging, Orsay (France); Annunziato, L. [University ' ' Federico II' ' , Division of Pharmacology, Department of Neuroscience, Reproductive and Dentistry Sciences, School of Medicine, Naples (Italy); IRCCS SDN, Naples (Italy)

    2016-07-15

    To evaluate the feasibility and sensitivity of {sup 18}F-DPA-714 for the study of microglial activation in the brain and spinal cord of transgenic SOD1{sup G93A} mice using high-resolution PET/CT and to evaluate the Iba1 and TSPO expression with immunohistochemistry. Nine symptomatic SOD1{sup G93A} mice (aged 117 ± 12.7 days, clinical score range 1 - 4) and five WT SOD1 control mice (aged 108 ± 28.5 days) underwent {sup 18}F-DPA-714 PET/CT. SUV ratios were calculated by normalizing the cerebellar (rCRB), brainstem (rBS), motor cortex (rMCX) and cervical spinal cord (rCSC) activities to that of the frontal association cortex. Two WT SOD1 and six symptomatic SOD1{sup G93A} mice were studied by immunohistochemistry. In the symptomatic SOD1{sup G93A} mice, rCRB, rBS and rCSC were increased as compared to the values in WT SOD1 mice, with a statistically significantly difference in rBS (2.340 ± 0.784 vs 1.576 ± 0.287, p = 0.014). Immunofluorescence studies showed that TSPO expression was increased in the trigeminal, facial, ambiguus and hypoglossal nuclei, as well as in the spinal cord, of symptomatic SOD1{sup G93A} mice and was colocalized with increased Iba1 staining. Increased {sup 18}F-DPA-714 uptake can be detected with high-resolution PET/CT in the brainstem of transgenic SOD1{sup G93A} mice, a region known to be a site of degeneration and increased microglial activation in amyotrophic lateral sclerosis, in agreement with increased TSPO expression in the brainstem nuclei shown by immunostaining. Therefore, {sup 18}F-DPA-714 PET/CT might be a suitable tool to evaluate microglial activation in the SOD1{sup G93A} mouse model. (orig.)

  20. Study of the oxidation resistance of ZrxNand ZrxSi1-xN thin films deposited by reactive magnetron sputtering; Estudo da resistencia a oxidacao de filmes finos de ZrxN e ZrxSi1-xN depositados por magnetron sputtering reativo

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, D.R.; Freitas, F.G.R.; Felix, L.C.; Carvalho, R.G.; Fontes Junior, A.S.; Tentardini, E.K., E-mail: daniel.angel0275@gmail.com [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Silva Junior, H. da [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil)

    2016-07-01

    The objective of this work is to evaluate the oxidation resistance on pure zirconium nitride thin films and with silicon addition (ZrN and ZrSiN respectively). The thin films deposition were performed using reactive magnetron sputtering. The coatings were characterized by Rutherford Backscattering Spectroscopy (RBS), grazing angle X ray diffraction (GAXRD), scanning electronic microscopy (SEM-FEG) and oxidation tests starting from 500°C to 700°C. This study evaluated thin films with silicon content up to 14,9 at.%. GAXRD results showed only ZrN characteristics peaks, which allow the inference that Si3N4 has an amorphous structure. Oxidation tests demonstrate that the film with highest silicon content shows an increase of 200°C in oxidation temperature when compared with ZrN pure thin film. (author)

  1. Conductance switching in Ag(2)S devices fabricated by in situ sulfurization.

    Science.gov (United States)

    Morales-Masis, M; van der Molen, S J; Fu, W T; Hesselberth, M B; van Ruitenbeek, J M

    2009-03-04

    We report a simple and reproducible method to fabricate switchable Ag(2)S devices. The alpha-Ag(2)S thin films are produced by a sulfurization process after silver deposition on an Si substrate. Structure and composition of the Ag(2)S are characterized using XRD and RBS. Our samples show semiconductor behaviour at low bias voltages, whereas they exhibit reproducible bipolar resistance switching at higher bias voltages. The transition between both types of behaviour is observed by hysteresis in the I-V curves, indicating decomposition of the Ag(2)S, increasing the Ag(+) ion mobility. The as-fabricated Ag(2)S samples are a good candidate for future solid state memory devices, as they show reproducible memory resistive properties and they are fabricated by an accessible and reliable method.

  2. Rutherford backscattering investigation of the corrosion of borosilicate glass

    International Nuclear Information System (INIS)

    Sales, B.C.; Boatner, L.A.; Naramoto, H.; White, C.W.

    1981-10-01

    The RBS spectra from Frit 21 borosilicate glasses doped with 5 wt % UO 2 , SrO, or Cs 2 O show that: during the initial stages of leaching (0 to 3 h) there is a substantial (300 to 500%) enhancement in the concentration of U, Sr, Ca, and Ti in the outer surface layer and that this enhancement is accompanied by a large depletion of Na, Si, and Cs; and upon further leaching under static conditions (24 h) the leached surface layer composition is indistinguishable from the unleached surface. Other borosilicate glasses such as PNL 76-68 may eventually show the same behavior if the final equilibrium pH value is greater than 9. The technique of Rutherford backscattering depth profile analysis can be a powerful tool for investigating the initial stages of glass corrosion

  3. Application of X-ray fluorescence (WDXRF): thickness and chemical composition determination of thin films

    International Nuclear Information System (INIS)

    Scapin, Valdirene de Oliveira.

    2004-01-01

    In this work a procedure is described for thickness and quantitative chemical composition of thin films by wavelength dispersion X-ray fluorescence (WDXRF) using Fundamental Parameters method. This method was validated according to quality assurance standard and applied sample Al, Cr, TiO2, Ni, ZrO2 (single thickness) and Ni/Cr (double thickness) on glass; Ni on steel and metallic zinc and TiO2 on metallic iron (single thickness), all the sample were prepared for physical deposition of vapor (PVD). The thickness had been compared with Absorption (FRX-A) and Rutherford Backscattering Spectrometry (RBS) methods; the result showed good efficiency of the fundamental parameters method. Sample structural characteristics analyzed by X ray diffraction (XRD) showed any influence in the thickness determinations. (author)

  4. Encapsulated Silicon Nanocrystals Formed in Silica by Ion Beam Synthesis

    International Nuclear Information System (INIS)

    Choi, Han Woo; Woo, Hyung Joo; Kim, Joon Kon; Kim, Gi Dong; Hong, Wan; Ji, Young Yong

    2004-01-01

    The photoluminescence (PL) emission of Si nanocrystals synthesized by 400 keV Si ion implanted in SiO 2 is studied as a function of ion dose and annealing time. The formation of nanocrystals at around 600 nm from the surface was confirmed by RBS and HRTEM, and the Si nanocrystals showed a wide and very intense PL emission at 700-900 nm. The intensity of this emission showed a typical behaviour with a fast transitory increase to reach a saturation with the annealing time, however, the red shift increased continuously because of the Ostwald ripening. The oversaturation of dose derived a decrease of PL intensity because of the diminishment of quantum confinement. A strong enhancement of PL intensity by H passivation was confirmed also, and the possible mechanism is discussed

  5. Conductance switching in Ag2S devices fabricated by in situ sulfurization

    International Nuclear Information System (INIS)

    Morales-Masis, M; Molen, S J van der; Hesselberth, M B; Ruitenbeek, J M van; Fu, W T

    2009-01-01

    We report a simple and reproducible method to fabricate switchable Ag 2 S devices. The α-Ag 2 S thin films are produced by a sulfurization process after silver deposition on an Si substrate. Structure and composition of the Ag 2 S are characterized using XRD and RBS. Our samples show semiconductor behaviour at low bias voltages, whereas they exhibit reproducible bipolar resistance switching at higher bias voltages. The transition between both types of behaviour is observed by hysteresis in the I-V curves, indicating decomposition of the Ag 2 S, increasing the Ag + ion mobility. The as-fabricated Ag 2 S samples are a good candidate for future solid state memory devices, as they show reproducible memory resistive properties and they are fabricated by an accessible and reliable method.

  6. Conductance switching in Ag{sub 2}S devices fabricated by in situ sulfurization

    Energy Technology Data Exchange (ETDEWEB)

    Morales-Masis, M; Molen, S J van der; Hesselberth, M B; Ruitenbeek, J M van [Kamerlingh Onnes Laboratorium, Universiteit Leiden, PO Box 9504, 2300 RA Leiden (Netherlands); Fu, W T [Leiden Institute of Chemistry, Gorlaeus Laboratorium, Universiteit Leiden, PO Box 9502, 2300 RA Leiden (Netherlands)], E-mail: ruitenbeek@physics.leidenuniv.nl

    2009-03-04

    We report a simple and reproducible method to fabricate switchable Ag{sub 2}S devices. The {alpha}-Ag{sub 2}S thin films are produced by a sulfurization process after silver deposition on an Si substrate. Structure and composition of the Ag{sub 2}S are characterized using XRD and RBS. Our samples show semiconductor behaviour at low bias voltages, whereas they exhibit reproducible bipolar resistance switching at higher bias voltages. The transition between both types of behaviour is observed by hysteresis in the I-V curves, indicating decomposition of the Ag{sub 2}S, increasing the Ag{sup +} ion mobility. The as-fabricated Ag{sub 2}S samples are a good candidate for future solid state memory devices, as they show reproducible memory resistive properties and they are fabricated by an accessible and reliable method.

  7. Characterization of the plastic substrates, the reflective layers, the adhesives, and the grooves of today's archival-grade recordable DVDs

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Guilin; Rivera, Felipe; Kanyal, Supriya S.; Davis, Robert C.; Vanfleet, Richard; Lunt, Barry M.; Shutthanandan, V.; Linford, Matthew R.

    2011-01-01

    The plastic substrates, reflective layers, dyes, and adhesives of four archival-grade DVDs and one standard-grade recordable DVD were analyzed to determine their chemical compositions and/or physical dimensions. Chemical analyses by ATR-FTIR, ToF-SIMS, XPS, EDX/STEM, and RBS show that all these DVDs use very similar polycarbonate plastic substrates and acrylate-based adhesives, but different reflective layers and dye write layers. In addition, physical measurements by AFM show differences in the DVD groove depth, width, and other dimensions. These chemical and physical analyses may help explain variations in DVD lifetimes and facilitate development of the next generation of archival-grade DVDs.

  8. Optical and Structural Properties of Multi-wall-carbon-nanotube-modified ZnO Synthesized at Varying Substrate Temperatures for Highly Efficient Light Sensing Devices

    Directory of Open Access Journals (Sweden)

    Valentine Saasa

    2015-12-01

    Full Text Available Structural, optical and light detection properties on carbon-nanotube-modified ZnO thin films grown at various temperatures from room to 1173 K are investigated. The optical band gap values calculated from reflectivity data show a hump at a critical temperature range of 873-1073 K. Similar trends in surface roughness as well as crystallite size of the films are observed. These changes have been attributed to structural change from wurzite hexagonal to cubic carbon modified ZnO as also validated by x-ray diffraction, RBS and PIXE of these layers. UV and visible light detection properties show similar trends. It is demonstrated that the present films can sense both UV and visible light to a maximum response efficiency of 66 % which is much higher than the last reported efficiency 10 %. This high response is given predominantly by cubic crystallite rather than the wurzite hexagonal composites.

  9. Ferroelectric thin films using oxides as raw materials

    Directory of Open Access Journals (Sweden)

    E.B. Araújo

    1999-01-01

    Full Text Available This work describes an alternative method for the preparation of ferroelectric thin films based on pre-calcination of oxides, to be used as precursor material for a solution preparation. In order to show the viability of the proposed method, PbZr0.53Ti0.47O3 and Bi4Ti3O12 thin films were prepared on fused quartz and Si substrates. The results were analyzed by X-ray Diffraction (XRD, Scanning Electron Microscopy (SEM, Infrared Spectroscopy (IR and Rutherford Backscattering Spectroscopy (RBS. The films obtained show good quality, homogeneity and the desired stoichiometry. The estimated thickness for one layer deposition was approximately 1000 Å and 1500 Å for Bi4Ti3O12 and PbZr0.53Ti0.47O3 films, respectively.

  10. Structural characterization of chemically deposited PbS thin films

    International Nuclear Information System (INIS)

    Fernandez-Lima, F.A.; Gonzalez-Alfaro, Y.; Larramendi, E.M.; Fonseca Filho, H.D.; Maia da Costa, M.E.H.; Freire, F.L.; Prioli, R.; Avillez, R.R. de; Silveira, E.F. da; Calzadilla, O.; Melo, O. de; Pedrero, E.; Hernandez, E.

    2007-01-01

    Polycrystalline thin films of lead sulfide (PbS) grown using substrate colloidal coating chemical bath depositions were characterized by RBS, XPS, AFM and GIXRD techniques. The films were grown on glass substrates previously coated with PbS colloidal particles in a polyvinyl alcohol solution. The PbS films obtained with the inclusion of the polymer showed non-oxygen-containing organic contamination. All samples maintained the Pb:S 1:1 stoichiometry throughout the film. The amount of effective nucleation centers and the mean grain size have being controlled by the substrate colloidal coating. The analysis of the polycrystalline PbS films showed that a preferable (1 0 0) lattice plane orientation parallel to the substrate surface can be obtained using a substrate colloidal coating chemical bath deposition, and the orientation increases when a layer of colloid is initially dried on the substrate

  11. Comparison of wet brewers' grains or dried distillers' grains as supplements to conserved bermudagrass forage as winter feeding options for beef cows.

    Science.gov (United States)

    Thomas, M V; Hersom, M J; Thrift, T A; Yelich, J V

    2017-01-01

    The objective of this study was to examine the use of 2 byproduct supplements and conserved warm-season forage as winter feeding options for primiparous beef cows. Gestating Angus ( = 48) and Brangus ( = 24) 2-yr-old cows were stratified by BW and breed to 1 of 12 pens. Pens were randomly assigned 1 of 2 supplements, wet brewers' grains (WBG) or dried distillers' grains (DDG). Coastal bermudagrass hay or round bale silage (RBS) was fed free choice (6 pens each) and cows received WBG or DDG supplements at a daily rate of 0.05% BW (DM basis) prorated for feeding 3 d/wk. Total BW and BCS changes did not differ ( = 0.65 and = 0.93, respectively) between DDG- and WBG-supplemented cows. Total amount of forage DM offered and mean calculated daily forage DM offered did not differ ( = 0.59 and = 0.20, respectively) between supplement treatments. Estimated daily mean and total supplement DM offered was greater ( forage sources were used in an unbalanced 6 × 4 design to measure intake, digestibility, and rumen parameters in ruminally fistulated steers. Supplement did not affect forage DMI of hay ( = 0.31) or RBS ( = 0.63). Total DMI was not different ( = 0.37 and = 0.73) for hay-based and RBS-based diets, respectively. Total tract digestibility tended to be greater ( = 0.06) for DDG than for WBG in hay diets but was not different ( = 0.76) for RBS diets. Daily mean ruminal pH was greater ( = 0.03) for WBG than for DDG when supplemented to hay-based diets. In RBS diets, a supplement × hour interaction ( = 0.05) existed for ruminal pH. Daily mean ruminal ammonia N concentration was greater ( forage. High-moisture forage sources can be coupled with high-moisture byproduct supplements.

  12. Development of an environmentally friendly protective coating for the depleted uranium-0.75 wt% titanium alloy

    International Nuclear Information System (INIS)

    Roeper, Donald F.; Chidambaram, Devicharan; Clayton, Clive R.; Halada, Gary P.; Derek Demaree, J.

    2006-01-01

    Molybdenum oxide-based conversion coatings have been formed on the surface of the depleted uranium-0.75 wt% titanium alloy using either concentrated nitric acid or fluorides for surface activation prior to coating formation. The acid-activated surface forms a coating that offers corrosion protection after a period of aging, when uranium species have migrated to the surface. X-ray photoelectron spectroscopy (XPS) revealed that the protective coating is primarily a polymolybdate bound to a uranyl ion. Rutherford backscattering spectroscopy (RBS) on the acid-activated coatings also shows uranium dioxide migrating to the surface. The fluoride-activated surface does not form a protective coating and there are no uranium species on the surface as indicated by XPS. The coating on the fluoride-activated samples has been found to contain a mixture of molybdenum oxides of which the main component is molybdenum trioxide and a minor component of an Mo(V) oxide

  13. Study of Cluster-size Effect on Damage Formation

    International Nuclear Information System (INIS)

    Aoki, Takaaki; Seki, Toshio; Nakai, Atsuko; Matsuo, Jiro; Takaoka, Gikan

    2003-01-01

    Computer simulation and experiments were performed in order to understand the effect of cluster size on damage formation. Results of molecular dynamics simulations of cluster impact on solid targets derived the model function, which explains the relationship among cluster size, incident energy and number of displacements. On the other hand, time of flight mass measurement system was installed a cluster irradiation system, so that cluster ion beam which cluster size distribution is well known can be irradiated on the target. The damage properties under various cluster irradiation conditions were examined using RBS. The results from computer simulations and experiments showed good agreements with each other, which suggests that irradiation damage by cluster ion beam can be controlled by selecting cluster size distribution and incident energy

  14. Room temperature and thermal decomposition of magnesium hydride/deuteride thin films

    Energy Technology Data Exchange (ETDEWEB)

    Ares, J.R.; Leardini, F.; Bodega, J.; Macia, M.D.; Diaz-Chao, P.; Ferrer, I.J.; Fernandez, J.F.; Sanchez, C. [Universidad Autonoma de Madrid (Spain). Lab. de Materiales de Interes en Energias Renovables

    2010-07-01

    Magnesium hydride (MgH{sub 2}) can be considered an interesting material to store hydrogen as long as two main drawbacks were solved: (i) its high stability and (ii) slow (de)hydriding kinetics. In that context, magnesium hydride films are an excellent model system to investigate the influence of structure, morphology and dimensionality on kinetic and thermodynamic properties. In the present work, we show that desorption mechanism of Pd-capped MgH{sub 2} at room temperature is controlled by a bidimensional interphase mechanism and a similar rate step limiting mechanism is observed during thermal decomposition of MgH{sub 2}. This mechanism is different to that occurring in bulk MgH{sub 2} (nucleation and growth) and obtained activation energies are lower than those reported in bulk MgH{sub 2}. We also investigated the Pd-capping properties upon H-absorption/desorption by means of RBS and isotope experiments. (orig.)

  15. Rutherford back-scattering and X-ray fluorescence for the study of corroded surfaces

    International Nuclear Information System (INIS)

    Chaudhri, M. Anwar

    2010-01-01

    A combination of Rutherford-Back-Scattering (RBS) and X-Ray Fluorescence Analysis (XRF) has been used to study the corroded inside surfaces of some tooth-paste tubes, which were causing a significant loss of the product. This greyish-brown, thin, corrosion layer on the inside of the tooth-paste tube is easily distinguishable from brand new, as well as from non-corroded used tubes, which are made of 99.7 % Al. The unused clean aluminium tube shows some copper traces (about 0.3 mg/cm 2 ) on the surface, which almost disappears from the surface of the non-corroded used tube but reappears, to a lesser extent, on the surface of the corroded tube. The corroded layer has been found to consist mainly of P and Ca (about 1 mg/cm 2 each) with smaller quantities of Na, Mg, Si, S and Cl. (authors)

  16. Ion beam analysis of ground coffee and roasted coffee beans

    International Nuclear Information System (INIS)

    Debastiani, R.; Santos, C.E.I. dos; Yoneama, M.L.; Amaral, L.; Dias, J.F.

    2014-01-01

    The way that coffee is prepared (using roasted ground coffee or roasted coffee beans) may influence the quality of beverage. Therefore, the aim of this work is to use ion beam techniques to perform a full elemental analysis of packed roasted ground coffee and packed roasted coffee beans, as well as green coffee beans. The samples were analyzed by PIXE (particle-induced X-ray emission). Light elements were measured through RBS (Rutherford backscattering spectrometry) experiments. Micro-PIXE experiments were carried out in order to check the elemental distribution in the roasted and green coffee beans. In general, the elements found in ground coffee were Mg, P, S, Cl, K, Ca, Ti, Mn, Fe, Cu, Zn, Rb and Sr. A comparison between ground coffee and grinded roasted beans shows significant differences for several elements. Elemental maps reveal that P and K are correlated and practically homogeneously distributed over the beans

  17. Yttrium implantation and addition element effects on the oxidation behaviour of reference steels at 973 K

    Energy Technology Data Exchange (ETDEWEB)

    Caudron, E.; Buscail, H.; Cueff, R.; Issartel, C.; El Messki, S.; Perrier, S.; Riffard, F. [Lab. Vellave d' Elaboration et d' Etude des Materiaux, Univ. Blaise Pascal Clermont-Fd 2, Le Puy en Velay (France)

    2004-07-01

    Yttrium implantation effects on reference steels (extra low carbon and low manganese steel) were studied by rutherford backscattering spectrometry (RBS), reflection high energy electron diffraction (RHEED), X-ray diffraction (XRD) and glancing angle X-ray diffraction (GAXRD). Thermogravimetry and in situ X-ray diffraction at 700 C and P{sub O2}=0.04 Pa for 24h were used to determine the yttrium implantation and addition element effects on sample oxidation resistance at high temperatures. This study clearly shows that yttrium implantation and subsequent high temperature oxidation induced the formation of several yttrium mixed oxides which closely depend on the reference steel addition elements. Moreover, these yttrium mixed oxides seem to be responsible for the improved reference steel oxidation resistance at high temperatures. (orig.)

  18. Nano Indentation Inspection of the Mechanical Properties of Gold Nitride Thin Films

    Directory of Open Access Journals (Sweden)

    Armen Verdyan

    2007-10-01

    Full Text Available The morphology and the local mechanical properties of gold nitride thin films were studied by atomic force microscope (AFM. Gold nitride films were deposited for the first time on silicon substrate without any buffer layer at room temperature by reactive pulsed laser ablation deposition (RPLD. The films were fabricated on (100 Si wafers by RPLD technique in which KrF excimer laser was used to ablate a gold target in N2 atmosphere (0.1 GPa-100 Pa and ambient temperature. Scanning electron microscopy (SEM and atomic force microscopy inspections showed that the films were flat plane with rms roughness in the range of 35.1 nm-3.6 nm, depending on the deposition pressure. Rutherford backscattering spectrometry (RBS and energy dispersion spectroscopy (EDS used to detect the nitrogen concentration in the films, have revealed a composition close to Au3N. The film

  19. Fabrication of hydroxyapatite thin films for biomedical applications using RF magnetron sputtering

    International Nuclear Information System (INIS)

    Yamaguchi, Tetsuro; Tanaka, Yoshikazu; Ide-Ektessabi, Ari

    2006-01-01

    The calcium phosphate thin films for medical applications require similar chemical properties as those of natural bone as well as a uniform surface without any defect, such as cracks and pinholes. In this study, the calcium phosphate thin films were fabricated using RF magnetron sputtering deposition technique at discharge power of 200W, 300W and 400W. The target used for the deposition was sintered HAp. RBS analysis showed that the Ca/P ratio increased with the discharge power becoming close to that of Ca/P=1.67 in ideal HAp. XPS analysis revealed the presence of PO 4 3- and OH - bonds in the calcium phosphate films fabricated. The chemical properties of the calcium phosphate thin films were similar to those of ideal HAp. The AFM results revealed that the thin films prepared had a uniform surface

  20. Bloodcompatibility improvement of titanium oxide film modified by phosphorus ion implantation

    International Nuclear Information System (INIS)

    Yang, P.; Leng, Y.X.; Zhao, A.S.; Zhou, H.F.; Xu, L.X.; Hong, S.; Huang, N.

    2006-01-01

    Our recent investigation suggested that Ti-O thin film could be a newly developed antithrombotic material and its thromboresistance could be related to its physical properties of wide gap semiconductor. In this work, titanium oxide film was modified by phosphorus ion implantation and succeeding vacuum annealing. RBS were used to investigate phosphorus distribution profile. Contact angle test results show that phosphorus-doped titanium oxide film becomes more hydrophilic after higher temperature annealing, while its electric conductivity increases. Antithrombotic property of phosphorus-doped titanium oxide thin films was examined by clotting time and platelet adhesion tests. The results suggest that phosphorus doping is an effective way to improve the bloodcompatibility of titanium oxide film, and it is related to the changes of electron structure and surface properties caused by phosphorus doping

  1. Nuclear microbeam study of advanced materials for fusion reactor technology

    International Nuclear Information System (INIS)

    Alves, L.C.; Alves, E.; Grime, G.W.; Silva, M.F. da; Soares, J.C.

    1999-01-01

    The Oxford scanning proton microprobe was used to study SiC fibres, SiC/SiC ceramic composites and Be pebbles, which are some of the most important materials for fusion technology. For the SiC materials, although the results reveal a high degree of homogeneity and purity in the composition of the fibres, some grains containing heavy metals were detected in the composites. Rutherford backscattering analysis further allowed establishing that at least some of these grains are not on the surface of the material but rather distributed throughout the bulk of the SiC composites. The two different types of Be pebbles analysed also showed very different levels of contaminants. The information obtained with the microbeam analysis is confronted with the one resulting from the broad beam PIXE and RBS analysis

  2. Impact of thermal treatment on the optical performance of InGaN/GaN light emitting diodes

    Science.gov (United States)

    Meneghini, Matteo; Zhu, Dandan; Humphreys, Colin J.; Berti, Marina; Gasparotto, Andrea; Cesca, Tiziana; Vinattieri, Anna; Bogani, Franco; Meneghesso, Gaudenzio; Zanoni, Enrico

    2015-10-01

    This paper describes a detailed analysis of the effects of high temperatures on the optical performance and structural characteristics of GaN-based LED structures with a high threading dislocation density. Results show that, as a consequence of storage at 900 °C in N2 atmosphere, the samples exhibit: (i) an increase in the efficiency of GaN and quantum-well luminescence, well correlated to an increase in carrier lifetime; (ii) a decrease in the parasitic luminescence peaks related to Mg acceptors, which is correlated to the reduction in the concentration of Mg in the p-type region, detected by Secondary Ion Mass Spectroscopy (SIMS); (iii) a diffusion of acceptor (Mg) atoms to the quantum well region; (iv) a reduction in the yield of Rutherford Backscattering Spectrometry (RBS)-channeling measurements, possibly due to a partial re-arrangement of the dislocations, which is supposed to be correlated to the increase in radiative efficiency (see (i)).

  3. Zirconium nitride hard coatings

    International Nuclear Information System (INIS)

    Roman, Daiane; Amorim, Cintia Lugnani Gomes de; Soares, Gabriel Vieira; Figueroa, Carlos Alejandro; Baumvol, Israel Jacob Rabin; Basso, Rodrigo Leonardo de Oliveira

    2010-01-01

    Zirconium nitride (ZrN) nanometric films were deposited onto different substrates, in order to study the surface crystalline microstructure and also to investigate the electrochemical behavior to obtain a better composition that minimizes corrosion reactions. The coatings were produced by physical vapor deposition (PVD). The influence of the nitrogen partial pressure, deposition time and temperature over the surface properties was studied. Rutherford backscattering spectrometry (RBS), X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD), scanning electron microscopy (SEM) and corrosion experiments were performed to characterize the ZrN hard coatings. The ZrN films properties and microstructure changes according to the deposition parameters. The corrosion resistance increases with temperature used in the films deposition. Corrosion tests show that ZrN coating deposited by PVD onto titanium substrate can improve the corrosion resistance. (author)

  4. Ageing effects on the wettability behavior of laser textured silicon

    International Nuclear Information System (INIS)

    Nunes, B.; Serro, A.P.; Oliveira, V.; Montemor, M.F.; Alves, E.; Saramago, B.; Colaco, R.

    2011-01-01

    In the present work we investigate the ageing of acid cleaned femtosecond laser textured silicon surfaces. Changes in the surface structure and chemistry were analysed by Rutherford backscattering spectrometry (RBS) and X-ray photoelectron spectroscopy (XPS), in order to explain the variation with time of the water contact angles of the laser textured surfaces. It is shown that highly hydrophobic silicon surfaces are obtained immediately after laser texturing and cleaning with acid solutions (water contact angle > 120 o ). However these surfaces are not stable and ageing leads to a decrease of the water contact angle which reaches a value of 80 o . XPS analysis of the surfaces shows that the growth of the native oxide layer is most probably responsible for this behavior.

  5. Ion beam analysis of ground coffee and roasted coffee beans

    Energy Technology Data Exchange (ETDEWEB)

    Debastiani, R., E-mail: rafa_debas@yahoo.com.br; Santos, C.E.I. dos; Yoneama, M.L.; Amaral, L.; Dias, J.F.

    2014-01-01

    The way that coffee is prepared (using roasted ground coffee or roasted coffee beans) may influence the quality of beverage. Therefore, the aim of this work is to use ion beam techniques to perform a full elemental analysis of packed roasted ground coffee and packed roasted coffee beans, as well as green coffee beans. The samples were analyzed by PIXE (particle-induced X-ray emission). Light elements were measured through RBS (Rutherford backscattering spectrometry) experiments. Micro-PIXE experiments were carried out in order to check the elemental distribution in the roasted and green coffee beans. In general, the elements found in ground coffee were Mg, P, S, Cl, K, Ca, Ti, Mn, Fe, Cu, Zn, Rb and Sr. A comparison between ground coffee and grinded roasted beans shows significant differences for several elements. Elemental maps reveal that P and K are correlated and practically homogeneously distributed over the beans.

  6. Control of discharge conditions to reduce hydrogen content in low Z films produced with DC glow

    International Nuclear Information System (INIS)

    Natsir, M.; Sagara, A.; Tsuzuki, K.; Tsuchiya, B.; Hasegawa, Y.; Motojima, O.

    1995-09-01

    Boronization at near room temperature has been performed in plasma processing teststand (PPT) by using a 5 % diborane gases B 2 H 6 in He on electrically floating or unfloating Al samples under various conditions on DC glow discharge power or total gas pressure. The hydrogen concentration was analyzed by using elastic recoil detection method (ERD) and a new modified normalizing technique with Rutherford back scattering (RBS). Results showed that a high growth rate of film formation and floating surface were effective in reducing hydrogen concentration in B films. This result was in good agreement with earlier measurements of H with flash filament (FF) desorption method. In particular the H/B ratio was reduced by decreasing ions but increasing radicals for B film formation. (author)

  7. Palladium-based electrocatalysts for ethanol oxidation reaction in DEFC; Eletrocatalisadores de paladio para reacao de oxidacao do etanol em DEFC

    Energy Technology Data Exchange (ETDEWEB)

    Moraes, L.P.R. de; Elsheikh, A.; Silva, E. L. da; Radtke, C.; Amico, S.C.; Malfatti, C.F., E-mail: leticiaprm@gmail.com [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil)

    2014-07-01

    Direct ethanol fuel cells require the use of electrocatalysts to promote bond cleavage of the ethanol molecule in an efficient way. Currently, most electrocatalysts contain platinum, which enables improved catalytic activity and stability in acidic media. However platinum presents high cost and low availability. Based on that, novel catalysts have been developed, such as those based on palladium and its alloys, which have attained excellent results in the oxidation of ethanol in alkaline media. In this work, Pd, PdSn and PdNiSn catalysts supported on Vulcan XC72R carbon were synthesized via impregnation/reduction. The electrocatalysts were characterized by RBS, XRD and cyclic voltammetry. The X-ray diffraction results showed the formation of an alloy and not the deposition of isolated elements. The synthesized catalysts displayed good catalytic activity, as observed by cyclic voltammetry, being the best electrochemical performance achieved by the ternary alloy. (author)

  8. Palladium-based electrocatalysts for ethanol oxidation reaction in DEFC

    International Nuclear Information System (INIS)

    Moraes, L.P.R. de; Elsheikh, A.; Silva, E. L. da; Radtke, C.; Amico, S.C.; Malfatti, C.F.

    2014-01-01

    Direct ethanol fuel cells require the use of electrocatalysts to promote bond cleavage of the ethanol molecule in an efficient way. Currently, most electrocatalysts contain platinum, which enables improved catalytic activity and stability in acidic media. However platinum presents high cost and low availability. Based on that, novel catalysts have been developed, such as those based on palladium and its alloys, which have attained excellent results in the oxidation of ethanol in alkaline media. In this work, Pd, PdSn and PdNiSn catalysts supported on Vulcan XC72R carbon were synthesized via impregnation/reduction. The electrocatalysts were characterized by RBS, XRD and cyclic voltammetry. The X-ray diffraction results showed the formation of an alloy and not the deposition of isolated elements. The synthesized catalysts displayed good catalytic activity, as observed by cyclic voltammetry, being the best electrochemical performance achieved by the ternary alloy. (author)

  9. Vacancy supersaturations produced by high-energy ion implantation

    International Nuclear Information System (INIS)

    Venezia, V.C.; Eaglesham, D.J.; Jacobson, D.C.; Gossmann, H.J.

    1998-01-01

    A new technique for detecting the vacancy clusters produced by high-energy ion implantation into silicon is proposed and tested. This technique takes advantage of the fact that metal impurities, such as Au, are gettered near one-half of the projected range (1/2 R p ) of MeV implants. The vacancy clustered region produced by a 2 MeV Si + implant into silicon has been labeled with Au diffused in from the front surface. The trapped Au was detected by Rutherford backscattering spectrometry (RBS) to profile the vacancy clusters. Cross section transmission electron microscopy (XTEM) analysis shows that the Au in the region of vacancy clusters is in the form of precipitates. By annealing MeV implanted samples prior to introduction of the Au, changes in the defect concentration within the vacancy clustered region were monitored as a function of annealing conditions

  10. Structural characterization of half-metallic Heusler compound NiMnSb

    Energy Technology Data Exchange (ETDEWEB)

    Nowicki, L. E-mail: lech.nowicki@fuw.edu.pl; Abdul-Kader, A.M.; Bach, P.; Schmidt, G.; Molenkamp, L.W.; Turos, A.; Karczewski, G

    2004-06-01

    High resolution X-ray diffraction (HRXRD) and Rutherford backscattering/channeling (RBS/c) techniques were used to characterize layers of NiMnSb grown by molecular beam epitaxy (MBE) on InP with a In{sub x}Ga{sub 1-x}As buffer. Angular scans in the channeling mode reveal that the crystal structure of NiMnSb is tetragonally deformed with c/a=1.010{+-}0.002, in agreement with HRXRD data. Although HRXRD demonstrates the good quality of the pseudomorphic NiMnSb layers the channeling studies show that about 20% of atoms in the layers do not occupy lattice sites in the [0 0 1] rows of NiMnSb. The possible mechanisms responsible for the observed disorder are discussed.

  11. Temperature dependence of ion-beam induced amorphization in α-quartz

    International Nuclear Information System (INIS)

    Dhar, Sankar; Bolse, Wolfgang; Lieb, Klaus-Peter

    1999-01-01

    The temperature dependence of the amorphization in α-quartz by Ne-ion bombardment has been investigated using Rutherford Backscattering Spectrometry in channeling geometry (RBS-C). The experimental results show that the critical temperature T c for inhibiting amorphization in quartz is around 940 K. The damage depth profile χ(z,phi) is independent of the temperature and fluence and can be simulated with a power-law function [χ(z,phi)∝(phiF D (z)) 3 ] of the damage energy distribution F D (z). At low irradiation temperature, the critical dose phi c for amorphization is independent of the temperature but it strongly increases at higher temperatures with an activation energy of 0.28 eV and has been explained by out-diffusion model of Morehead and Crowder

  12. Formation and characterization of nanoparticles formed by sequential ion implantation of Au and Co into SiO2

    International Nuclear Information System (INIS)

    Kluth, P.; Hoy, B.; Johannessen, B.; Dunn, S.G.; Foran, G.J.; Ridgway, M.C.

    2007-01-01

    Nanoparticles (NPs) were formed by sequential ion implantation of Au and Co into thin SiO 2 . After Au implantation and annealing, Co implantations were carried out at room temperature (RT) and 400 deg. C, respectively, with no subsequent annealing. The NPs were investigated by means of Rutherford backscattering spectroscopy (RBS), transmission electron microscopy (TEM) and extended X-ray absorption fine structure spectroscopy (EXAFS). TEM shows the formation of Co-Au core-shell NPs for the Co implantation at 400 deg. C. EXAFS measurements indicate significant strain in the NPs and a bond-length expansion of the Co-Co bonds in the NP core with a concomitant contraction of the Au-Au bonds in the Au shells. NPs are also observed by TEM for the Co implantation performed at RT, however, a lack of crystallinity is apparent from electron diffraction and EXAFS measurements

  13. Study of structural differences between stoichiometric and congruent lithium niobate

    CERN Document Server

    Kling, A; Correia, J G; Da Silva, M F A; Diéguez, E; Agulló-López, F; Soares, J C

    1996-01-01

    The structural differences between stoichiometric and congruent (lithium deficient) lithium niobate single crystals were studied by RBS- and NRA-channeling as well as perturbed angular correlation (PAC) measurements. The d-PAC111Cd-PAC investigations point out that a second Li site can be detected in congruent material, while only one is present in stoichiometric. Channeling studies of different axes and the comparison of the results with computer simulations corroborated former indications that this additional lattice site can be attributed to the formation of ilmenite type stacking faults. A comparative study of the energy dependence of the dechanneling showed that a remarkable disorder is also present in the Nb sublattice of the congruent crystals and that these defects have a point-like character.

  14. Structure, morphology and melting hysteresis of ion-implanted nanocrystals

    International Nuclear Information System (INIS)

    Andersen, H.H.; Johnson, E.

    1995-01-01

    Investigations of nanosized metal and semimetal inclusions produced by ion implantation in aluminium are reviewed. The inclusions are from 1 nm to 15 nm in size and contain from 80 to 100,000 atoms. Embedded crystallites, which are topotactically aligned with the surrounding matrix, may not be produced in this size range by any other method. The inclusions offer unique possibilities for study of the influence of interfaces on the crystal structure of the inclusions as well as on their melting and solidification behaviour. Studies are made with transmission electron microscopy (TEM), electron- and x-ray diffraction and in situ RBS- channeling measurements. Bi, Cd, In, Pb and Tl inclusions all show a substantial melting/solidification temperature hysteresis, which, in all cases except for Bi, is placed around the bulk melting temperature, while bismuth melts below that temperature. (au) 46 refs

  15. Characterization of silver colloids formed in LiBbO3 by Ag and O implantation at room and elevated temperatures

    International Nuclear Information System (INIS)

    Williams, E.K.; Ila, D.; Darwish, A.; Poker, D.B.; Sarkisov, S.S.; Curley, M.J.; Wang, J.-C.; Svetchnikov, V.L.; Zandbergen, H.W.

    1999-01-01

    To address the issue of dispersion of Ag colloids in LiNbO 3 at heat treatment temperatures of 400-500 deg. C, Ag and O were implanted at energies of 160 and 35 keV, respectively, at room temperature (Rt) and at 500 deg. C. Fluences were 4x10 16 and 8x10 16 /cm 2 and the order of the Ag and O implants was varied. Electron paramagnetic resonance spectra indicated that only O followed by Ag implantation of 500 deg. C produced silver oxide. Optical absorption spectrometry and RBS showed significant differences in the dispersion of the colloids with implant temperature and implant order. Implantation of Ag at 1.5 MeV to a fluence of 2x10 16 /cm 2 followed by heat treatment at 500 deg. C for 1 h produced nonlinear optical waveguides with a nonlinear index of the order of 10 -10 cm 2 /W at 532 nm

  16. Influence of the bismuth deficit on the structural and electric properties of the Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub y} thin films synthesized by molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Alami, H.El.; Rannou, I.; Deville Cavellin, C

    2004-07-15

    BiSrCaCuO thin films were grown on (1 0 0) SrTiO3 substrates by molecular beam epitaxy (MBE) with variation of the Bi deposition time. A new 2x212 family with x varied between 1 and 0 was grown. The X-ray study, the Rutherford back scattering (RBS), reflection high energy electron diffraction (RHEED) and atomic force microscopy (AFM) were used to characterize the films. It was shown that the growth method used leads to intergrowth nanostructures. The transport measurements of BiSrCaCuO thin films were performed. The results analysed using the theory of percolation show a 2D character of conductivity in the films studied.

  17. Enhancement of oxidation resistance in Cu and Cu(Al) thin layers

    Energy Technology Data Exchange (ETDEWEB)

    Horvath, Z.E.; Peto, G. E-mail: peto@mfa.kfki.hu; Paszti, Z.; Zsoldos, E.; Szilagyi, E.; Battistig, G.; Lohner, T.; Molnar, G.L.; Gyulai, J

    1999-01-02

    High conductivity and good resistance to electromigration makes copper a promising interconnect material in microelectronics. However, one of its disadvantages is the poor corrosion resistance. Two methods of passivation are investigated and compared: Al alloying and BF{sub 2}{sup +} ion implantation. X-ray diffraction (XRD) and Rutherford Backscattering Spectrometry (RBS) show the oxidation inhibition of both methods, but the different ratio of CuO{sub 2} to CuO phases suggests different mechanisms of passivation. There are no definite oxide lines in the XRD spectrum of the implanted and annealed Cu(Al) sample, so the presence of Al and the implantation together give increased protection against oxidation. The difference between the two mechanisms of oxidation inhibition is discussed briefly.

  18. Enhancement of oxidation resistance in Cu and Cu(Al) thin layers

    International Nuclear Information System (INIS)

    Horvath, Z.E.; Peto, G.; Paszti, Z.; Zsoldos, E.; Szilagyi, E.; Battistig, G.; Lohner, T.; Molnar, G.L.; Gyulai, J.

    1999-01-01

    High conductivity and good resistance to electromigration makes copper a promising interconnect material in microelectronics. However, one of its disadvantages is the poor corrosion resistance. Two methods of passivation are investigated and compared: Al alloying and BF 2 + ion implantation. X-ray diffraction (XRD) and Rutherford Backscattering Spectrometry (RBS) show the oxidation inhibition of both methods, but the different ratio of CuO 2 to CuO phases suggests different mechanisms of passivation. There are no definite oxide lines in the XRD spectrum of the implanted and annealed Cu(Al) sample, so the presence of Al and the implantation together give increased protection against oxidation. The difference between the two mechanisms of oxidation inhibition is discussed briefly

  19. The visigothic treasure of Torredonjimeno (Jaen, Spain): A study with IBA techniques

    International Nuclear Information System (INIS)

    Perea, A.; Climent-Font, A.; Fernandez-Jimenez, M.; Enguita, O.; Gutierrez, P.C.; Calusi, S.; Migliori, A.; Montero, I.

    2006-01-01

    The visigothic treasure of Torredonjimeno (Jaen, Spain) was found by chance in the year 1926 buried in an olive grove. The finding consisted of some hundreds fragments of gold objects and gems coming from several votive crowns and crosses, some of them belonging to an unidentified visigothic king. The treasure may belong chronologically to the same period as the Guarrazar treasure or, possibly, to a somewhat later time, but the pieces are fragmented and of less technological workmanship than the latter. This is the reason why the Torredonjimeno treasure has not attracted as much attention from archeologists and art historians as that from Guarrazar. On the occasion of an exhibition showing together all the objects of the treasure, it is normally kept in three different museums in Barcelona, Cordoba and Madrid, a number of pieces were analyzed, using PIXE, PIGE and RBS, at the external microbeam facility installed at the Center for Micro-Analysis of Materials

  20. Mg{sub 2}Sn heterostructures on Si(111) substrate

    Energy Technology Data Exchange (ETDEWEB)

    Dózsa, L., E-mail: dozsa@mfa.kfki.hu [Institute of Technical Physics and Materials Science, Centre for Energy Research, Hungarian Academy of Sciences, 1525 Budapest Pf, 49 (Hungary); Galkin, N.G. [Institute of Automation and Control Processes of FEB RAS, 5 Radio St., Vladivostok 690041 (Russian Federation); Far Eastern Federal University, 8 Sukhanova St., Vladivostok 690950 (Russian Federation); Pécz, B.; Osváth, Z.; Zolnai, Zs. [Institute of Technical Physics and Materials Science, Centre for Energy Research, Hungarian Academy of Sciences, 1525 Budapest Pf, 49 (Hungary); Németh, A. [Wigner Research Centre for Physics, Institute for Particle and Nuclear Physics, 1525 Budapest, P.O.B. 49 (Hungary); Galkin, K.N.; Chernev, I.M. [Institute of Automation and Control Processes of FEB RAS, 5 Radio St., Vladivostok 690041 (Russian Federation); Dotsenko, S.A. [Institute of Automation and Control Processes of FEB RAS, 5 Radio St., Vladivostok 690041 (Russian Federation); Far Eastern Federal University, 8 Sukhanova St., Vladivostok 690950 (Russian Federation)

    2017-05-31

    Highlights: • Investigations show that the nanostructures have significant changes during the applied regular experimental investigations. • It is especially true for transmittance electron microscopy, where the investigated layers have to be thinned near to the nanostructure size. • The time order of the applied experimental investigation has a dominant effect on the experimetal results. - Abstract: Thin un-doped and Al doped polycrystalline Mg-stannide films consisting mainly of Mg{sub 2}Sn semiconductor phase have been grown by deposition of Sn-Mg multilayers on Si(111) p-type wafers at room temperature and annealing at 150 °C. Rutherford backscattering measurement spectroscopy (RBS) were used to determine the amount of Mg and Sn in the structures. Raman spectroscopy has shown the layers contain Mg{sub 2}Sn phase. Cross sectional transmission electron microscopy (XTEM) measurements have identified Mg{sub 2}Sn nanocrystallites in hexagonal and cubic phases without epitaxial orientation with respect to the Si(111) substrate. Significant oxygen concentration was found in the layer both by RBS and TEM. The electrical measurements have shown laterally homogeneous conductivity in the grown layer. The undoped Mg{sub 2}Sn layers show increasing resistivity with increasing temperature indicating the scattering process dominates the resistance of the layers, i.e. large concentration of point defects was generated in the layer during the growth process. The Al doped layer shows increase of the resistance at low temperature caused by freeze out of free carriers in the Al doped Mg{sub 2}Sn layer. The measurements indicate the necessity of protective layer grown over the Mg{sub 2}Sn layers, and a short time delay between sample preparation and cross sectionalTEM analysis, since the unprotected layer is degraded by the interaction with the ambient.

  1. DC heating induced shape transformation of Ge structures on ultraclean Si(5 5 12) surfaces.

    Science.gov (United States)

    Dash, J K; Rath, A; Juluri, R R; Raman, P Santhana; Müller, K; Rosenauer, A; Satyam, P V

    2011-04-06

    We report the growth of Ge nanostructures and microstructures on ultraclean, high vicinal angle silicon surfaces and show that self-assembled growth at optimum thickness of the overlayer leads to interesting shape transformations, namely from nanoparticle to trapezoidal structures, at higher thickness values. Thin films of Ge of varying thickness from 3 to 12 ML were grown under ultrahigh vacuum conditions on a Si(5 5 12) substrate while keeping the substrate at a temperature of 600 °C. The substrate heating was achieved by two methods: (i) by heating a filament under the substrate (radiative heating, RH) and (ii) by passing direct current through the samples in three directions (perpendicular, parallel and at 45° to the (110) direction of the substrate). We find irregular, more spherical-like island structures under RH conditions. The shape transformations have been found under DC heating conditions and for Ge deposition more than 8 ML thick. The longer sides of the trapezoid structures are found to be along (110) irrespective of the DC current direction. We also show the absence of such a shape transformation in the case of Ge deposition on Si(111) substrates. Scanning transmission electron microscopy measurements suggested the mixing of Ge and Si. This has been confirmed with a quantitative estimation of the intermixing using Rutherford backscattering spectrometry (RBS) measurements. The role of DC heating in the formation of aligned structures is discussed. Although the RBS simulations show the presence of a possible SiO(x) layer, under the experimental conditions of the present study, the oxide layer would not play a role in determining the formation of the various structures that were reported here.

  2. Surface science analysis of GaAs photocathodes following sustained electron beam delivery

    Directory of Open Access Journals (Sweden)

    V. Shutthanandan

    2012-06-01

    Full Text Available Degradation of the photocathode materials employed in photoinjectors represents a challenge for sustained operation of nuclear physics accelerators and high power free electron lasers (FEL. Photocathode quantum efficiency degradation is due to residual gases in the electron source vacuum system being ionized and accelerated back to the photocathode. These investigations are a first attempt to characterize the nature of the photocathode degradation, and employ multiple surface and bulk analysis techniques to investigate damage mechanisms including sputtering of the Cs-oxidant surface monolayer, other surface chemistry effects, and ion implantation. Surface and bulk analysis studies were conducted on two GaAs photocathodes, which were removed from the JLab FEL DC photoemission gun after delivering electron beam, and two control samples. The analysis techniques include helium ion microscopy, Rutherford backscattering spectrometry (RBS, atomic force microscopy, and secondary ion mass spectrometry (SIMS. In addition, two high-polarization strained superlattice GaAs photocathode samples, one removed from the continuous electron beam accelerator facility (CEBAF photoinjector and one unused, were also analyzed using transmission electron microscopy (TEM and SIMS. It was found that heat cleaning the FEL GaAs wafer introduces surface roughness, which seems to be reduced by prolonged use. The bulk GaAs samples retained a fairly well organized crystalline structure after delivering beam but show evidence of Cs depletion on the surface. Within the precision of the SIMS and RBS measurements, the data showed no indication of hydrogen implantation or lattice damage from ion back bombardment in the bulk GaAs wafers. In contrast, SIMS and TEM measurements of the strained superlattice photocathode show clear crystal damage in the wafer from ion back bombardment.

  3. Annealing effect on corrosion resistance of Bi{sub x}Ti{sub y}O{sub z} coatings

    Energy Technology Data Exchange (ETDEWEB)

    Pinzon, M. J.; Alfonsoa, J. E.; Olaya, J. J. [Universidad Nacional de Colombia, Grupo de Ciencia de Materiales y Superficies, Bogota AA 14490 (Colombia); Pineda Vargas, C. A., E-mail: jealfonsoo@unal.edu.co [iThemba LABS, Materials Research Department, PO Box 722, Somerset West 7129 (South Africa)

    2016-11-01

    Bismuth titanate (Bi-xTi{sub y}O{sub z}) has received widespread attention due to the fact that during recent times it has found important applications in strategic research fields such as optics and optoelectronic, and more recently studies have shown how their physicochemical properties may be harnessed in order to be able to use Bi{sub x}Ti{sub y}O{sub z}, as an anti corrosive coating. In this work bismuth titanate (Bi{sub x}Ti{sub y}O{sub z}) coatings were grown on titanium alloy (Ti6A14V) substrates, using RF magnetron sputtering at room temperature. The main objectives of the work were quantify the evolution of crystallographic phase formation, as a function of the annealing temperature, and establish the chemical composition in order to characterize the behaviour of the bismuth titanate coating as a protective coating of the corrosion. The morphology of the coating was observed via scanning electronic microscopy (Sem); the crystalline structure was characterized by X-ray diffraction (XRD) and the chemical composition was analyzed by Rutherford Backscattering Spectrometry (RBS). The corrosion resistance of the coatings was studied by potentiodynamic polarization (Pp) test (Tafel extrapolation). Sem results showed that the surface roughness of the coatings changed when the temperature of annealing increased. Similar change occurred after Pp tests. The XRD analysis revealed a change in the coatings microstructure as a function of the annealing temperature, since they evolved from a completely amorphous phase to a polycrystalline phase. RBS results indicate that coatings growing at high temperature have a complex chemical composition. Finally, the electrochemical analysis showed that the corrosion resistance of the coating is much better in the amorphous phases of bismuth titanate than in the polycrystalline phases. (Author)

  4. Measles Virus Hemagglutinin epitopes immunogenic in natural infection and vaccination are targeted by broad or genotype-specific neutralizing monoclonal antibodies.

    Science.gov (United States)

    Muñoz-Alía, Miguel Angel; Casasnovas, José M; Celma, María Luisa; Carabaña, Juan; Liton, Paloma B; Fernandez-Muñoz, Rafael

    2017-05-15

    Measles virus (MV) remains a leading cause of vaccine-preventable deaths in children. Protection against MV is associated with neutralizing antibodies that preferentially recognize the viral hemagglutinin (MV-H), and to a lesser extent, the fusion protein (MV-F). Although MV is serologically monotypic, 24 genotypes have been identified. Here we report three neutralization epitopes conserved in the more prevalent circulating MV genotypes, two located in the MV-H receptor binding site (RBS) (antigenic site III) and a third in MV-H/MV-F interphase (antigenic site Ia) which are essential for MV multiplication. In contrast, two MV-H neutralization epitopes, showed a genotype-specific neutralization escape due to a single amino acid change, that we mapped in the "noose" antigenic site, or an enhanced neutralization epitope (antigenic site IIa). The monoclonal antibody (mAb) neutralization potency correlated with its binding affinity and was mainly driven by kinetic dissociation rate (k off ). We developed an immunoassay for mAb binding to MV-H in its native hetero-oligomeric structure with MV-F on the surface of a MV productive steady-state persistently infected (p.i.) human cell lines, and a competitive-binding assay with serum from individuals with past infection by different MV genotypes. Binding assays revealed that a broad neutralization epitope, in RBS antigenic site, a genotype specific neutralization epitopes, in noose and IIa sites, were immunogenic in natural infection and vaccination and may elicit long-lasting humoral immunity that might contribute to explain MV immunogenic stability. These results support the design of improved measles vaccines, broad-spectrum prophylactic or therapeutic antibodies and MV-used in oncolytic therapies. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. 130 MeV Au ion irradiation induced dewetting on In{sub 2}Te{sub 3} thin film

    Energy Technology Data Exchange (ETDEWEB)

    Matheswaran, P.; Abhirami, K.M.; Gokul, B. [Department of Physics, Kongunadu Arts and Science College, Coimbatore 641029 (India); Sathyamoorthy, R., E-mail: rsathya1959@gmail.com [Department of Physics, Kongunadu Arts and Science College, Coimbatore 641029 (India); Prakash, Jai [Department of Chemistry, M.M.H. College, Ghaziabad 201001 (India); Asokan, K.; Kanjilal, D. [Materials Science Division, Inter University Accelerator Centre, New Delhi 110067 (India)

    2012-09-01

    Highlights: Black-Right-Pointing-Pointer In{sub 2}Te{sub 3} phase formed from In/Te bilayer by 130 MeV Au ion irradiation. Black-Right-Pointing-Pointer Lower fluence results mixed phases with initial state of dewetting. Black-Right-Pointing-Pointer At higher fluence, In{sub 2}Te{sub 3} phase with complete dewetting pattern is formed. Black-Right-Pointing-Pointer Thermal spike model is used to explain the inter face mixing phenomena. Black-Right-Pointing-Pointer SHI irradiation may be used to functionalize the structural and surface properties of thin films. - Abstract: In/Te bilayer thin films were prepared by sequential thermal evaporation and subsequently irradiated by 130 MeV Au ions. The pristine and irradiated samples were characterized by X-ray diffraction (XRD), Rutherford backscattering spectrometry (RBS), scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDX) techniques. RBS spectra reveal the sputtering of Te film and interface mixing, with increasing fluence. The surface morphology showed the beginning of dewetting of Te thin film and formation of the partially connected with the mixed zones at the fluence of 1 Multiplication-Sign 10{sup 13} ions/cm{sup 2}. At the higher fluence of 3 Multiplication-Sign 10{sup 13} ions/cm{sup 2}, dewetted structures were isolated at the surface. Above results are explained based on the formation of craters, sputtering and dewetting followed by inter-diffusion at the interface of molten zones due to thermal spike induced by Au ions.

  6. Structural, mechanical, electrical and wetting properties of ZrNx films deposited by Ar/N2 vacuum arc discharge: Effect of nitrogen partial pressure

    Science.gov (United States)

    Abdallah, B.; Naddaf, M.; A-Kharroub, M.

    2013-03-01

    Non-stiochiometric zirconium nitride (ZrNx) thin films have been deposited on silicon substrates by vacuum arc discharge of (N2 + Ar) gas mixtures at different N2 partial pressure ratio. The microstructure, mechanical, electrical and wetting properties of these films are studied by means of X-ray diffraction (XRD), micro-Raman spectroscopy, Rutherford back scattering (RBS) technique, conventional micro-hardness testing, electrical resistivity, atomic force microscopy (AFM) and contact angle (CA) measurements. RBS results and analysis show that the (N/Zr) ratio in the film increases with increasing the N2 partial pressure. A ZrNx film with (Zr/N) ratio in the vicinity of stoichiometric ZrN is obtained at N2 partial pressure of 10%. XRD and Raman results indicate that all deposited films have strained cubic crystal phase of ZrN, regardless of the N2 partial pressure. On increasing the N2 partial pressure, the relative intensity of (1 1 1) orientation with respect to (2 0 0) orientation is seen to decrease. The effect of N2 partial pressure on micro-hardness and the resistivity of the deposited film is revealed and correlated to the alteration of grain size, crystallographic texture, stoichiometry and residual stress developed in the film. In particular, it is found that residual stress and nitrogen incorporation in the film play crucial role in the alteration of micro-hardness and resistivity respectively. In addition, CA and AFM results demonstrate that as N2 partial pressure increases, both the surface hydrophobicity and roughness of the deposited film increase, leading to a significant decrease in the film surface free energy (SFE).

  7. Micro-PIXE on thin plant tissue samples in frozen hydrated state: A novel addition to JSI nuclear microprobe

    International Nuclear Information System (INIS)

    Vavpetič, P.; Pelicon, P.; Vogel-Mikuš, K.; Grlj, N.; Pongrac, P.; Jeromel, L.; Ogrinc, N.; Regvar, M.

    2013-01-01

    Recently we completed a construction of a cryostat at Jožef Stefan Institute (JSI) nuclear microprobe enabling us to analyze various types of biological samples in frozen hydrated state using micro-PIXE/STIM/RBS. Sample load-lock system was added to our existing setup to enable us to quickly insert a sample holder with frozen hydrated tissue samples onto a cold goniometer head cooled with liquid nitrogen inside the measuring chamber. Cryotome-cut slices of frozen hydrated plant samples were mounted between two thin silicon nitride foils and then attached to the sample holder. Sufficient thermal contact between silicon nitride foils and sample holder must be achieved, as well as between the sample holder and the cold goniometer head inside the measuring chamber to prevent melting of the samples. Matrix composition of frozen hydrated tissue is consisted mostly of ice. Thinning of the sample as well as water evaporation during high vacuum and proton beam exposure was inspected by the measurements with RBS and STIM method simultaneously with micro-PIXE. For first measuring attempts a standard micro-PIXE configuration for tissue mapping was used with proton beam cross section of 1.2 × 1.2 μm 2 and a beam current of 100 pA. The temperature of the cold goniometer head was kept below 130 K throughout the entire proton beam exposure. First measurements of thin plant tissue samples in frozen hydrated state show minute sample degradation during the 10 h period of micro-PIXE measurements

  8. Assessment of dye distribution in sensitized solar cells by microprobe techniques

    Energy Technology Data Exchange (ETDEWEB)

    Barreiros, M.A., E-mail: alexandra.barreiros@lneg.pt [Laboratório Nacional de Energia e Geologia, LEN/UES, Estrada do Paço do Lumiar, 22, 1649-038 Lisboa (Portugal); Corregidor, V. [IPFN, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10, 2686-953 Sacavém (Portugal); Alves, L.C. [C2TN, Campus Tecnológico e Nuclear, Instituto Superior Técnico, Universidade de Lisboa, E.N. 10, 2686-953 Sacavém (Portugal); Guimarães, F. [Laboratório Nacional de Energia e Geologia, LGM/UCTM, Rua da Amieira, Apartado 1089, 4466-901 S. Mamede de Infesta (Portugal); Mascarenhas, J.; Torres, E.; Brites, M.J. [Laboratório Nacional de Energia e Geologia, LEN/UES, Estrada do Paço do Lumiar, 22, 1649-038 Lisboa (Portugal)

    2015-04-01

    Dye sensitized solar cells (DSCs) have received considerable attention once this technology offers economic and environmental advantages over conventional photovoltaic (PV) devices. The PV performance of a DSC relies on the characteristics of its photoanode, which typically consists of a nanocrystalline porous TiO{sub 2} film, enabled with a large adsorptive surface area. Dye molecules that capture photons from light during device operation are attached to the film nanoparticles. The effective loading of the dye in the TiO{sub 2} electrode is of paramount relevance for controlling and optimizing solar cell parameters. Relatively few methods are known today for quantitative evaluation of the total dye adsorbed on the film. In this context, microprobe techniques come out as suitable tools to evaluate the dye surface distribution and depth profile in sensitized films. Electron Probe Microanalysis (EPMA) and Ion Beam Analytical (IBA) techniques using a micro-ion beam were used to quantify and to study the distribution of the Ru organometallic dye in TiO{sub 2} films, making use of the different penetration depth and beam sizes of each technique. Different 1D nanostructured TiO{sub 2} films were prepared, morphologically characterized by SEM, sensitized and analyzed by the referred techniques. Dye load evaluation in different TiO{sub 2} films by three different techniques (PIXE, RBS and EPMA/WDS) provided similar results of Ru/Ti mass fraction ratio. Moreover, it was possible to assess dye surface distribution and its depth profile, by means of Ru signal, and to visualize the dye distribution in sample cross-section through X-ray mapping by EPMA/EDS. PIXE maps of Ru and Ti indicated an homogeneous surface distribution. The assessment of Ru depth profile by RBS showed that some films have homogeneous Ru depth distribution while others present different Ru concentration in the top layer (2 μm thickness). These results are consistent with the EPMA/EDS maps obtained.

  9. Dietary administration of a Gracilaria tenuistipitata extract enhances the immune response and resistance against Vibrio alginolyticus and white spot syndrome virus in the white shrimp Litopenaeus vannamei.

    Science.gov (United States)

    Sirirustananun, Nuttarin; Chen, Jiann-Chu; Lin, Yong-Chin; Yeh, Su-Tuen; Liou, Chyng-Hwa; Chen, Li-Li; Sim, Su Sing; Chiew, Siau Li

    2011-12-01

    The haemogram, phenoloxidase (PO) activity, respiratory bursts (RBs), superoxide dismutase (SOD) activity, glutathione peroxidase (GPx) activity, lysozyme activity, and the mitotic index of haematopoietic tissue (HPT) were examined after the white shrimp Litopenaeus vannamei had been fed diets containing the hot-water extract of Gracilaria tenuistipitata at 0 (control), 0.5, 1.0, and 2.0 g kg(-1) for 7-35 days. Results indicated that these parameters directly increased with the amount of extract and time, but slightly decreased after 35 days. RBs, SOD activity, and GPx activity reached the highest levels after 14 days, whereas PO and lysozyme activities reached the highest levels after 28 days. In a separate experiment, white shrimp L. vannamei, which had been fed diets containing the extract for 14 days, were challenged with Vibrio alginolyticus at 2 × 10(6) cfu shrimp(-1) and white spot syndrome virus (WSSV) at 1 × 10(3) copies shrimp(-1), and then placed in seawater. The survival rate of shrimp fed the extract-containing diets was significantly higher than that of shrimp fed the control diet at 72-144 h post-challenge. We concluded that dietary administration of the G. tenuistipitata extract at ≤1.0 g kg(-1) could enhance the innate immunity within 14 days as evidenced by the increases in immune parameters and mitotic index of HPT in shrimp and their enhanced resistance against V. alginolyticus and WSSV infections. Shrimp fed the extract-containing diets showed a higher and continuous increase in the humoral response indicating its persistent role in innate immunity. Copyright © 2011 Elsevier Ltd. All rights reserved.

  10. Cation non-stoichiometry in pulsed laser deposited Sr{sub 2+y}Fe{sub 1+x}Mo{sub 1-x}O₆ epitaxial films

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, T. L.; Woodward, P. M., E-mail: woodward.55@osu.edu [Department of Chemistry and Biochemistry, The Ohio State University, Columbus, Ohio 43210-1117 (United States); Dixit, M.; Williams, R. E. A.; Susner, M. A.; Fraser, H. L.; McComb, D. W.; Sumption, M. D. [Department of Materials Science and Engineering, The Ohio State University, Columbus, Ohio 43210-1117 (United States); Lemberger, T. R. [Department of Physics, The Ohio State University, Columbus, Ohio 43210-1117 (United States)

    2014-07-07

    Sr₂FeMoO₆ (SFMO) films were grown on SrTiO₃ (100)- and (111)-oriented substrates via pulsed laser deposition (PLD). In order to study the fundamental characteristics of deposition, films were grown in two different PLD chambers. In chamber I, the best films were grown with a relatively long substrate-to-target distance (89 mm), high substrate temperature (850 °C), and low pressure (50 mTorr) in a 95% Ar/5% H₂ atmosphere. Although X-ray diffraction (XRD) measurements indicate these films are single phase, Rutherford Backscattering (RBS) measurements reveal considerable non-stoichiometry, corresponding to a Sr₂Fe{sub 1–x}Mo{sub 1+x}O₆ composition with x≅0.2–0.3. This level of non-stoichiometry results in inferior magnetic properties. In chamber II, the best films were grown with a much shorter substrate-to-target distance (38 mm), lower temperature (680 °C), and higher pressure (225 mTorr). XRD measurements show that the films are single phase, and RBS measurements indicate that they are nearly stoichiometric. The degree of ordering between Fe and Mo was dependent on both the temperature and pressure used during deposition, reaching a maximum order parameter of 85%. The saturation magnetization increases as the Fe/Mo ordering increases, reaching a maximum of 2.4 μB/f.u. Based on prior studies of bulk samples, one would expect a higher saturation magnetization for this degree of Fe/Mo order. The presence of extra strontium oxide layers in the form of Ruddlesden-Popper intergrowths appears to be responsible for the lower than expected saturation magnetization of these films.

  11. Payload specialist Reinhard Furrer show evidence of previous blood sampling

    Science.gov (United States)

    1985-01-01

    Payload specialist Reinhard Furrer shows evidence of previous blood sampling while Wubbo J. Ockels, Dutch payload specialist (only partially visible), extends his right arm after a sample has been taken. Both men show bruises on their arms.

  12. Uudised : Otsman taas Riias show'l. Rokkstaarist ministriks

    Index Scriptorium Estoniae

    2007-01-01

    Drag-kabareeartist Erkki Otsman esineb detsembris Riias "Sapnu Fabrikas" toimuval jõulu-show'l. Austraalia rokkansambli Midnight Oil endine laulja Peter Garrett nimetati valitsuse keskkonnaministriks

  13. Time dependent patient no-show predictive modelling development.

    Science.gov (United States)

    Huang, Yu-Li; Hanauer, David A

    2016-05-09

    Purpose - The purpose of this paper is to develop evident-based predictive no-show models considering patients' each past appointment status, a time-dependent component, as an independent predictor to improve predictability. Design/methodology/approach - A ten-year retrospective data set was extracted from a pediatric clinic. It consisted of 7,291 distinct patients who had at least two visits along with their appointment characteristics, patient demographics, and insurance information. Logistic regression was adopted to develop no-show models using two-thirds of the data for training and the remaining data for validation. The no-show threshold was then determined based on minimizing the misclassification of show/no-show assignments. There were a total of 26 predictive model developed based on the number of available past appointments. Simulation was employed to test the effective of each model on costs of patient wait time, physician idle time, and overtime. Findings - The results demonstrated the misclassification rate and the area under the curve of the receiver operating characteristic gradually improved as more appointment history was included until around the 20th predictive model. The overbooking method with no-show predictive models suggested incorporating up to the 16th model and outperformed other overbooking methods by as much as 9.4 per cent in the cost per patient while allowing two additional patients in a clinic day. Research limitations/implications - The challenge now is to actually implement the no-show predictive model systematically to further demonstrate its robustness and simplicity in various scheduling systems. Originality/value - This paper provides examples of how to build the no-show predictive models with time-dependent components to improve the overbooking policy. Accurately identifying scheduled patients' show/no-show status allows clinics to proactively schedule patients to reduce the negative impact of patient no-shows.

  14. Entertaining politics, seriously?! : How talk show formats blur conceptual boundaries

    NARCIS (Netherlands)

    Schohaus, Birte

    2017-01-01

    What happens behind the scenes of a talk show? Why do some politicians seem to appear on every show while others are hardly ever seen? Birte Schohaus conducted a multi-layered research in which she conducted interviews with journalists, producers, PR advisors and (former) politicians and combined

  15. Effects of TV Crime Shows on Behavioural Development of Children

    Directory of Open Access Journals (Sweden)

    Abdullah Mudassar

    2017-01-01

    Full Text Available Television crime dramas and shows are very popular all over the world. This popularity is not bound to a certain age group, rather all the TV viewers like these shows very much. Like other countries, dozens of TV channels are telecasting these crime shows in Pakistan. Furthermore, few of the channels telecast crime shows at prime time which attests the popularity of such genre. Some of the media contents behave in morally disputed ways. The crime depictions as re-enactments of TV crime shows are questionable in the field of research signifying diverse cultural contexts. A large number of people are habitual to watch these shows, which may probably come out with negative behavioural outcomes. Especially the children who are at their behavioural developmental phase; are more susceptible to adopt negative behavioural leanings. In this research effort, introduction and detail of TV crime shows in Pakistan are provided, the literature concerning “media as risk factor“ in children development is discussed, and relevant theories inferences are deliberated.it was found that media has powerful role in behaviour formulating of children and violence media portrayal (TV crime shows may appear with grave concerns. Previous scientific literature was reviewed to find and discuss the problem in hand. In the research effort, the literature review provides research propositions to explore further dimensions to TV crime shows’ effects and possible negative or positive behavioural outcomes in children behaviour.

  16. The Presentation of Science in Everyday Life: The Science Show

    Science.gov (United States)

    Watermeyer, Richard

    2013-01-01

    This paper constitutes a case-study of the "science show" model of public engagement employed by a company of science communicators focused on the popularization of science, technology, engineering and mathematics (STEM) subject disciplines with learner constituencies. It examines the potential of the science show to foster the interest…

  17. "The Daily Show with Jon Stewart": Part 1

    Science.gov (United States)

    Trier, James

    2008-01-01

    Comedy Central's popular program "The Daily Show With Jon Stewart" is the best critical media literacy program on television, and it can be used in valuable ways in the classroom as part of a media literacy pedagogy. This Media Literacy column provides an overview of the show and its accompanying website and considers ways it might be used in the…

  18. The Daily Show with Jon Stewart: Part 2

    Science.gov (United States)

    Trier, James

    2008-01-01

    "The Daily Show With Jon Stewart" is one of the best critical literacy programs on television, and in this Media Literacy column the author suggests ways that teachers can use video clips from the show in their classrooms. (For Part 1, see EJ784683.)

  19. 16 CFR 5.57 - Order to show cause.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Order to show cause. 5.57 Section 5.57 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE STANDARDS OF CONDUCT Disciplinary Actions Concerning Postemployment Conflict of Interest § 5.57 Order to show cause. (a...

  20. Davedan Show Di Amphi Theatre Nusa Dua Bali

    Directory of Open Access Journals (Sweden)

    Ni Made Ruastiti

    2018-05-01

    Full Text Available Artikel ini disusun dari hasil penelitian yang bertujuan untuk dapat memahami pertunjukan Davedan Show di Amphi Theatre Nusa Dua Bali. Penelitian ini dilakukan karena adanya ketimpangan antara asumsi dan kenyataan di lapangan. Pada umumnya wisatawan yang datang ke Bali hanya senang dan antusias menonton seni pertunjukan pariwisata berbasis seni budaya lokal saja. Tetapi kenyataan ini berbeda. Walaupun Davedan Show tidak dibangun dari seni budaya lokal saja, tetapi kenyataannya wisatawan sangat senang menonton pertunjukan tersebut. Pertanyaannya: bagaimanakah bentuk pertunjukan Davedan Show tersebut?; mengapa wisatawan senang menonton pertunjukan itu?; apa implikasinya bagi pelaku, masyarakat, dan industri pariwisata di Nusa Dua, Bali?. Penelitian ini menggunakan metode penelitian kualitatif, khususnya implementatif partisipatoris yang mengutamakan kerjasama antara periset dengan para informan terkait. Sumber data penelitian ini adalah pertunjukan Davedan itu sendiri, pihak manajemen, para penari, penonton, hasil-hasil penelitian yang telah ada sebelumnya. Seluruh data yang telah dikumpulkan dengan teknik observasi, wawancara, FGD, dan studi kepustakaan itu dianalisis secara kritis dengan menggunakan teori estetika postmodern, teori praktik, dan teori relasi kuasa pengetahuan. Hasil penelitian menunjukan bahwa: (1 Davedan Show disajikan dalam bentuk oratorium. Hal itu dapat dilihat dari cara penyajian, koreografi, dan iringan pertunjukannya. Davedan Show yang menampilkan tema Treasure of The Archipelago, membuka gerbang petualangan baru itu diiringi musik rekaman etnik Nusantara secara medley, berkelanjutan dengan struktur pertunjukan: seni budaya Bali, Sumatra, Sunda, Solo, Kalimantan, dan seni budaya Papua; (2 Davedan Show banyak diminati wisatawan manca negara karena penciptaan pertunjukan itu dilatari oleh ideologi pasar, ideologi estetika, dan ideologi budaya Nusantara; (3 Hingga kini Davedan Show berkembang secara berkelanjutan di Nusa Dua

  1. QLab 3 show control projects for live performances & installations

    CERN Document Server

    Hopgood, Jeromy

    2013-01-01

    Used from Broadway to Britain's West End, QLab software is the tool of choice for many of the world's most prominent sound, projection, and integrated media designers. QLab 3 Show Control: Projects for Live Performances & Installations is a project-based book on QLab software covering sound, video, and show control. With information on both sound and video system basics and the more advanced functions of QLab such as MIDI show control, new OSC capabilities, networking, video effects, and microphone integration, each chapter's specific projects will allow you to learn the software's capabilitie

  2. marker development for two novel rice genes showing differential ...

    Indian Academy of Sciences (India)

    2014-08-19

    Aug 19, 2014 ... School of Crop Improvement, College of PostGraduate Studies, Central Agricultural University, ... from the root transcriptome data for tolerance to low P. .... Values show a representative result of three independent experiments ...

  3. Do men and women show love differently in marriage?

    Science.gov (United States)

    Schoenfeld, Elizabeth A; Bredow, Carrie A; Huston, Ted L

    2012-11-01

    In Western societies, women are considered more adept than men at expressing love in romantic relationships. Although scholars have argued that this view of love gives short shrift to men's ways of showing love (e.g., Cancian, 1986; Noller, 1996), the widely embraced premise that men and women "love differently" has rarely been examined empirically. Using data collected at four time points over 13 years of marriage, the authors examined whether love is associated with different behaviors for husbands and wives. Multilevel analyses revealed that, counter to theoretical expectations, both genders were equally likely to show love through affection. But whereas wives expressed love by enacting fewer negative or antagonistic behaviors, husbands showed love by initiating sex, sharing leisure activities, and doing household work together with their wives. Overall, the findings indicate that men and women show their love in more nuanced ways than cultural stereotypes suggest.

  4. Army Study Shows Decline In Behavioral Health Stigma

    Science.gov (United States)

    2012-01-01

    Army Study Shows Decline in Behavioral Health Stigma By Rob McIlvaine Army News Service WASHINGTON, Jan. 20, 2012 - A newly released Army study on...conference yesterday. The three-year study outlines the problem of suicide in the Army and related issues of substance abuse, spouse abuse and child abuse...REPORT TYPE 3. DATES COVERED 00-00-2012 to 00-00-2012 4. TITLE AND SUBTITLE Army Study Shows Decline In Behavioral Health Stigma 5a. CONTRACT

  5. Dolphin shows and interaction programs: benefits for conservation education?

    Science.gov (United States)

    Miller, L J; Zeigler-Hill, V; Mellen, J; Koeppel, J; Greer, T; Kuczaj, S

    2013-01-01

    Dolphin shows and dolphin interaction programs are two types of education programs within zoological institutions used to educate visitors about dolphins and the marine environment. The current study examined the short- and long-term effects of these programs on visitors' conservation-related knowledge, attitude, and behavior. Participants of both dolphin shows and interaction programs demonstrated a significant short-term increase in knowledge, attitudes, and behavioral intentions. Three months following the experience, participants of both dolphin shows and interaction programs retained the knowledge learned during their experience and reported engaging in more conservation-related behaviors. Additionally, the number of dolphin shows attended in the past was a significant predictor of recent conservation-related behavior suggesting that repetition of these types of experiences may be important in inspiring people to conservation action. These results suggest that both dolphin shows and dolphin interaction programs can be an important part of a conservation education program for visitors of zoological facilities. © 2012 Wiley Periodicals, Inc.

  6. Pedagogical Techniques Employed by the Television Show "MythBusters"

    Science.gov (United States)

    Zavrel, Erik

    2016-11-01

    "MythBusters," the long-running though recently discontinued Discovery Channel science entertainment television program, has proven itself to be far more than just a highly rated show. While its focus is on entertainment, the show employs an array of pedagogical techniques to communicate scientific concepts to its audience. These techniques include: achieving active learning, avoiding jargon, employing repetition to ensure comprehension, using captivating demonstrations, cultivating an enthusiastic disposition, and increasing intrinsic motivation to learn. In this content analysis, episodes from the show's 10-year history were examined for these techniques. "MythBusters" represents an untapped source of pedagogical techniques, which science educators may consider availing themselves of in their tireless effort to better reach their students. Physics educators in particular may look to "MythBusters" for inspiration and guidance in how to incorporate these techniques into their own teaching and help their students in the learning process.

  7. Implications of the Goal Theory on air show programs planning

    Directory of Open Access Journals (Sweden)

    Dewald Venter

    2014-01-01

    Full Text Available Events have long played an important role in human society (Shone & Parry, 2010: 3. The toils and efforts of daily lives have often been broken up by events of all kinds as humans seek an escape from the harsh reality of existence and events provide the outlet. Events are classified into four categories according to Shone and Parry (2010: 5 namely leisure (sport, recreation, personal (weddings, birthdays, cultural (art, folklore and organizational (politics, commercial. Successful events either match or exceed visitor motives and goals. It is critical that data be collected from visitors to determine their motives and goals in order to satisfy them and thereby encouraging repeat visits. One such event is the annual air show held at the Zwartkop Air Force Base (AFB in Pretoria, South Africa. Zwartkop AFB is also home to the South African Air Force (SAAF museum that also the hosts of the air show. Much of the museum‟s funds are generated through hosting the air show and sponsor contributions. Visitor goal satisfaction should therefore be of critically importance to the program planners. Military hardware has long held a fascination for those who used them and inspired the imagination of young and old. Such hardware often serves as a remembrance of times passed and as a testament to those who perished. For many visiting museums and air shows, curiosity plays a big role. The particular focus of this article will be on how the goal theory of leisure travel can be utilized by the air show organizers to enhance visitor experience to an air show.

  8. CERN cars drive by the Geneva Motor Show

    CERN Multimedia

    CERN Bulletin

    2011-01-01

    One of CERN's new gas-fuelled cars was a special guest at the press days of the Geneva motor show this year. The car enjoyed a prominent position on the Gazmobil stand, right next to the latest Mazeratis and Ferraris. Journalists previewing the motor show could discover CERN's support for green technologies and also find out more about the lab - home to the fastest racetrack on the planet, with protons in the LHC running at 99.9999991% of the speed of light.    

  9. The Biochemistry Show: a new and fun tool for learning

    Directory of Open Access Journals (Sweden)

    A.H Ono

    2006-07-01

    Full Text Available The traditional methods to teach biochemistry in most universities are based on the memorization of chemical structures,  biochemical  pathways  and  reagent  names,  which  is  many  times  dismotivating  for  the  students.  We presently describe an innovative, interactive and alternative method for teaching biochemistry to medical and nutrition undergraduate students, called the Biochemistry Show (BioBio Show.The Biobio show is based on active participation of the students. They are divided in groups and the groups face each other. One group faces another one group at a time, in a game based on true or false questions that involve subjects of applied biochemistry (exercise, obesity, diabetes, cholesterol, free radicals, among others. The questions of the Show are previously elaborated by senior students. The Biobio Show has four phases, the first one is a selection exam, and from the second to the fourth phase, eliminatory confrontations happen. On a confrontation, the first group must select a certain quantity of questions for the opponent to answer.  The group who choses the questions must know how to answer and justify the selected questions. This procedure is repeated on all phases of the show. On the last phase, the questions used are taken from an exam previously performed by the students: either the 9-hour biochemistry exam (Sé et al. A 9-hour biochemistry exam. An iron man competition or a good way of evaluating undergraduate students? SBBq 2005, abstract K-6 or the True-or-False exam (TFE (Sé et al. Are tutor-students capable of writing good biochemistry exams? SBBq 2004, abstract K-18. The winner group receives an extra 0,5 point on the final grade. Over 70% of the students informed on a questionnaire that the Biobio Show is a valuable tool for learning biochemistry.    That is a new way to enrich the discussion of biochemistry in the classroom without the students getting bored. Moreover, learning

  10. An autopsied case of tuberculous meningitis showing interesting CT findings

    International Nuclear Information System (INIS)

    Abiko, Takashi; Higuchi, Hiroshi; Imada, Ryuichi; Nagai, Kenichi

    1983-01-01

    A 61-year-old female patient died of a neurological disorder of unknown origin one month after the first visit and was found to have had tuberculous meningitis at autopsy. CT revealed a low density area showing an enlargement of the cerebral ventricle but did not reveal contrast enhancement in the basal cistern peculiar to tuberculous meningitis. (Namekawa, K.)

  11. Auditory temporal-order thresholds show no gender differences

    NARCIS (Netherlands)

    van Kesteren, Marlieke T. R.; Wierslnca-Post, J. Esther C.

    2007-01-01

    Purpose: Several studies on auditory temporal-order processing showed gender differences. Women needed longer inter-stimulus intervals than men when indicating the temporal order of two clicks presented to the left and right ear. In this study, we examined whether we could reproduce these results in

  12. Auditory temporal-order thresholds show no gender differences

    NARCIS (Netherlands)

    van Kesteren, Marlieke T R; Wiersinga-Post, J Esther C

    2007-01-01

    PURPOSE: Several studies on auditory temporal-order processing showed gender differences. Women needed longer inter-stimulus intervals than men when indicating the temporal order of two clicks presented to the left and right ear. In this study, we examined whether we could reproduce these results in

  13. An Easy Way to Show Memory Color Effects.

    Science.gov (United States)

    Witzel, Christoph

    2016-01-01

    This study proposes and evaluates a simple stimulus display that allows one to measure memory color effects (the effect of object knowledge and memory on color perception). The proposed approach is fast and easy and does not require running an extensive experiment. It shows that memory color effects are robust to minor variations due to a lack of color calibration.

  14. Polypyridyl iron(II) complexes showing remarkable photocytotoxicity ...

    Indian Academy of Sciences (India)

    aditya

    Polypyridyl iron(II) complexes showing remarkable photocytotoxicity in visible light. ADITYA GARAI a. , UTTARA BASU a. , ILA PANT b. , PATURU KONDAIAH*. ,b. AND. AKHIL R. CHAKRAVARTY*. ,a a. Department of Inorganic and Physical Chemistry, Indian Institute of Science, Bangalore. 560012, India. E-mail: ...

  15. Manumycin from a new Streptomyces strain shows antagonistic ...

    African Journals Online (AJOL)

    Manumycin from a new Streptomyces strain shows antagonistic effect against methicillin-resistant Staphylococcus aureus (MRSA)/vancomycin-resistant enterococci (VRE) strains from Korean Hospitals. Yun Hee Choi, Seung Sik Cho, Jaya Ram Simkhada, Chi Nam Seong, Hyo Jeong Lee, Hong Seop Moon, Jin Cheol Yoo ...

  16. Five kepler target stars that show multiple transiting exoplanet candidates

    DEFF Research Database (Denmark)

    Steffen..[], Jason H.; Batalha, N. M.; Broucki, W J.

    2010-01-01

    We present and discuss five candidate exoplanetary systems identified with the Kepler spacecraft. These five systems show transits from multiple exoplanet candidates. Should these objects prove to be planetary in nature, then these five systems open new opportunities for the field of exoplanets a...

  17. Your Town Television Show: SMART Program (Part 1) [video

    OpenAIRE

    Naval Postgraduate School, (U.S.); Sanders, John; Millsaps, Knox; Shifflett, Deborah

    2010-01-01

    From "Your Town" television show. SMART Scholarship Program featured on Your Town television program in Monterey, California. Host John Sanders, Special Collections Manager of the Naval Postgraduate School's Dudley Knox Library, interviews Dr. Knox Millsaps, Executive Agent for the SMART Program, and Deborah Shifflett, SMART Program Manager.

  18. Your Town Television Show: SMART Program (Part 3) [video

    OpenAIRE

    Naval Postgraduate School, (U.S.); Sanders, John; Millsaps, Knox; Shifflett, Deborah

    2010-01-01

    From "Your Town" television show. SMART Scholarship Program featured on Your Town television program in Monterey, California. Host John Sanders, Special Collections Manager of the Naval Postgraduate School's Dudley Knox Library, interviews Dr. Knox Millsaps, Executive Agent for the SMART Program, and Deborah Shifflett, SMART Program Manager.

  19. A Progress Evaluation of Four Bilingual Children's Television Shows.

    Science.gov (United States)

    Klein, Stephen P.; And Others

    An evaluation of a bilingual education TV series was conducted involving 6-year-old English speaking, Spanish speaking, and bilingual children at four sites. Children were assigned to control and experimental groups with the latter group seeing four 30 minute shows. A pretest-posttest design was employed with the pretest serving as the covariate…

  20. The neonicotinoid imidachloprid shows high chronic toxicity to mayfly nymphs

    NARCIS (Netherlands)

    Roessink, I.; Merga, L.B.; Zweers, A.J.; Brink, van den P.J.

    2013-01-01

    The present study evaluated the acute and chronic toxicity of imidacloprid to a range of freshwater arthropods. Mayfly and caddisfly species were most sensitive to short-term imidacloprid exposures (10 tests), whereas the mayflies showed by far the most sensitive response to long-term exposure of

  1. An Easy Way to Show Memory Color Effects

    OpenAIRE

    Witzel, Christoph

    2016-01-01

    This study proposes and evaluates a simple stimulus display that allows one to measure memory color effects (the effect of object knowledge and memory on color perception). The proposed approach is fast and easy and does not require running an extensive experiment. It shows that memory color effects are robust to minor variations due to a lack of color calibration.

  2. 36 CFR 14.24 - Showing as to citizenship required.

    Science.gov (United States)

    2010-07-01

    ... INTERIOR RIGHTS-OF-WAY Procedures § 14.24 Showing as to citizenship required. (a) Individuals. An individual applicant applying for a right-of-way under any right-of-way act, except the Act of March 3, 1891... applicant resided in the United States thereafter while a minor, should be furnished. Where the husband and...

  3. Mice lacking neuropeptide Y show increased sensitivity to cocaine

    DEFF Research Database (Denmark)

    Sørensen, Gunnar; Woldbye, David Paul Drucker

    2012-01-01

    There is increasing data implicating neuropeptide Y (NPY) in the neurobiology of addiction. This study explored the possible role of NPY in cocaine-induced behavior using NPY knockout mice. The transgenic mice showed a hypersensitive response to cocaine in three animal models of cocaine addiction...

  4. Television Judge Shows: Nordic and U.S. Perspectives

    DEFF Research Database (Denmark)

    Porsdam, Helle

    2017-01-01

    Legal discourse is language that people use in a globalizing and multicultural society to negotiate acceptable behaviors and values. We see this played out in popular cultural forums such as judicial television dramas. In the American context, television judge shows are virtually synonymous...

  5. Mixed cultures of Kimchi lactic acid bacteria show increased cell ...

    African Journals Online (AJOL)

    ufuoma

    anaerobic organisms that are highly resistant to salts. Probiotic cultures for use in ... kimchi have a superior ability to decompose and utilize nutrients, and show ... citrate, 5 g sodium acetate, 1 g Tween, 2 g K2HPO4, 0.2 g. MgSO4•7H2O, 0.2 g ...

  6. Teaching Job Interviewing Skills with the Help of Television Shows

    Science.gov (United States)

    Bloch, Janel

    2011-01-01

    Because of its potential for humor and drama, job interviewing is frequently portrayed on television. This article discusses how scenes from popular television series such as "Everybody Loves Raymond," "Friends," and "The Mary Tyler Moore Show" can be used to teach effective job interview skills in business communication courses. Television…

  7. Airline Overbooking Problem with Uncertain No-Shows

    Directory of Open Access Journals (Sweden)

    Chunxiao Zhang

    2014-01-01

    Full Text Available This paper considers an airline overbooking problem of a new single-leg flight with discount fare. Due to the absence of historical data of no-shows for a new flight, and various uncertain human behaviors or unexpected events which causes that a few passengers cannot board their aircraft on time, we fail to obtain the probability distribution of no-shows. In this case, the airlines have to invite some domain experts to provide belief degree of no-shows to estimate its distribution. However, human beings often overestimate unlikely events, which makes the variance of belief degree much greater than that of the frequency. If we still regard the belief degree as a subjective probability, the derived results will exceed our expectations. In order to deal with this uncertainty, the number of no-shows of new flight is assumed to be an uncertain variable in this paper. Given the chance constraint of social reputation, an overbooking model with discount fares is developed to maximize the profit rate based on uncertain programming theory. Finally, the analytic expression of the optimal booking limit is obtained through a numerical example, and the results of sensitivity analysis indicate that the optimal booking limit is affected by flight capacity, discount, confidence level, and parameters of the uncertainty distribution significantly.

  8. Triphala, a formulation of traditional Ayurvedic medicine, shows

    Indian Academy of Sciences (India)

    Triphala, a formulation of traditional Ayurvedic medicine, shows protective effect against X-radiation in HeLa cells. YUKI TAKAUJI KENSUKE ... with the cellscultured in vitro. The simple bioassay system with human cultured cells would facilitate the understanding of themolecular basis for the beneficial effects of Triphala.

  9. Bilinguals Show Weaker Lexical Access during Spoken Sentence Comprehension

    Science.gov (United States)

    Shook, Anthony; Goldrick, Matthew; Engstler, Caroline; Marian, Viorica

    2015-01-01

    When bilinguals process written language, they show delays in accessing lexical items relative to monolinguals. The present study investigated whether this effect extended to spoken language comprehension, examining the processing of sentences with either low or high semantic constraint in both first and second languages. English-German…

  10. Soil bacteria show different tolerance ranges to an unprecedented disturbance

    DEFF Research Database (Denmark)

    Nunes, Ines Marques; Jurburg, Stephanie; Jacquiod, Samuel Jehan Auguste

    2018-01-01

    stress doses. FRG1, the most sensitive group, was dominated by Actinobacteria. FRG2 and FRG3, with intermediate tolerance, displayed prevalence of Proteobacteria, while FRG4, the most resistant group, was driven by Firmicutes. While the most sensitive FRGs showed predictable responses linked to changes...

  11. Genoa Boat Show – Good Example of Event Management

    Directory of Open Access Journals (Sweden)

    Dunja Demirović

    2012-07-01

    Full Text Available International Boat Show, a business and tourist event, has been held annually in Italian city of Genoa since 1962. The fair is one of the oldest, largest and best known in the field of boating industry worldwide, primarily due to good management of the event and it can serve as case study for domestic fair organizers to improve the quality of their business and services. Since Belgrade is the city of fairs, but compared to Genoa still underdeveloped in terms of trade shows, the following tasks imposed naturally in this study: to determine the relationship of the organizers of Genoa Boat Show in the sector of preparation and fair offer, in the sector of selection and communication with specific target groups (especially visitors, services during the fair and functioning of the city during the fair. During the research the authors have mostly used historical method, comparison, synthesis and the interview method. The results of theoretical research, in addition, may help not only managers of fair shows and of exhibitions, but also to organizers of other events in our country

  12. Recurrent and multiple bladder tumors show conserved expression profiles

    International Nuclear Information System (INIS)

    Lindgren, David; Fioretos, Thoas; Månsson, Wiking; Höglund, Mattias; Gudjonsson, Sigurdur; Jee, Kowan Ja; Liedberg, Fredrik; Aits, Sonja; Andersson, Anna; Chebil, Gunilla; Borg, Åke; Knuutila, Sakari

    2008-01-01

    Urothelial carcinomas originate from the epithelial cells of the inner lining of the bladder and may appear as single or as multiple synchronous tumors. Patients with urothelial carcinomas frequently show recurrences after treatment making follow-up necessary. The leading hypothesis explaining the origin of meta- and synchronous tumors assumes a monoclonal origin. However, the genetic relationship among consecutive tumors has been shown to be complex in as much as the genetic evolution does not adhere to the chronological appearance of the metachronous tumors. Consequently, genetically less evolved tumors may appear chronologically later than genetically related but more evolved tumors. Forty-nine meta- or synchronous urothelial tumors from 22 patients were analyzed using expression profiling, conventional CGH, LOH, and mutation analyses. We show by CGH that partial chromosomal losses in the initial tumors may not be present in the recurring tumors, by LOH that different haplotypes may be lost and that detected regions of LOH may be smaller in recurring tumors, and that mutations present in the initial tumor may not be present in the recurring ones. In contrast we show that despite apparent genomic differences, the recurrent and multiple bladder tumors from the same patients display remarkably similar expression profiles. Our findings show that even though the vast majority of the analyzed meta- and synchronous tumors from the same patients are not likely to have originated directly from the preceding tumor they still show remarkably similar expressions profiles. The presented data suggests that an expression profile is established early in tumor development and that this profile is stable and maintained in recurring tumors

  13. New Inspiring Planetarium Show Introduces ALMA to the Public

    Science.gov (United States)

    2009-03-01

    As part of a wide range of education and public outreach activities for the International Year of Astronomy 2009 (IYA2009), ESO, together with the Association of French Language Planetariums (APLF), has produced a 30-minute planetarium show, In Search of our Cosmic Origins. It is centred on the global ground-based astronomical Atacama Large Millimeter/submillimeter Array (ALMA) project and represents a unique chance for planetariums to be associated with the IYA2009. ESO PR Photo 09a/09 Logo of the ALMA Planetarium Show ESO PR Photo 09b/09 Galileo's first observations with a telescope ESO PR Photo 09c/09 The ALMA Observatory ESO PR Photo 09d/09 The Milky Way band ESO PR Video 09a/09 Trailer in English ALMA is the leading telescope for observing the cool Universe -- the relic radiation of the Big Bang, and the molecular gas and dust that constitute the building blocks of stars, planetary systems, galaxies and life itself. It is currently being built in the extremely arid environment of the Chajnantor plateau, at 5000 metres altitude in the Chilean Andes, and will start scientific observations around 2011. ALMA, the largest current astronomical project, is a revolutionary telescope, comprising a state-of-the-art array of 66 giant 12-metre and 7-metre diameter antennas observing at millimetre and submillimetre wavelengths. In Search of our Cosmic Origins highlights the unprecedented window on the Universe that this facility will open for astronomers. "The show gives viewers a fascinating tour of the highest observatory on Earth, and takes them from there out into our Milky Way, and beyond," says Douglas Pierce-Price, the ALMA Public Information Officer at ESO. Edited by world fulldome experts Mirage3D, the emphasis of the new planetarium show is on the incomparable scientific adventure of the ALMA project. A young female astronomer guides the audience through a story that includes unique animations and footage, leading the viewer from the first observations by Galileo

  14. Mutations increasing exposure of a receptor binding site epitope in the soluble and oligomeric forms of the caprine arthritis-encephalitis lentivirus envelope glycoprotein

    International Nuclear Information System (INIS)

    Hoetzel, Isidro; Cheevers, William P.

    2005-01-01

    The caprine arthritis-encephalitis (CAEV) and ovine maedi-visna (MVV) viruses are resistant to antibody neutralization, a feature shared with all other lentiviruses. Whether the CAEV gp135 receptor binding site(s) (RBS) in the functional surface envelope glycoprotein (Env) is protected from antibody binding, allowing the virus to resist neutralization, is not known. Two CAEV gp135 regions were identified by extrapolating a gp135 structural model that could affect binding of antibodies to the RBS: the V1 region and a short sequence analogous in position to the human immunodeficiency virus type 1 gp120 loop B postulated to be located between two major domains of CAEV gp135. Mutation of isoleucine-166 to alanine in the putative loop B of gp135 increased the affinity of soluble gp135 for the CAEV receptor(s) and goat monoclonal antibody (Mab) F7-299 which recognizes an epitope overlapping the gp135 RBS. The I166A mutation also stabilized or exposed the F7-299 epitope in anionic detergent buffers, indicating that the I166A mutation induces conformational changes and stabilizes the RBS of soluble gp135 and enhances Mab F7-299 binding. In contrast, the affinity of a V1 deletion mutant of gp135 for the receptor and Mab F7-299 and its structural stability did not differ from that of the wild-type gp135. However, both the I166A mutation and the V1 deletion of gp135 increased cell-to-cell fusion activity and binding of Mab F7-299 to the oligomeric Env. Therefore, the CAEV gp135 RBS is protected from antibody binding by mechanisms both dependent and independent of Env oligomerization which are disrupted by the V1 deletion and the I166A mutation, respectively. In addition, we found a correlation between side-chain β-branching at amino acid position 166 and binding of Mab F7-299 to oligomeric Env and cell-to-cell fusion, suggesting local secondary structure constraints in the region around isoleucine-166 as one determinant of gp135 RBS exposure and antibody binding

  15. HUBBLE VISION: A Planetarium Show About Hubble Space Telescope

    Science.gov (United States)

    Petersen, Carolyn Collins

    1995-05-01

    In 1991, a planetarium show called "Hubble: Report From Orbit" outlining the current achievements of the Hubble Space Telescope was produced by the independent planetarium production company Loch Ness Productions, for distribution to facilities around the world. The program was subsequently converted to video. In 1994, that program was updated and re-produced under the name "Hubble Vision" and offered to the planetarium community. It is periodically updated and remains a sought-after and valuable resource within the community. This paper describes the production of the program, and the role of the astronomical community in the show's production (and subsequent updates). The paper is accompanied by a video presentation of Hubble Vision.

  16. Political Show-Technology in the Post-Soviet Space

    Directory of Open Access Journals (Sweden)

    O. E. Grishin

    2015-01-01

    Full Text Available In the modern political process of Russia actively used technology show. With their help, political actors can influence public opinion and shape the public interest in certain issues. In Russia, these technologies are relevant, and are especially well developed. The pressing of the problem is due to a new round of information war on the territory of Ukraine. Inclusion in the information space, and discuss the pressing issues of modern Ukraine by media people such as C. Shuster and V. Solovyov, suggests that the political show has entertainment figures, actuality, the ambiguity of the proposed conclusions. At the same time it becomes part of the information war and political reality of the normal state.

  17. Migraine patients consistently show abnormal vestibular bedside tests

    Directory of Open Access Journals (Sweden)

    Eliana Teixeira Maranhão

    2015-01-01

    Full Text Available Migraine and vertigo are common disorders, with lifetime prevalences of 16% and 7% respectively, and co-morbidity around 3.2%. Vestibular syndromes and dizziness occur more frequently in migraine patients. We investigated bedside clinical signs indicative of vestibular dysfunction in migraineurs.Objective To test the hypothesis that vestibulo-ocular reflex, vestibulo-spinal reflex and fall risk (FR responses as measured by 14 bedside tests are abnormal in migraineurs without vertigo, as compared with controls.Method Cross-sectional study including sixty individuals – thirty migraineurs, 25 women, 19-60 y-o; and 30 gender/age healthy paired controls.Results Migraineurs showed a tendency to perform worse in almost all tests, albeit only the Romberg tandem test was statistically different from controls. A combination of four abnormal tests better discriminated the two groups (93.3% specificity.Conclusion Migraine patients consistently showed abnormal vestibular bedside tests when compared with controls.

  18. Migraine patients consistently show abnormal vestibular bedside tests.

    Science.gov (United States)

    Maranhão, Eliana Teixeira; Maranhão-Filho, Péricles; Luiz, Ronir Raggio; Vincent, Maurice Borges

    2016-01-01

    Migraine and vertigo are common disorders, with lifetime prevalences of 16% and 7% respectively, and co-morbidity around 3.2%. Vestibular syndromes and dizziness occur more frequently in migraine patients. We investigated bedside clinical signs indicative of vestibular dysfunction in migraineurs. To test the hypothesis that vestibulo-ocular reflex, vestibulo-spinal reflex and fall risk (FR) responses as measured by 14 bedside tests are abnormal in migraineurs without vertigo, as compared with controls. Cross-sectional study including sixty individuals - thirty migraineurs, 25 women, 19-60 y-o; and 30 gender/age healthy paired controls. Migraineurs showed a tendency to perform worse in almost all tests, albeit only the Romberg tandem test was statistically different from controls. A combination of four abnormal tests better discriminated the two groups (93.3% specificity). Migraine patients consistently showed abnormal vestibular bedside tests when compared with controls.

  19. CT findings of rectosigmoid carcinoma showing exophytic growth

    International Nuclear Information System (INIS)

    Ohgi, Kazuyuki; Kohno, Atsushi; Higuchi, Mutsumi

    1987-01-01

    CT findings of 7 rectosigmoid carcinomas showing exophytic growth were evaluated. All cases had bulky masses, ranging from 6.0 to 11.5 cm in maximum diameter. All masses were difficult to differentiate from the other pelvic masses on CT, presumably due to their exophytic growth and/or invasion to the surrounding organs. However, 3 out of 7 cases showed diffuse rectosigmoidal wall thickening adjacent to the primary tumor, and it is considered to be valuable in the determination of primary site. All female cases had gynecological symptom such as genital bleeding, due to uterine and/or vaginal invasion. When indeterminate pelvic mass is revealed by CT, rectosigmoid carcinoma should be considered into differential diagnosis. (author)

  20. Preschoolers show less trust in physically disabled or obese informants

    Directory of Open Access Journals (Sweden)

    Sara eJaffer

    2015-01-01

    Full Text Available This research examined whether preschool-aged children show less trust in physically disabled or obese informants. In Study 1, when learning about novel physical activities and facts, 4- and 5-year-olds preferred to endorse the testimony of a physically abled, non-obese informant rather than a physically disabled or obese one. In Study 2, after seeing that the physically disabled or obese informant was previously reliable whereas the physically abled, non-obese one was unreliable, 4- and 5-year-olds did not show a significant preference for either informant. We conclude that in line with the literature on children’s negative stereotypes of physically disabled or obese others, preschoolers are biased against these individuals as potential sources of new knowledge. This bias is robust in that past reliability might undermine its effect on children, but cannot reverse it.