WorldWideScience

Sample records for ray raja clavata

  1. Characterization and isolation of DNA microsatellite primers in Raja clavata L. (thornback ray, Rajidae)

    NARCIS (Netherlands)

    Chevolot, M; Reusch, TBH; Boele-Bos, S; Stam, WT; Olsen, JL

    The thornback ray, Raja clavata, is an elasmobranch (cartilaginous fish). Since the 1950s, its stock has severely declined. In order to investigate the genetic population structure of the species, we developed microsatellite loci. The five loci reported here have eight to 48 alleles per locus and

  2. Reproductive biology of Raja clavata (Elasmobranchii: Rajidae) from Southern Black Sea coast around Turkey

    Science.gov (United States)

    Saglam, Hacer; Ak, Orhan

    2012-06-01

    Specimens of Raja clavata were monthly collected at the coast of Havaalanı (Trabzon/Turkey) from January 2009 to December 2009 at depths between 20 and 40 m. A total of 230 individuals of thornback ray (131 females and 99 males) were collected by bottom trawls during research cruises. Using logistic regression, it was determined that TL at 50% maturity of males was 718 mm TL and of females 746 mm TL. The ovarian fecundity ranged from 27 to 60 yellow follicles in both ovaries. Females carrying egg cases were found in July and October. Variations in the gonadosomatic and hepatosomatic indices indicated a continuous reproductive cycle during the year.

  3. Bioaccumulation of metals and PCBs in Raja clavata.

    Science.gov (United States)

    Torres, Paulo; Tristão da Cunha, Regina; Micaelo, Cristina; Rodrigues, Armindo Dos Santos

    2016-12-15

    The goal of this study was to assess stable isotopes profiles, metals concentration and PCBs in Raja clavata muscle and liver, according to sex and size, and to elucidate its suitability as a Mid-Atlantic biomonitor. The results reflected bioaccumulation and suggested biomagnification processes for As and Hg in muscle tissue. Cd, Cu and Zn were detected in high amounts in liver, Cr, Mn and Rb were relatively stable and low, Pb was not detected and Sr was present in muscle at high levels, decreasing with length. Hg and Se were strongly correlated, suggesting a mitigation role. Both tissues presented low concentrations of PCBs, especially the dioxin-like congeners, although always higher in liver and not correlated with size. None of these contaminants exceed EU legislated limits. However, they need to be monitored given study area's location, volcanic nature and the expected increase of anthropogenic activity related to future prospective mining activities and the establishment of the Transatlantic Trade and Investment Partnership (TTIP) between Europe and the USA. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Recovery of Proteolytic and Collagenolytic Activities from Viscera By-products of Rayfish (Raja clavata

    Directory of Open Access Journals (Sweden)

    José Antonio Vázquez

    2009-12-01

    Full Text Available The aim of this work was to study the recovery of proteolytic and collagenolytic activities from rayfish (Raja clavata viscera wastes. Initially, different parts of the gastrointestinal tract by-products (stomach, duodenum section including pancreas, final intestine were evaluated. The extracts from proximal intestine yielded the highest values of both enzymatic activities. Optimal conditions for protease activity quantification were established at pH = 6, T = 40 °C and incubation time ≤20 min. The mathematical equation used to model the joint effect of pH and temperature led to maximum activity at pH = 8.66 and 59.4 °C, respectively. Overcooled acetone was found to be best option for recovery of enzymatic activities in comparison with ethanol, PEG-4000, ammonium sulphate and ultrafiltration system. Finally, a simple and systematic protocol of partial purification and total recovery of proteases and collagenases was defined.

  5. RAJA Performance Suite

    Energy Technology Data Exchange (ETDEWEB)

    2017-09-01

    The RAJA Performance Suite is designed to evaluate performance of the RAJA performance portability library on a wide variety of important high performance computing (HPC) algorithmic lulmels. These kernels assess compiler optimizations and various parallel programming model backends accessible through RAJA, such as OpenMP, CUDA, etc. The Initial version of the suite contains 25 computational kernels, each of which appears in 6 variants: Baseline SequcntiaJ, RAJA SequentiaJ, Baseline OpenMP, RAJA OpenMP, Baseline CUDA, RAJA CUDA. All variants of each kernel perform essentially the same mathematical operations and the loop body code for each kernel is identical across all variants. There are a few kernels, such as those that contain reduction operations, that require CUDA-specific coding for their CUDA variants. ActuaJ computer instructions executed and how they run in parallel differs depending on the parallel programming model backend used and which optimizations are perfonned by the compiler used to build the Perfonnance Suite executable. The Suite will be used primarily by RAJA developers to perform regular assessments of RAJA performance across a range of hardware platforms and compilers as RAJA features are being developed. It will also be used by LLNL hardware and software vendor panners for new defining requirements for future computing platform procurements and acceptance testing. In particular, the RAJA Performance Suite will be used for compiler acceptance testing of the upcoming CORAUSierra machine {initial LLNL delivery expected in late-2017/early 2018) and the CORAL-2 procurement. The Suite will aJso be used to generate concise source code reproducers of compiler and runtime issues we uncover so that we may provide them to relevant vendors to be fixed.

  6. Occurrence of the Leech, Pontobdella muricata Linnaeus, on Elasmobranch Species in the Northern and Central Adriatic Sea.

    Science.gov (United States)

    Bolognini, Luca; Leoni, Simone; Polidori, Piero; Grati, Fabio; Scarcella, Giuseppe; Pellini, Giulio; Domenichetti, Filippo; Ferrà, Carmen; Fabi, Gianna

    2016-12-01

    This study provides a parasitological analysis of the elasmobranch species caught in the northern and central Adriatic Sea. Sixty-two marine leeches were recorded on 747 individuals of Raja clavata Linnaeus, 1758 (thornback ray), Myliobatis aquila Linnaeus, 1758 (common eagle ray), and Torpedo marmorata Risso, 1810 (marbled torpedo ray) caught in 56 hauls over a 5 yr period. All leeches were identified as Pontobdella muricata, which is a typical ectoparasite of benthic elasmobranchs. The prevalence of infection ranged from 7.11% on R. clavata to 12.00% on M. aquila. The intensity of infection, the preferential sites of attachment to the host, and the periodicity of infection were evaluated.

  7. DNA barcoding unveils skate (Chondrichthyes: Rajidae) species diversity in 'ray' products sold across Ireland and the UK.

    Science.gov (United States)

    Griffiths, Andrew Mark; Miller, Dana D; Egan, Aaron; Fox, Jennifer; Greenfield, Adam; Mariani, Stefano

    2013-01-01

    Skates are widely consumed across the globe, but many large species are subject to considerable concern regarding their conservation and management. Within Europe such issues have recently driven policy changes so that, for the first time, reports of skate landings now have to be made under species-specific names. Total allowable catches have also been established for many groups, which have been set to zero for a number of the most vulnerable species (e.g., Dipturus batis, Raja undulata and Rostoraja alba). Whilst accurate species identification has become an important issue for landings, the sale of skates is still usually made under a blanket term of "skate" or "ray". The matter of identifying species of skate is further complicated by their morphologically conservative nature and the fact that they are commercially valued for their wings. Thus, before sale their bodies are usually discarded (i.e., "winged") and often skinned, making morphological identification impossible. For the first time, DNA barcoding (of the mitochondrial COI gene) was applied to samples of skate wings from retail outlets across the British Isles, providing insight into which species are sold for consumption. A total of 98 wing samples were analysed, revealing that six species were sold; blonde ray (Raja brachyura), spotted ray (Raja montagui), thornback ray (Raja clavata), cuckoo ray (Leucoraja naevus) small-eyed ray (Raja microocellata) and shagreen ray (Leucoraja fullonica). Statistical testing demonstrated that there were significant differences in the species sold in the distinct retail groups which suggests complex drivers behind the patterns of sale in skates. The results also indicate that endangered species are not commonly being passed on to consumers. In addition, the practice of selling skate wings under ambiguous labels is highlighted as it makes it extremely difficult for consumers to exercise a right to avoid species of conservation concern. Interestingly, a single retailer

  8. E S Raja Gopal

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. E S Raja Gopal. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 4 April 2000 pp 37-45 General Article. Critical Opalescence · E S Raja Gopal · More Details Fulltext PDF. Volume 6 Issue 5 May 2001 pp 16-28 General Article.

  9. Multiple paternity analysis in the thornback ray Raja clavata L.

    NARCIS (Netherlands)

    Chevolot, Malia; Ellis, Jim R.; Rijnsdorp, Adriaan D.; Stam, Wytze T.; Olsen, Jeanine L.

    2007-01-01

    Skates (Rajidae) are characterized by slow growth rate, low fecundity, and late maturity and are thus considered to be vulnerable to exploitation. Although understanding mating systems and behavior are important for long-term conservation and fisheries management, this aspect of life history is

  10. Multiple paternity analysis in the Thornback Ray Raja clavata L.

    NARCIS (Netherlands)

    Chevolot, M.; Ellis, J.R.; Rijnsdorp, A.D.; Stam, W.T.; Olsen, J.L.

    2007-01-01

    Skates (Rajidae) are characterized by slow growth rate, low fecundity, and late maturity and are thus considered to be vulnerable to exploitation. Although understanding mating systems and behavior are important for long-term conservation and fisheries management, this aspect of life history is

  11. Raja Servus of Larantuka, Flores, Eastern Indonesia Le raja Servus de Larantuka, à Flores, en Indonésie orientale

    Directory of Open Access Journals (Sweden)

    Robert H. Barnes

    2012-07-01

    Full Text Available The Dutch deposed Raja Lorenzo II of Larantuka, Flores, in 1904 and exiled him to Java. After his son Servus reached maturity, they appointed him Raja. By then the office had largely been reduced to a principally administrative function at the bottom of the colonial bureaucracy, although the Dutch called the rajas in the Dutch East Indies “self-governors”.Servus seems to have been demoralized by an attack on his life which he survived only after six hours of swimming in the sea. Eventually both the Dutch officials and the local Catholic missionaries became dissatisfied with him and he was forced to resign. Later the Dutch were forced to leave and the Indonesian state completed the job of bureaucratizing local administration by abolishing the office of raja.Les Hollandais ont déposé le raja Lorenzo II de Larantuka en 1904 et l’ont exilé à Java. Lorsque son fils Servus a atteint sa maturité, ils l’ont nommé raja. Alors, le poste avait été largement réduit à une fonction surtout administrative au bas de la bureaucratie coloniale, même si les Hollandais appelaient les rajas des Indes orientales Hollandaises « gouverneurs autonomes ». Servus semble avoir perdu le moral après une agression à laquelle il ne survécut qu’après une nage de six heures dans la mer. Au final, il déçut à la fois les fonctionnaires hollandais et les missionnaires catholiques locaux qui l’obligèrent à démissionner. Par la suite, les Hollandais furent contraints au départ et l’état indonésien termina le travail de bureaucratisation de l’administration locale en mettant fin à la fonction de raja.

  12. A new Eastern Central Atlantic skate Raja parva sp. nov. (Rajoidei: Rajidae) belonging to the Raja miraletus species complex.

    Science.gov (United States)

    Last, Peter R; Séret, Bernard

    2016-08-05

    An investigation of combined CO1 and NADH2 data for rajid skates referable to Raja miraletus provided evidence that populations ranging from southern Africa to the North-East Atlantic and Mediterranean Sea, once considered to represent a cline, belong to a species complex consisting of at least four valid species. Raja miraletus appears to be confined to the Mediterranean Sea, and the North-East Atlantic from the Bay of Biscay south to Morocco and Madeira. The southernmost species, referable to the resurrected Raja ocellifera, occurs off southern Africa, off Namibia and from False Bay to Durban (South Africa). Two species occur off tropical West Africa, including Raja parva sp. nov. (Senegal, Liberia and Angola but is probably more widespread within the region), and another unidentified species needing further investigation. Raja cf. miraletus, confirmed from Mauritania and Senegal, appears to be a larger skate with a broader disc, more broadly pointed snout, larger spiracles, and a slightly longer and broader tail. Raja parva sp. nov. differs from nominal members of the complex in having an unusually long procaudal tail (exceeding 22% TL), as well as a combination of other external characters. Past investigators observed morphological and anatomical differences between these forms but these were thought to be due to intraspecific variability. They postulated that an upwelling at Cape Blanco (21°N) may have isolated the Mediterranean form (R. miraletus) from Mauritania-Senegal form (now known to be two species). Similarly, the Benguela Current and upwelling off Cape Frio (18°S) were thought to be responsible for separating the Angolan form (R. parva) and South African form (R. ocellifera).

  13. Penanganan Abrasi Pantai Desa Sei Raja Kabupaten Sukamara Kalimantan Tengah

    OpenAIRE

    Aziz, Mustofa Kamal; Lesmi, Seruni Adidar; Pranoto, Sumbogo; Parmantoro, Priyo Nugroho

    2016-01-01

    The problems of the coastal area in Sei Raja Beach were retreat of the coastline, sedimentation in river mouth of Raja River, destruction of existing shore protection structure such as groin and jetty which was caused of wave. The objective of the final project is to model and to design the right shore structures to protect the shore from abrasion in Sei Raja Beach. The area which planned is around 3,1 km include the river mouth of Raja River. The analysis result of waverose shows that domina...

  14. Rediscovery of Bugulella clavata Hincks 1887 (Ectoprocta)

    Digital Repository Service at National Institute of Oceanography (India)

    Menon, N.R; Nair, N.B.

    The species Bugulella clavata collected from the Krusadai island, Gulf of Mannar is redescribed Description is based on the three fragments of a colony at a depth of 5 m Redescription has helped to important features such as nature and shape...

  15. Synergistic interaction of CLAVATA1, CLAVATA2, and RECEPTOR-LIKE PROTEIN KINASE 2 in cyst nematode parasitism of Arabidopsis

    Science.gov (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ENDOSPERM SURROUNDING REGION (ESR) (CLE)-like effector proteins. These proteins act as ligand mimics of plant CLE peptides and are required for successful nematode infection. Previously, we showed that CLV2 and CORYNE (CRN), a heterodimer recept...

  16. Mohamed Mahroop, Raja M.

    African Journals Online (AJOL)

    Mohamed Mahroop, Raja M. Vol 15, No 38 (2016) - Articles Antibacterial potential of silver nanoparticle synthesized by marine actinomycetes in reference with standard antibiotics against hospital acquired infectious pathogens. Abstract PDF. ISSN: 1684-5315. AJOL African Journals Online. HOW TO USE AJOL.

  17. Gaya Komunikasi Pemasaran di Pemerintah: Promotion Mix Destinasi Tujuan Wisata Kabupaten Raja Ampat

    Directory of Open Access Journals (Sweden)

    Mubaddilah Rafa'al

    2017-03-01

    Full Text Available This study focuses on the description of Promotion marketing mix used by the Department of Culture and Tourism Raja Ampat. This research is interesting because it is a means of marketing communications for the company in order to inform the products to be introduced to tourists, persuade and improve the consumer directly or indirectly about the services they offer. This study aimed to describe the promotion mix used the Department of Culture and Tourism Raja Ampat. In order to know that the Department of Culture and Tourism Raja Ampat has managed to reach the desired rating. The method used in this study using in-depth interview, the quotation in question and answer activities between researchers and resource speakers. With respect to achieving success in the marketing process, the Department of Culture and Tourism Raja Ampat using promotion mix include advertising, sales promotion, public relations, personal selling, direct marketing, and internet marketing.   Keywords: Promotion mix, tourists, Department of Culture and Tourism Raja Ampat

  18. DNA barcoding unveils skate (Chondrichthyes: Rajidae) species diversity in ‘ray’ products sold across Ireland and the UK

    Science.gov (United States)

    Egan, Aaron; Fox, Jennifer; Greenfield, Adam; Mariani, Stefano

    2013-01-01

    Skates are widely consumed across the globe, but many large species are subject to considerable concern regarding their conservation and management. Within Europe such issues have recently driven policy changes so that, for the first time, reports of skate landings now have to be made under species-specific names. Total allowable catches have also been established for many groups, which have been set to zero for a number of the most vulnerable species (e.g., Dipturus batis, Raja undulata and Rostoraja alba). Whilst accurate species identification has become an important issue for landings, the sale of skates is still usually made under a blanket term of “skate” or “ray”. The matter of identifying species of skate is further complicated by their morphologically conservative nature and the fact that they are commercially valued for their wings. Thus, before sale their bodies are usually discarded (i.e., “winged”) and often skinned, making morphological identification impossible. For the first time, DNA barcoding (of the mitochondrial COI gene) was applied to samples of skate wings from retail outlets across the British Isles, providing insight into which species are sold for consumption. A total of 98 wing samples were analysed, revealing that six species were sold; blonde ray (Raja brachyura), spotted ray (Raja montagui), thornback ray (Raja clavata), cuckoo ray (Leucoraja naevus) small-eyed ray (Raja microocellata) and shagreen ray (Leucoraja fullonica). Statistical testing demonstrated that there were significant differences in the species sold in the distinct retail groups which suggests complex drivers behind the patterns of sale in skates. The results also indicate that endangered species are not commonly being passed on to consumers. In addition, the practice of selling skate wings under ambiguous labels is highlighted as it makes it extremely difficult for consumers to exercise a right to avoid species of conservation concern. Interestingly, a

  19. DNA barcoding unveils skate (Chondrichthyes: Rajidae species diversity in ‘ray’ products sold across Ireland and the UK

    Directory of Open Access Journals (Sweden)

    Andrew Mark Griffiths

    2013-08-01

    Full Text Available Skates are widely consumed across the globe, but many large species are subject to considerable concern regarding their conservation and management. Within Europe such issues have recently driven policy changes so that, for the first time, reports of skate landings now have to be made under species-specific names. Total allowable catches have also been established for many groups, which have been set to zero for a number of the most vulnerable species (e.g., Dipturus batis, Raja undulata and Rostoraja alba. Whilst accurate species identification has become an important issue for landings, the sale of skates is still usually made under a blanket term of “skate” or “ray”. The matter of identifying species of skate is further complicated by their morphologically conservative nature and the fact that they are commercially valued for their wings. Thus, before sale their bodies are usually discarded (i.e., “winged” and often skinned, making morphological identification impossible. For the first time, DNA barcoding (of the mitochondrial COI gene was applied to samples of skate wings from retail outlets across the British Isles, providing insight into which species are sold for consumption. A total of 98 wing samples were analysed, revealing that six species were sold; blonde ray (Raja brachyura, spotted ray (Raja montagui, thornback ray (Raja clavata, cuckoo ray (Leucoraja naevus small-eyed ray (Raja microocellata and shagreen ray (Leucoraja fullonica. Statistical testing demonstrated that there were significant differences in the species sold in the distinct retail groups which suggests complex drivers behind the patterns of sale in skates. The results also indicate that endangered species are not commonly being passed on to consumers. In addition, the practice of selling skate wings under ambiguous labels is highlighted as it makes it extremely difficult for consumers to exercise a right to avoid species of conservation concern

  20. Organizational Conflict In Local Management Budget Planning In Raja Ampat Regency

    Directory of Open Access Journals (Sweden)

    Baba

    2015-01-01

    Full Text Available ABSTRACT Local government leadership in Raja Ampat based on the writers observation yet effectively perform conflict resolution organizations in the area of financial management. This is evident from the acquisition of predicate disclaimer that occur repeatedly. Disclaimer predicate occurs repeatedly in the area of financial management in Raja Ampat because the local government leadership has not been effective in reducing conflicts that have a negative effect on the performance of individuals and the performance of positions in all SKPDs not implementing more effective management strategies in order to moderate the conflict related to disagreements about the task policy and other organizational issues and less effective in stimulating the learning process SKPDs level with regard to financial management area. Based on the above description organizational conflict studies in the area of financial management in Raja Ampat is important and urgent to do. The importance of this study because of financial management in Raja Ampat still face the task of conflict situations and conflict relations in the budget planning. The purpose of this study is to 1 Describe the forms of organizational conflicts in planning budget in Raja Ampat.2 Describe the sources of conflict in the organization of planning budget in Raja Ampat. 3 Analyze the conflict resolution organizations in planning budget in Raja Ampat. Based on several conclusions can be drawn as follows 1In the budget planning are forms of task conflict and relationship conflict. 2 Sources of conflict in the budget planning is the difference in the organizations goals criteria that do not work worth it and the inequality of treatment between sub-units. 3 Conflict resolution is a budget planning by providing an understanding of the meaning-Term Development Plan and the area and ask for advice and input from the Regent to accommodate the pricing to be more flexible to adjust to market conditions and the

  1. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata

    OpenAIRE

    Elahi, Robin

    2005-01-01

    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in w...

  2. Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE

    Science.gov (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ESR(CLE)-like effector proteins. These proteins have been shown to act as ligand mimics of plant CLE peptides and are required for successful nematode infection; however, the receptors for nematode CLE-like peptides have not been identified. Her...

  3. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata.

    Science.gov (United States)

    Elahi, Robin

    2005-11-18

    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in wet and dry habitat; significantly more colonies were found in dry habitat. Seventeen of 19 nests built on slopes of > 5 degrees inclination were positioned on the downward side of the tree, possibly using the trunk as a shield against runoff during rain showers. Moisture and pH inside nests were significantly different from adjacent soil. These results suggest that water influences the ground nesting habits of P. clavata, thus ecological differences between comparatively wet and dry portions of tropical forests may arise from the relative abundance of this ant species.

  4. Raja klooster Peipsi ääres Raja külas / Olev Suuder

    Index Scriptorium Estoniae

    Suuder, Olev, 1949-

    2005-01-01

    Peipsi-äärsete vene vanausuliste küladest, kirikutest, Raja kloostrist. Palvela projekteeris 1902. a. W. Schilling, 1912. a. ehitati viie kupliga kirik. Ikoonimaalija Gavriil Jefimovitsh Frolovist (1854-1939), kes avas palvelas ikoonimaalimiskooli ja maalis uue kiriku ikonostaasi. Palvela fassaadide restaureerimisest, kiriku vundamendi ja põranda konserveerimisest, haljastuse kujundamisest. Uuringud: Maret Eimre, Kaja Onton. Arhitektuurne projekt: K. Onton. Teostus: Wunibald. Kirik ja kirikuaed: eritingimused ja haljastusprojekt: Kati Niibo. Teostus: Cobra Grupp. Muinsuskaitseline järelevalve: Olev Suuder. 6 ill

  5. To drink or grasp? How bullet ants ( Paraponera clavata) differentiate between sugars and proteins in liquids

    Science.gov (United States)

    Jandt, Jennifer; Larson, Hannah K.; Tellez, Peter; McGlynn, Terrence P.

    2013-12-01

    Flexibility in behavior can increase the likelihood that a forager may respond optimally in a fluctuating environment. Nevertheless, physiological or neuronal constraints may result in suboptimal responses to stimuli. We observed foraging workers of the giant tropical ant (also referred to as the "bullet ant"), Paraponera clavata, as they reacted to liquid solutions with varying concentrations of sugar and protein. We show that when protein/sucrose concentration is high, many bullet ants will often try to grasp at the droplet, rather than gather it by drinking. Because P. clavata actively hunt for prey, fixed action patterns and rapid responses to protein may be adaptively important, regardless of the medium in which it is presented. We conclude that, in P. clavata, food-handling decisions are made in response to the nutrient content of the food rather than the texture of the food. Further, we suggest that colonies that maintain a mixture of individuals with consistent fixed or flexible behavioral responses to food-handling decisions may be better adapted to fluctuating environmental conditions, and we propose future studies that could address this.

  6. A quantification of predation rates, indirect positive effects on plants, and foraging variation of the giant tropical ant, Paraponera clavata

    Directory of Open Access Journals (Sweden)

    Lee A. Dyer

    2002-09-01

    Full Text Available While a clear consensus is emerging that predators can play a major role in shaping terrestrial communities, basic natural history observations and simple quantifications of predation rates in complex terrestrial systems are lacking. The potential indirect effect of a large predatory ant, Paraponera clavata Fabricius (Formicidae: Ponerinae, on herbivores was determined on rainforest trees at La Selva Biological Station in Costa Rica and Barro Colorado Island in Panama. Prey and other food brought back to nests by 75 colonies of P. clavata were quantified, taking into account temporal, seasonal, and microhabitat variation for both foraging activity and composition of foraging booty. The dispersion and density of ant colonies and combined density with the mean amounts of prey retrieval were used to calculate rates of predation per hectare in the two forests. In addition, herbivory was measured on trees containing P. clavata and on trees where the ants were not foraging. Colonies at La Selva brought back significantly more nectar plus prey than those at Barro Colorado Island, but foraging patterns were similar in the two forests. At both forests, the ants were more active at night, and there was no significant seasonal or colonial variation in consumption of nectar, composition of foraging booty, and overall activity of the colonies. At La Selva, trees containing P. clavata colonies had the same levels of folivory as nearest neighbor trees without P. clavata but had significantly lower folivory than randomly selected trees. Predation by this ant was high in both forests, despite its omnivorous diet. This insect predator is part of potentially important top-down controls in these wet and moist forests.

  7. The complete mitochondrial genome of the Longnose skate: Raja rhina (Rajiformes, Rajidae).

    Science.gov (United States)

    Jeong, Dageum; Lee, Youn-Ho

    2015-02-01

    The complete sequence of mitochondrial DNA of a longnose skate, Raja rhina was determined for the first time. It is 16,910 bp in length containing 2 rRNA, 22 tRNA and 13 protein coding genes with the same gene order and structure as those of other Rajidae species. The nucleotide of L-strand is composed of 30.1% A, 27.2% C, 28.5% T and 14.2% G, showing a slight A + T bias. The G is the least used base and markedly lower at the third codon position (5.4%). Twelve of the 13 protein coding genes use ATG as their start codon while the COX1 starts with GTG. As for stop codon, only ND4 shows incomplete stop codon TA. This mitogenome is the first report for a species of the genus Raja, and providing a valuable resource of genetic information for understanding the phylogenetic relationship and the evolution of the genus Raja as well as the family, Rajidae.

  8. SIMBOL RAMA DAN EPOS RAMAYANA BAGI RAJA DAN MASYARAKAT JAWA

    Directory of Open Access Journals (Sweden)

    Wachid Eko Purwanto

    2015-06-01

    Full Text Available Epos Ramayana merupakan epos kuno yang ditulis dalam tujuh kanda terdiri atas 24.000 sloka. Di Jawa epos Ramayana pertama kali muncul secara lengkap dalam bentuk relief di Candi Lara Jonggrang yang dibangun sekitar tahun 782 hingga 872 M. Epos tua yang hidup di masyarakat Jawa ini pastilah mempunyai ajaran. Tokoh Rama sebagai tokoh utama merupakan simbol paling utama dalam epos ini. Berkait dengan simbol ajaran, tokoh Rama dalam epos Ramayana Jawa mempunyai fungsi bagi Raja Jawa dan masyarakat Jawa. Bagi raja simbol tokoh Rama memiliki tiga fungsi utama. Pertama sebagai fungsi spiritual. Kedua adalah fungsi legitimasi kekuasaan. Ketiga adalah fungsi pencitraan. Adapun bagi masyarakat Jawa, simbol tokoh Rama memiliki dua fungsi utama. Pertama adalah fungsi spiritual. Kedua adalah fungsi filosofis.

  9. Checklist of Macroalgae in Waisai Coast, Raja Ampat

    Directory of Open Access Journals (Sweden)

    Retno Suryandari

    2016-05-01

    Full Text Available Macroalgae are very abundant organisms in Indonesian coastal zone. They comprise 8.6% of the total marine organisms.The aim of the research was to identify macroalgae in Waisai Coast Raja Ampat. The results showed that 38 macroalgae were found in Waisai Coast Raja Ampat but only 29 species of macroalgae can be identified. Macroalgae found in Waisai Coast Raja Ampat are green algae, red algae and brown algae. Green algae found and identified are Caulerpa macra (Weber-van Bosse Draisma & Prud’homme, Caulerpa racemosa var. macrophysa (Sonder wx Kutzing W.R.Taylor,  Caulerpa sertularoides (S. Gmelin Howe f. brevipes (J. Agardh Svedilus, Caulerpa cupressoides (Vahl C. Agardh, Halimeda discoidea Decaisne, Halimeda Opuntia (Linnaeus J.V. Lamoroux, Halimeda tuna (J. Ellis & Solander J.V. Lamoroux, Halimeda cylindraceae Decaisne, Halimeda macroloba Decaisne, Avrainvillea erecta (Berkeley A. Gepp & E.S. Gepp, Codium geppiorum O.C.Schmidt, Boergesenia forbesii (Hardvey Feldmann, Valonia ventricosa J. Agardh, Dictyosphaeria cavernosa (Forsskål Børgesen, Chaetomorpha spiralisOkamura, Anadyomene wrightii Harvey ex. J. E. Gray, Neomeris annulata Dickie. Red algae species found and successfully identified areAcanthophora spicifera (M. Vahl Børgesen, Laurencia papilosa (C. Agardh Greville, Gracilaria salicornia (C. Agardh E.Y. Dawson, Amphiora fragilissima (Linnaeus J.V. Lamoroux, Hypnea pannosa J. Agardh. Brown algae species  found and identified are Hormophysa cuneiformis (J.F. Gmelin P.C. Silva, Sargassum aquifolium (Turner C. Agardh, Sargassum polycystum C. Agardh, Turbinaria ornata (Turner J. Agardh, Padina australis Hauck, Canistrocarpus cervicornis (Kutzing De Paula & De Clerck Hydroclathrus clatratus (C. Agardh M. Howe. The only species found in Indonesia is Sargassum aquifolium.

  10. Raja ja Kallas - mehed Šebrle selja taga / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-

    2008-01-01

    Üheteistkümnendat korda toimuval Reval Hotels Cupi mitmevõistlusel on pearollis elav legend tšehh Roman Šebrle, kellega Eesti parematest hakkavad rinda pistma Andres Raja ja Madis Kallas. Lisa: Reval Cupi ajaloo paremad tulemused

  11. Life history and viability of a long-lived marine invertebrate: the octocoral Paramuricea clavata.

    Science.gov (United States)

    Linares, Cristina; Doak, Daniel F; Coma, Rafel; Díaz, David; Zabala, Mikel

    2007-04-01

    The red gorgonian Paramuricea clavata is a long-lived, slow-growing sessile invertebrate of ecological and conservation importance in the northwestern Mediterranean Sea. We develop a series of size-based matrix models for two Paramuricea clavata populations. These models were used to estimate basic life history traits for this species and to evaluate the viability of the red gorgonian populations we studied. As for many other slow-growing species, sensitivity and elasticity analysis demonstrate that gorgonian population growth is far more sensitive to changes in survival rates than to growth, shrinkage, or reproductive rates. The slow growth and low mortality of red gorgonians results in low damping ratios, indicating slow convergence to stable size structures (at least 50 years). The stable distributions predicted by the model did not differ from the observed ones. However, our simulations point out the fragility of this species, showing both populations in decline and high risk of extinction over moderate time horizons. These declines appear to be related to a recent increase in anthropogenic disturbances. Relative to their life span, the values of recruitment elasticity for Paramuricea clavata are lower than those reported for other marine organisms but are similar to those reported for some long-lived plants. These values and the delayed age of sexual maturity, in combination with the longevity of the species, show a clear fecundity/mortality trade-off. Full demographic studies of sessile marine species are quite scarce but can provide insight into population dynamics and life history patterns for these difficult and under-studied species. While our work shows clear results for the red gorgonian, the variability in some of our estimates suggest that future work should include data collection over longer temporal and spatial scales to better understand the long-term effects of natural and anthropogenic disturbances on red gorgonian populations.

  12. Relationship between radiocesium contamination and the contents of various elements in the web spider Nephila clavata (Nephilidae: Arachnida)

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato

    2015-01-01

    The accident at the Fukushima Dai-ichi nuclear power plant seriously contaminated a large area in northeast Japan with a large amount of radioactive material. Consequently, various organisms, including arthropods, in the ecosystem have been contaminated with radiocesium ("1"3"7Cs) through the food chain. We previously showed that the web spider Nephila clavata was contaminated with "1"3"7Cs and that the level of contamination, which varied among spider individuals, was independent of the amount of prey consumed. The present study aimed to clarify the mechanisms that could determine the level of "1"3"7Cs contamination in N. clavata. We first demonstrated the patterns of contents of over 30 elements in N. clavata that were collected at two forest sites (PS and ES) in Fukushima and then focused on the relationships between the contents of the alkali metals Li, Na, K, and Rb and the accumulation of "1"3"7Cs in the spiders; Cs is an alkali metal and is expected to act similarly to Li, Na, K, and Rb. We also focused on the content of the non-alkali element, Cu, which is an essential element for oxygen transport in spiders. We found that Na content correlated positively with "1"3"7Cs accumulation at both sites, which suggested that "1"3"7Cs accumulation in N. clavata was related with the dynamics of Na. The K–, Rb–, and Cu–"1"3"7Cs relationships were site specific; the relationships were significant at site PS, but not significant at site ES. Factors causing the site specific relationships and the probable pathway for "1"3"7Cs transfer from soil to plants and then to higher trophic levels are discussed in terms of the transfer processes of the alkali metals. - Highlights: • Accumulation of "1"3"7Cs and various elements in web spiders was investigated. • "1"3"7Cs accumulation positively correlated with that of K, Rb, Na, and Cu. • Accumulation of alkali metals determined the level of "1"3"7Cs contamination. • K–, Rb–, Cu–"1"3"7Cs relationships were

  13. Molecular Identification and Genetic Diversity of Acropora hyacinthus from Boo and Deer Island, Raja Ampat, West Papua

    Science.gov (United States)

    Wijayanti, DP; Indrayanti, E.; Nuryadi, H.; Dewi, RA; Sabdono, A.

    2018-02-01

    Indonesia lies at the centre of biodiversity for corals. However, the reefs suffered from extensive human exploitation. Marine Protected Areas is thought to be best solution to protect coral reefs ecosystem. Understanding genetic diversity is crucial for effective management of the MPAs, however genetic diversity is rarely been corporate in designing an MPA. Moreover, many MPAs are uneffectively manage due to poor designated and demarcated.Raja Ampat which is located in western tip of West Papua, was designated as a park to mitigatethreatsand protect the valuable marine resources.Scleractinian corals in the genus Acropora are among the most dominant distributed in Raja Ampat waters, including the species of Acroporahyacinthus. The research aimed to analyze genetic diversity and to describe the kinship relationship of Acroporahyacinthus between 2 populations: Boo Island and Deer Island, Raja Ampat. Genetic marker Cytochrome Oxidase I (CO I) of the mitochondrial genome DNA (mtDNA) was used to analyze genetic diversity. Reconstruction of phylogenetic tree and genetic diversity were made by usingsoftware MEGA 5.05 (Moleculer Evolutionary Genetics Analysis). The results of this research indicatecorals A. hyacinthus from Boo Island and Deer Island Raja Ampat are in the low category of genetic diversity and overall had a close genetic relationship of kinship. This is likely due to the small size of the population and few numbers of samples that may not represent the population.

  14. The biology of the skates raja wallacei and r.pullopunctata (batoidea ...

    African Journals Online (AJOL)

    Aspects of the biology of Raja wallacei and R. pullopunctata were investigated using data collected in 1995 and 1996 from research and commercial trawls on the Agulhas Bank, South Africa. Age and growth parameters were investigated by examination of bands on the vertebral centrum. Estimates of Von Bertalanffy ...

  15. Synthesis, X-ray crystal structure, DNA binding and Nuclease activity ...

    Indian Academy of Sciences (India)

    s12039-016-1125-x. Synthesis, X-ray crystal structure, DNA binding and Nuclease activity of lanthanide(III) complexes of 2-benzoylpyridine acetylhydrazone. KARREDDULA RAJA, AKKILI SUSEELAMMA and KATREDDI HUSSAIN REDDY. ∗.

  16. Cryptic marine biota of the Raja Ampat island group : Preliminary results of the Raja Ampat Expedition , Ekspedisi Widya Nusantara (E-Win) of the Indonesian Institute of Sciences (LIPI)

    NARCIS (Netherlands)

    Hoeksema, B.W.; Meij, van der S.E.T.

    2008-01-01

    The Raja Ampat expedition in 2007 was organized by the National Museum of Natural History Naturalis in Leiden in cooperation with the Research Centre for Oceanography (RCO-LIPI, Jakarta) as part of Ekspedisi Widya Nusantara (E-Win expedition) of the Indonesian Institute of Sciences (LIPI). The

  17. Nephila clavata L Koch, the Joro Spider of East Asia, newly recorded from North America (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    E. Richard Hoebeke

    2015-02-01

    Full Text Available Nephila clavata L Koch, known as the Joro spider and native to East Asia (Japan, China, Korea, and Taiwan, is newly reported from North America. Specimens from several locations in northeast Georgia were collected from around residential properties in Barrow, Jackson, and Madison counties in late October and early November 2014. These are the first confirmed records of the species in the New World. Our collections, along with confirmed images provided by private citizens, suggest that the Joro spider is established in northeast Georgia. Genomic sequence data for the COI gene obtained from two specimens conforms to published sequences for N. clavata, providing additional confirmation of species identity. Known collection records are listed and mapped using geocoding. Our observations are summarized along with published background information on biology in Asia and we hypothesize on the invasion history and mode of introduction into North America. Recognition features are given and photographic images of the male and female are provided to aid in their differentiation from the one native species of the genus (Nephila clavipes in North America.

  18. Application of Cold Storage for Raja Sere Banana (Musa acuminata colla)

    Science.gov (United States)

    Crismas, S. R. S.; Purwanto, Y. A.; Sutrisno

    2018-05-01

    Raja Sere is one of the indigenous banana cultivars in Indonesia. This cultivar has a yellow color when ripen, small size and sweet taste. Traditionally, the growers market this banana cultivar to the market without any treatment to delay the ripening process. Banana fruits are commonly being harvested at the condition of hard green mature. At this condition of hard green mature, banana fruits can be stored for a long-term period. The objective of this study was to examine the effect of cold storage on the quality of raja sere banana that stored at 13°C. Banana fruits cultivar Raja Sere were harvested from local farmer field at the condition of hard green mature (about 14 weeks age after the flower bloom). Fifteen bunches of banana were stored in cold storage with a temperature of 13°C for 0, 3, 6, 9, and 12 days, respectively. For the control, room temperature storage (28°C) was used. At a storage period, samples of banana fruits ripened in the ripening chamber by injecting 100 ppm of ethylene gas at 25°C for 24 hours. The quality parameters namely respiration rate, hardness, total soluble solids (TSS), change in color, and weight loss were measured. For those banana fruits stored at room temperature, the shelf-life of banana was only reached up to 6 days. For those banana fruits stored in cold storage, the condition of banana fruits was reached up to 12 days. After cold storage and ripening, the third day measurement was the optimal time for bananas to be consumed which indicated by the yellow color (lightness value = 68.51, a* = 4.74 and value b* = 62.63), TSS 24.30 °Brix and hardness 0.48 kgf, weight loss about 7.53-16.45% and CO2 respiration rate of 100.37 mLCO2 / kg.hr.

  19. Complete mitochondrial genome of the mottled skate: Raja pulchra (Rajiformes, Rajidae).

    Science.gov (United States)

    Jeong, Dageum; Kim, Sung; Kim, Choong-Gon; Myoung, Jung-Goo; Lee, Youn-Ho

    2016-05-01

    The complete sequence of mitochondrial DNA of a mottled skate, Raja pulchra was sequenced as being circular molecules of 16,907 bp including 2 rRNA, 22 tRNA, 13 protein-coding genes (PCGs), and an AT-rich control region. The organization of the PCGs is the same as those found in other Rajidae species. The nucleotide of L-strand is composed of 29.8% A, 28.0% C, 27.9% T, and 14.3% G with a bias toward A + T slightly. Twelve of 13 PCGs are initiated by the ATG codon while COX1 starts with GTG. Only ND4 harbors the incomplete termination codon, TA. All tRNA genes have a typical clover-leaf structure of mitochondrial tRNA with the exception of [Formula: see text] which has a reduced DHU arm. This mitogenome will provide essential information for better phylogenetic resolution and precision of the family Rajidae and the genus Raja as well as for establishment of a fish stock recovery plan of the species.

  20. Eile avati Harku vallas Raja tööstuskeskuse uus juurdepääsutee

    Index Scriptorium Estoniae

    2003-01-01

    Kahe Harku valla ettevõtte algatusel ja riigi toel sai Raja tööstuskeskus Tabasalus kaasaegse juurdepääsutee, rahastasid Ettevõtluse Arendamise Sihtasutus ning eraettevõtted Greiner Packaging ja Palmatin

  1. Recent progress in accelerator activities at Raja Ramanna Centre for Advanced Technology, Indore

    International Nuclear Information System (INIS)

    Gupta, P.D.

    2013-01-01

    Raja Ramanna Centre for Advanced Technology, Indore is a premier national institute engaged in R and D work in front-line areas of accelerator science, technology, and applications. The Centre has designed, developed, and commissioned two synchrotron radiation sources: Indus-1 and Indus-2, serving as national facilities. The Centre is pursuing various other accelerator activities viz. development of a high energy proton accelerator for a spallation neutron source, electron accelerators for food irradiation and industrial applications and free electron lasers (FEL) in THz and IR spectral region, study of innovative schemes of laser driven electron acceleration, and development of advanced technologies to support these activities such as superconducting RF (SCRF) technology, cryogenics, RF power, magnets, ultra high vacuum and control instrumentation. In this talk, an overview of the progress made in accelerator activities at Raja Ramanna Centre for Advanced Technology in recent years is be presented

  2. Solid-phase synthesis and biological evaluation of Joro spider toxin-4 from Nephila clavata

    DEFF Research Database (Denmark)

    Barslund, Anne Fuglsang; Poulsen, Mette Homann; Bach, Tinna Brøbech

    2011-01-01

    Polyamine toxins from orb weaver spiders are attractive pharmacological tools particularly for studies of ionotropic glutamate (iGlu) receptors in the brain. These polyamine toxins are biosynthesized in a combinatorial manner, providing a plethora of related, but structurally complex toxins...... to be exploited in biological studies. Here, we have used solid-phase synthetic methodology for the efficient synthesis of Joro spider toxin-4 (JSTX-4) (1) from Nephila clavata, providing sufficient amounts of the toxin for biological evaluation at iGlu receptor subtypes using electrophysiology. Biological...

  3. In planta processing and glycosylation of a nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-like effector and its interaction with a host CLAVATA2-like receptor to promote parasitism.

    Science.gov (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S; Mitchum, Melissa G; Wang, Xiaohong

    2015-01-01

    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. © 2015 American Society of Plant Biologists. All Rights Reserved.

  4. Bilirubin metabolism in the spiny dogfish, Squalus acanthias, and the small skate, Raja erinacea

    NARCIS (Netherlands)

    Jansen, P. L.; Arias, I. M.

    1977-01-01

    1. The main bilirubin conjugate in bile of spiny dogfish (Squalus Acanthias) and small skate (Raja Erinacea) is bilirubin monoglucuronide. 2. Microsomal preparations from dogfish and small skate liver have similar bilirubin UDPglucuronyltransferase (UDPGT) activity and catalyze the conjugation of

  5. Ammolagena clavata (Jones and Parker, 1860), an agglutinated benthic foraminiferal species - first report from the Recent sediments, Arabian Sea, Indian Ocean region

    Digital Repository Service at National Institute of Oceanography (India)

    Nigam, R.; Mazumder, A.; Saraswat, R.

    The rare presence of the agglutinated foraminiferal species Ammolagena clavata is presented for the first time from the Recent sediments of the Indian Ocean region. This species has previously been reported in Recent sediments from all other oceans...

  6. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  7. In Planta Processing and Glycosylation of a Nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-Like Effector and Its Interaction with a Host CLAVATA2-Like Receptor to Promote Parasitism1[OPEN

    Science.gov (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S.; Mitchum, Melissa G.

    2015-01-01

    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. PMID:25416475

  8. Identification of potential essential fish habitats for skates based on fishers' knowledge.

    Science.gov (United States)

    Serra-Pereira, Bárbara; Erzini, Karim; Maia, Catarina; Figueiredo, Ivone

    2014-05-01

    Understanding of spatio-temporal patterns of sensitive fish species such as skates (Rajidae) is essential for implementation of conservation measures. With insufficient survey data available for these species in Portuguese Continental waters, this study shows that fishery-dependent data associated with fishers' knowledge can be used to identify potential Essential Fish Habitats (EFH) for seven skate species. Sites with similar geomorphology were associated with the occurrence of juveniles and/or adults of the same group of species. For example, sites deeper than 100 m with soft sediment include predominantly adults of Raja clavata, and are the habitat for egg deposition of this species. Raja undulata and R. microocellata are the more coastal species, preferring sand or gravel habitats, while coastal areas with rocks and sand seabed are potential nursery areas for R. brachyura, R. montagui and R. clavata. The main output of this study is the identification of preferential fishing sites enclosing potential EFH for some species, associated with egg-laying and nursery grounds. The location of these areas will be considered for future seasonal closures, and studies will be conducted to evaluate the biological and socio-economic impacts of such measures. As in the past, fishermen will collaborate in the process of evaluating those impacts, since they have practical and applied knowledge that is extremely valuable for evaluating the advantages and disadvantages of such closures. In conclusion, this study is a first contribution to the understanding and identification of EFH for skate species, associated with nursery and egg deposition sites, with direct application to management.

  9. Identification of Potential Essential Fish Habitats for Skates Based on Fishers' Knowledge

    Science.gov (United States)

    Serra-Pereira, Bárbara; Erzini, Karim; Maia, Catarina; Figueiredo, Ivone

    2014-05-01

    Understanding of spatio-temporal patterns of sensitive fish species such as skates (Rajidae) is essential for implementation of conservation measures. With insufficient survey data available for these species in Portuguese Continental waters, this study shows that fishery-dependent data associated with fishers' knowledge can be used to identify potential Essential Fish Habitats (EFH) for seven skate species. Sites with similar geomorphology were associated with the occurrence of juveniles and/or adults of the same group of species. For example, sites deeper than 100 m with soft sediment include predominantly adults of Raja clavata, and are the habitat for egg deposition of this species. Raja undulata and R. microocellata are the more coastal species, preferring sand or gravel habitats, while coastal areas with rocks and sand seabed are potential nursery areas for R. brachyura, R. montagui and R. clavata. The main output of this study is the identification of preferential fishing sites enclosing potential EFH for some species, associated with egg-laying and nursery grounds. The location of these areas will be considered for future seasonal closures, and studies will be conducted to evaluate the biological and socio-economic impacts of such measures. As in the past, fishermen will collaborate in the process of evaluating those impacts, since they have practical and applied knowledge that is extremely valuable for evaluating the advantages and disadvantages of such closures. In conclusion, this study is a first contribution to the understanding and identification of EFH for skate species, associated with nursery and egg deposition sites, with direct application to management.

  10. Kecernaan Pakan Berbentuk Pelet Mengandung Kulit Pisang Raja Fermentasi Dengan Mikroorganisme Lokal Dibandingkan Dengan Trichoderma harzianum Pada Kelinci Rex Jantan Lepas Sapih

    OpenAIRE

    Ginting, Julius Syah Putra

    2014-01-01

    Utilization of Raja banana peel can be maximized by fermentation method. The objective of research was to determine the effect of utilization fermented raja banana peel in rations of weaning males rex rabbit. The research had been conducted in the Laboratory of Animal Biology Livestock Studies Program, Agriculture faculty of North Sumatera University from Agustust 2013 until November 2013. This research was used 21 Rex rabbit, mutual average body weights 732±66,74 g. The design was used compl...

  11. Modelling the spatial distribution of plaice ( Pleuronectes platessa), sole ( Solea solea) and thornback ray ( Raja clavata) in UK waters for marine management and planning

    Science.gov (United States)

    Maxwell, D. L.; Stelzenmüller, V.; Eastwood, P. D.; Rogers, S. I.

    2009-04-01

    Species distribution maps are needed for ecosystem-based marine management including the development of marine spatial plans. If such maps are based on predictive models then modelling procedures should aim to maximise validation success, and any uncertainty in the predictions needs to be made explicit. We developed a predictive modelling approach to produce robust maps of the distributions of selected marine species at a regional scale. We used 14 years of survey data to map the distributions of plaice, sole and thornback ray in three hydrographic regions comprising parts of the Irish Sea, Celtic Sea and the English Channel with the help of the hybrid technique regression kriging, which combines regression models with geostatistical tools. For each species-region combination we constructed logistic Generalized Linear Models (GLMs) based on presence-absence data using the environmental variables: depth, bottom temperature, bed shear stress and sediment type, as predictors. We selected GLMs using the mean squared error of prediction (MSEP) estimated by cross-validation then conducted a geostatistical analysis of the residuals to incorporate spatial structure in the predictions. In general, we found that species occurrence was positively related to shallow areas, a bed shear stress of between 0 and 1.5 N/m 2, and the presence of sandy sediment. Predicted species occurrence probabilities were in good agreement with survey observations. This modelling framework selects environmental models based on predictive ability and considers the effect of spatial autocorrelation on predictions, together with the simultaneous presentation of observations, associated uncertainties, and predictions. The potential benefit of these distribution maps to marine management and planning is discussed.

  12. PENGEMBANGAN ENERGI TERBARUKAN MELALUI EVALUASI PROGRAM KONVERSI MINYAK TANAH KE LPG DI PULAU GILI RAJA-SUMENEP (Developing Renewable Energy Through An Evaluation for A Program of Kerosene Conversion to LPG in Gili Raja Island - Sumenep

    Directory of Open Access Journals (Sweden)

    Nian Riawati

    2014-10-01

    Full Text Available ABSTRAK Penelitian ini mengevaluasi program konversi minyak tanah ke Liquefied Petroleum Gas (LPG pada kelompok sasaran di pulau Gili Raja kabupaten Sumenep Jawa Timur. Kajian sebelumnya terhadap program ini masih bersifat formatif dengan fokus efisiensi dan efektivitas implementasi. Dengan menggunakan metode Minimum Evaluation Procedure (MEP penelitian ini mempertanyakan implementasi program secara runtut, mulai output, outcome sampai impact. Melalui pendekatan kualitatif penelitian ini dapat mendeskripsikan konteks dan setting secara alamiah. Hasil penelitian menunjukkan adanya pungutan dalam proses distribusi paket program, rendahnya akses atau penggunaan paket program serta tidak adanya dampak program. Selain itu, ditemukan adanya potensi lokal berupa kotoran ternak yang dapat dikembangkan menjadi sumber daya energi terbarukan. Berdasarkan hal itu, disarankan sebuah program dapat dikembangkan secara asimetris sesuai dengan kondisi lokasi dan kelompok sasaran, terjadinya komunikasi intensif antara pelaksana program dengan kelompok sasaran serta stakeholders lainnya. Berdasarkan potensi kelompok sasaran di pulau Gili Raja, hendaknya dikembangkan kebijakan energi alternatif biogas untuk memenuhi kebutuhan energi masyarakat serta mendukung pencapaian tujuan kebijakan energi nasional.   ABSTRACT The purpose of this research is to evaluate the conversion programfrom kerosene to Liquefied Petroleum Gas (LPG on a target group in Gili Raja island of SumenepMunicipal, East Java. Previous study on this program was quite formative one and focusing on the efficiency and the effectiveness of the program implementation. In addition, by applying Minimum Evaluation Procedure’s (MEP method, this research questioned the implementation of the program consecutively from the output, the outcome as well as the impact. Furthermore, through a qualitative approach, this research will be able to describe context and setting naturally. Result of the research shows

  13. X-ray absorption spectroscopy of U (VI) sorbed onto alumina

    International Nuclear Information System (INIS)

    Kumar, Sumit; Jain, Aishwarya; Tomar, B.S.; Manchanda, V.K.; Poswal, A.K.; Jha, S.N.; Sabharwal, S.C.

    2009-01-01

    Sorption of U (VI) by alumina varying pH has been studied by X-ray absorption Spectroscopy. The experiments were carried out using the EXAFS beamline (BL-8) of INDUS-2 at Raja Ramanna Centre for Advanced Technology, Indore. The absorption intensity was found to increase with the increasing pH of the suspension. (author)

  14. Incorporating Local Wisdom Sasi into Marine Zoning to Increase the Resilience of a Marine Protected Area Network in Raja Ampat, Indonesia.

    Science.gov (United States)

    Purwanto, P., Jr.; Mangubhai, S.; Muhajir, M.; Hidayat, N. I.; Rumetna, L.; Awaludinnoer, A.; Thebu, K.

    2016-02-01

    The Raja Ampat government and local communities established 6 Marine Protected Areas (MPAs) in 2007 to protect the unique marine biodiversity and ensure sustainable fisheries in West Papua, Indonesia. Increasing human populations resulting in overfishing and the use of destructive fishing practices are the main threats and challenges the region faces. Biophysical, socioeconomic and climate change criteria and factors were developed for zoning the Raja Ampat MPA network. Resilience principles such as replication, habitat representation, protection of critical habitat and connectivity were applied to the final zoning design. Reef resilience data using global monitoring protocols were collected to provide insights into the resilience of different reefs to further guide zoning. Resilience rankings showed that fishing pressure on reef fish communities especially on piscivores, herbivores and excavators was the main factor lowering resilience in MPAs. In addition data were collected on `sasi' areas throughout the MPAs. Sasi is a type of traditional resource management practice used by local communities to open and close areas to fishing single or multiple fisheries species. Once the fishery recovers local communities then harvest the species for food or sale. Raja Ampat MPAs network managed as multi-objective zoning system. The current zoning system explicitly recognizes community sasi within Traditional Use Zones, which often are adjacent or close to No-Take Zones. The explicit inclusion of sasi areas within zoning plans for the MPAs will likely lead to good compliance by local communities, and the increase fish biomass. Improving the management of fisheries through the incorporation of traditional fisheries management will therefore increase the overall resilience of coral reefs in the Raja Ampat MPA network.

  15. Raja asterias population assessment in FAO GFCM GSA17 area

    Directory of Open Access Journals (Sweden)

    C. FERRÀ

    2016-09-01

    Full Text Available Population structure and distribution of the starry ray, Raja asterias, were described based on data collected during yearly rapido trawl surveys (SoleMon, between 2005 and 2014 in the Northern and Central Adriatic Sea. A total of 306 individuals were caught, sex ratio was 1.04:1 in favor of males and length-weight relationships were obtained for the whole sample. Following the MEDITS scale, maturity was estimated, observing a higher number of immature individuals. Relative abundance significantly increased during the recent period with the highest values recorded at 5-30 m depths. Such increase could be related to the response of R. asterias to climatic change or to the decrease  in fishing pressure in the area. Clear spatial segregation of individuals depending on their life stage was observed, with immature individuals inhabiting the coastal areas and adults more abundant at depths greater than 40 m. The comparison of the result of the present study with MEDITS survey outcomes in terms of  distribution patterns, persistence areas of adults and juveniles and abundances indices, evidences that SoleMon survey seems to be more suitable in defining such features of the stock, likely due to the greater catchability of the rapido trawl in respect to the MEDITS trawl net. However, further investigations are needed to identify factors affecting the increasing abundance of this species, and develop an action plan for spatial management of fishing activities.

  16. KONDISI SOSIAL EKONOMI DAN BUDAYA MASYARAKAT SEKITAR KAWASAN KONSERVASI : STUDI KASUS DI PULAU GAG, RAJA AMPAT, PAPUA BARAT

    Directory of Open Access Journals (Sweden)

    Baharinawati W. Hastanti

    2013-12-01

    Full Text Available This study was aim to know the social, economic and cultural communities on the island of Gag, a nickel mining sites in the Marine Wildlife of the Raja Ampat Islands. In last years the region enter into a conflict between the central government (Ministry of Forestry and the local government supported by the community. The conflict occurred because of a lack of public understanding of conservation of natural resources and the presence of nickel mining was expected to improve the welfare of local communities. Lack of public understanding of conservation is influenced by socio-economic conditions and local culture is partly because of geographical isolation, low levels of education and the difficulty of economic development. These factors led to the economic motivation of nickel mining in the region hope was forwarded to the exclusion of ecological impacts would arise from the nickel mining project.Keywords: Social, economic, cultural, community, conservation area, Raja Ampat

  17. Makna Tindakan Pragmatik Bedhaya Tejaningsih pada Jumenengan K.G.P.H Tejawulan Sebagai Raja Paku Buwana XIII di Surakarta

    Directory of Open Access Journals (Sweden)

    Maryono -

    2017-03-01

    Abstrak   Kehadiran Bedhaya Tejaningsih pada ritual jumenengan K.G.P.H Tejawulan rupanya tidak sekadar bentuk hiburan, namun mengandung makna simbolis. Pada Penelitian pragmatik Bedhaya Tejaningsih, peneliti menggunakan pendekatan linguistik pragmatik. Bentuk penelitiannya bersifat kualitatif interpretatif dengan dasar rujukan teori-teori pragmatik dan seni pertunjukan. Metode pengumpulan datanya dengan cara: studi pustaka, observasi dan wawancara. Hasil kajian menunjukkan bahwa makna kehadiran tari Bedhaya Tejaningsih pada ritual jumenengan K.G.P.H Tejawulan merupakan bentuk hiburan, keteladanan dan kredibilitas. Sebagai bentuk hiburan kehadiran tari Bedhaya Tejaningsih pada penobatan raja secara keseluruhan sajiannya memberikan santapan estetis bagi penonton. Makna keteladanan yang ditemukan adalah bentuk permintaan terhadap masyarakat untuk meneladani figur pemimpin yang baik dan bijak yang selalu mengutamakan cinta kasih dalam mengayomi masyarakat, menciptakan ketentraman dan kedamaian. Makna kredibilitas adalah permohonan K.G.P.H Tejawulan terhadap masyarakat untuk memberi dukungan dan pengakuan atas penobatannya sebagai raja supaya memiliki legitimasi berdasar adat budaya Karaton Kasunanan Surakarta.   Kata kunci: tari Bedhaya Tejaningsih, makna tindakan pragmatik, dan jumenengan.

  18. Transient shifts in bacterial communities associated with the temperate gorgonian Paramuricea clavata in the Northwestern Mediterranean Sea.

    Directory of Open Access Journals (Sweden)

    Marie La Rivière

    Full Text Available BACKGROUND: Bacterial communities that are associated with tropical reef-forming corals are being increasingly recognized for their role in host physiology and health. However, little is known about the microbial diversity of the communities associated with temperate gorgonian corals, even though these communities are key structural components of the ecosystem. In the Northwestern Mediterranean Sea, gorgonians undergo recurrent mass mortalities, but the potential relationship between these events and the structure of the associated bacterial communities remains unexplored. Because microbial assemblages may contribute to the overall health and disease resistance of their host, a detailed baseline of the associated bacterial diversity is required to better understand the functioning of the gorgonian holobiont. METHODOLOGY/PRINCIPAL FINDINGS: The bacterial diversity associated with the gorgonian Paramuricea clavata was determined using denaturing gradient gel electrophoresis, terminal-restriction fragment length polymorphism and the construction of clone libraries of the bacterial 16S ribosomal DNA. Three study sites were monitored for 4 years to assess the variability of communities associated with healthy colonies. Bacterial assemblages were highly dominated by one Hahellaceae-related ribotype and exhibited low diversity. While this pattern was mostly conserved through space and time, in summer 2007, a deep shift in microbiota structure toward increased bacterial diversity and the transient disappearance of Hahellaceae was observed. CONCLUSION/SIGNIFICANCE: This is the first spatiotemporal study to investigate the bacterial diversity associated with a temperate shallow gorgonian. Our data revealed an established relationship between P. clavata and a specific bacterial group within the Oceanospirillales. These results suggest a potential symbiotic role of Hahellaceae in the host-microbe association, as recently suggested for tropical corals

  19. Descriptions and revised key to the eggcases of the skates (Rajiformes: Rajidae) and catsharks (Carcharhiniformes: Scyliorhinidae) of the British Isles.

    Science.gov (United States)

    Gordon, Cat A; Hood, Ali R; Ellis, Jim R

    2016-08-12

    Updated descriptions and measurements for the eggcases of 10 rajiform and three scyliorhinid species occurring in the shelf seas around the British Isles are given, based on museum material, specimens collected during the 'Great Eggcase Hunt' (a Shark Trust recording project), and specimens obtained from fishery surveys. Quantitative data are given for Amblyraja radiata (n = 94), Dipturus batis (n = 24), D. cf. intermedia (n = 33), Leucoraja naevus (n = 94), Raja brachyura (n = 53), R. clavata (n = 52), R. microocellata (n = 57), R. montagui (n = 52), R. undulata (n = 52), Rostroraja alba (n = 5), Galeus melastomus (n = 7), Scyliorhinus canicula (n = 52) and S. stellaris (n = 58). An updated key for the identification of elasmobranch eggcases is provided, incorporating recent changes in skate taxonomy.

  20. CLE-CLAVATA1 peptide-receptor signaling module regulates the expansion of plant root systems in a nitrogen-dependent manner.

    Science.gov (United States)

    Araya, Takao; Miyamoto, Mayu; Wibowo, Juliarni; Suzuki, Akinori; Kojima, Soichi; Tsuchiya, Yumiko N; Sawa, Shinichiro; Fukuda, Hiroo; von Wirén, Nicolaus; Takahashi, Hideki

    2014-02-04

    Morphological plasticity of root systems is critically important for plant survival because it allows plants to optimize their capacity to take up water and nutrients from the soil environment. Here we show that a signaling module composed of nitrogen (N)-responsive CLE (CLAVATA3/ESR-related) peptides and the CLAVATA1 (CLV1) leucine-rich repeat receptor-like kinase is expressed in the root vasculature in Arabidopsis thaliana and plays a crucial role in regulating the expansion of the root system under N-deficient conditions. CLE1, -3, -4, and -7 were induced by N deficiency in roots, predominantly expressed in root pericycle cells, and their overexpression repressed the growth of lateral root primordia and their emergence from the primary root. In contrast, clv1 mutants showed progressive outgrowth of lateral root primordia into lateral roots under N-deficient conditions. The clv1 phenotype was reverted by introducing a CLV1 promoter-driven CLV1:GFP construct producing CLV1:GFP fusion proteins in phloem companion cells of roots. The overaccumulation of CLE2, -3, -4, and -7 in clv1 mutants suggested the amplitude of the CLE peptide signals being feedback-regulated by CLV1. When CLE3 was overexpressed under its own promoter in wild-type plants, the length of lateral roots was negatively correlated with increasing CLE3 mRNA levels; however, this inhibitory action of CLE3 was abrogated in the clv1 mutant background. Our findings identify the N-responsive CLE-CLV1 signaling module as an essential mechanism restrictively controlling the expansion of the lateral root system in N-deficient environments.

  1. Drinking Water Quality of Water Vending Machines in Parit Raja, Batu Pahat, Johor

    Science.gov (United States)

    Hashim, N. H.; Yusop, H. M.

    2016-07-01

    An increased in demand from the consumer due to their perceptions on tap water quality is identified as one of the major factor on why they are mentally prepared to pay for the price of the better quality drinking water. The thought that filtered water quality including that are commercially available in the market such as mineral and bottled drinking water and from the drinking water vending machine makes they highly confident on the level of hygiene, safety and the mineral content of this type of drinking water. This study was investigated the vended water quality from the drinking water vending machine in eight locations in Parit Raja are in terms of pH, total dissolve solids (TDS), turbidity, mineral content (chromium, arsenic, cadmium, lead and nickel), total organic carbon (TOC), pH, total colony-forming units (CFU) and total coliform. All experiments were conducted in one month duration in triplicate samples for each sampling event. The results indicated the TDS and all heavy metals in eight vended water machines in Parit Raja area were found to be below the Food Act 1983, Regulation 360C (Standard for Packaged Drinking Water and Vended water, 2012) and Malaysian Drinking Water Quality, Ministry of Health 1983. No coliform was presence in any of the vended water samples. pH was found to be slightly excess the limit provided while turbidity was found to be 45 to 95 times more higher than 0.1 NTU as required by the Malaysian Food Act Regulation. The data obtained in this study would suggest the important of routine maintenance and inspection of vended water provider in order to maintain a good quality, hygienic and safety level of vended water.

  2. Preliminary observations on the effects of selenate on the development of the embryonic skate, Raja eglanteria

    Science.gov (United States)

    Conrad, G. W.; Luer, C. A.; Paulsen, A. Q.; Funderburgh, J. L.; Spooner, B. S. (Principal Investigator)

    1993-01-01

    Morphogenesis of the clearnose skate, Raja eglanteria, was not significantly inhibited as a result of 7 days of exposure to 1-2 mM selenate in the sea water during Days 59-69 of embryonic development (hatching would normally have occurred at 82 +/- 4 days of incubation). Although corneal transparency appeared normal in the eye, preliminary measurements of the thickness of Bowman's layer of the cornea suggested that it was significantly thinner in the corneas of embryos exposed to 1-2 mM selenate. Selenate is an ion reported to inhibit sulfation of glycosaminoglycans in connective tissue.

  3. CLAVATA3-like genes are differentially expressed in grape vine (Vitis vinifera) tissues.

    Science.gov (United States)

    Tominaga-Wada, Rumi; Nukumizu, Yuka; Wada, Takuji; Sawa, Shinichiro; Tetsumura, Takuya

    2013-10-15

    The CLAVATA3 (CLV3)/endosperm surrounding region [(ESR) CLE] peptides function as intercellular signaling molecules that regulate various physiological and developmental processes in diverse plant species. We identified five CLV3-like genes from grape vine (Vitis vinifera var. Pinot Noir): VvCLE 6, VvCLE 25-1, VvCLE 25-2, VvCLE 43 and VvCLE TDIF. These CLV3-like genes encode short proteins containing 43-128 amino acids. Except VvCLE TDIF, grape vine CLV3-like proteins possess a consensus amino acid sequence known as the CLE domain. Phylogenic analysis suggests that the VvCLE 6, VvCLE25-1, VvCLE25-2 and VvCLE43 genes have evolved from a single common ancestor to the Arabidopsis CLV3 gene. Expression analyses showed that the five grape CLV3-like genes are expressed in leaves, stems, roots and axillary buds with significant differences in their levels of expression. For example, while all of them were strongly expressed in axillary buds, VvCLE6 and VvCLE43 expression prevailed in roots, and VvCLE25-1, VvCLE25-2 and VvCLE TDIF expression in stems. The differential expression of the five grape CLV3-like peptides suggests that they play different roles in different organs and developmental stages. Copyright © 2013 Elsevier GmbH. All rights reserved.

  4. Measurement of X-ray mass attenuation coefficient of nickel around the K-edge using synchrotron radiation based X-ray absorption study

    International Nuclear Information System (INIS)

    Roy, Bunty Rani; Rajput, Parasmani; Jha, S.N.; Nageswara Rao, A.S.

    2015-01-01

    The work presents the X-ray absorption fine structure (XAFS) technique for measuring the X-ray mass attenuation coefficient of nickel metal foil in the X-ray energy range of 8271.2–8849.4 eV using scanning XAFS beam line (BL-09) at Indus-2 synchrotron radiation source facility, Raja Ramanna Centre for Advanced Technology (RRCAT) at Indore, India. The result represents the X-ray mass attenuation coefficient data for 0.02 mm thick Ni metal foil in the XAFS region of Ni K-edge. However, the results are compared to theoretical values using X-COM. There is a maximum deviation which is found exactly near the K-edge jump and decreases as we move away from the absorption edge. Oscillatory structure appears just above the observed absorption edge i.e., 8348.7 eV and is confined to around 250 eV above the edge. - Highlights: • Mass attenuation coefficient measurements of nickel using synchrotron radiation. • The measurements were taken exactly near the Ni K-edge at an energy step of 1 eV. • A maximum deviation is found near the K-edge

  5. Age, growth and length-weight relationship of the rough skate, Raja radula (Linnaeus, 1758 (Chondrichthyans: Rajidae, from the Gulf of Gabes (Tunisia, Central Mediterranean

    Directory of Open Access Journals (Sweden)

    Hasna Kadri

    2014-05-01

    Full Text Available Objective: To investigate the length distribution, sex ratio, length-weight relationship, age and growth of Raja radula in the Gulf of Gabes. Methods: The age and growth characteristic of the rough skate (Raja radula inhabiting in the Gulf of Gabes (Central Mediterranean Sea was determined. A total of 1 250 specimens were sampled. According to the marginal increment band its growth was annual. Results: The growth parameters were derived by using the von-Bertalanffy method and were separately evaluated as follows: TL∞=97.2 cm, K= 0.15 y -1 , to= 0.35, and W∞= 5.28 kg, and TL∞= 76.4 cm, K = 0.22 y -1 , to= 0.16, and W∞= 3.77 kg, for females and males respetively. The maximum age was 12 years for females and 10 years for males. Conclusions: Results from this research will provide a starting point to develop a management plan for the rough skate in the Gulf of Gabes. Further investigations are necessary to quantify the impact of the existing regulations on the population dynamics and recruitment patterns of this species in the region.

  6. TINJAUAN SEJARAH TERHADAP NASKAH DAN TEKS KITAB PENGETAHUAN BAHASA, KAMUS LOGAT MELAYU JOHOR PAHANG RIAU LINGGA KARYA RAJA ALI HAJI

    Directory of Open Access Journals (Sweden)

    Ellya Roza

    2012-11-01

    Full Text Available Kingdom of Riau in the 19th century recognized by many historians as the center of culture and intellectual development. While at the same time, the kingdom of Riau no longer holds hegemony and succeeding in politics, economy and trade, but they have a tradition of excellence in the form of writing that many writers with works of quality that is not only in the field of literature and language alone but also in the fields of religion, history, socio-political, legal, and cultural. Although the tools for writing like paper and ink difficulty encountered in those days, and must be imported from European countries, but the author and the author's Riau while still concentrating on the activities making up the reef. For instance, Raja Ali Haji (1808-1873 is the third descendant of Raja Haji Fi Sabilillah most productive in writing activities. One of his works, entitled The Book of Knowledge of Language, Slang Dictionary Pahang Malay Johor Riau linga which was completed in 1858 is a Malay Dictionary Malay First Nature books can even be regarded as Malay Einsiklopedi containing approximately 2000 sentences basic and advanced script written as Bustanul Katibin which intends to foster Malay language became the language of the standard on its own. The manuscript of the book, now the mistress Foundation Indrasakti in Penyengat. In connection with that paper will review the history of the manuscript and are contained in the text.

  7. Anticancer Activity of a Hexapeptide from Skate (Raja porosa) Cartilage Protein Hydrolysate in HeLa Cells.

    Science.gov (United States)

    Pan, Xin; Zhao, Yu-Qin; Hu, Fa-Yuan; Chi, Chang-Feng; Wang, Bin

    2016-08-16

    In this study, the hexapeptide Phe-Ile-Met-Gly-Pro-Tyr (FIMGPY), which has a molecular weight of 726.9 Da, was separated from skate (Raja porosa) cartilage protein hydrolysate using ultrafiltration and chromatographic methods, and its anticancer activity was evaluated in HeLa cells. Methylthiazolyldiphenyl-tetrazolium bromide (MTT) assay indicated that FIMGPY exhibited high, dose-dependent anti-proliferation activities in HeLa cells with an IC50 of 4.81 mg/mL. Acridine orange/ethidium bromide (AO/EB) fluorescence staining and flow cytometry methods confirmed that FIMGPY could inhibit HeLa cell proliferation by inducing apoptosis. Western blot assay revealed that the Bax/Bcl-2 ratio and relative intensity of caspase-3 in HeLa cells treated with 7-mg/mL FIMGPY were 2.63 and 1.83, respectively, significantly higher than those of the blank control (p skate cartilage protein hydrolysate may have applications as functional foods and nutraceuticals for the treatment and prevention of cancer.

  8. [Peculiarities of the phospholipid and fatty acid composition of erythrocyte plasma membranes of the Black Sea fish].

    Science.gov (United States)

    Silkin, Iu A; Silkina, E N; Zabelinskiĭ, S A

    2012-01-01

    The phospholipid and the fatty acid composition of the main phospholipids families of erythrocyte plasma membranes was studied in two species of cartilaginous fish: the common thrasher (Raja clavata L.) and the common stingray (Dasyatis pastinaca) and three bony fish species: the scorpion fish (Scorpaena porcus L.), the smarida (Spicara flexuosa Raf.), and the horse mackerel (Trachurus mediterraneus ponticus Aleev). It was shown that in the studied fish, 70.0-80.0 % of all membrane phospholipids were composed of phosphatidylcholine and phosphatidylethanolamine. Phosphatidylserine, monophosphoinositide, and sphingomyelin were minor components whose content in the erythrocyte membrane fluctuated from 3.0 % to 13.0 %. The fatty acid phospholipids composition was represented by a large specter of acids. From saturated acids, basic for plasma membranes are palmitic (C16: 0) and stearic (C18: 0) acids. From unsaturated acids, the larger part belong to mono-, tetra-, penta-, and hexaenoic acids in fish phospholipids. The calculation of the double bond index and of the unsaturation coefficient showed difference in the deformation ability of erythrocyte membranes of the studied fish.

  9. Distribución, mortalidad y asociación con plantas, de nidos de Paraponera clavata (Hymenoptera: Formicidae en la isla de Barro Colorado, Panamá

    Directory of Open Access Journals (Sweden)

    Rolando Pérez

    1999-12-01

    Full Text Available Se estudió la distribución, mortalidad, reclutamiento y asociación con plantas, de 308 nidos de la hormiga neotropical Paraponera clavata en una parcela de cincuenta hectáreas de bosque viejo en la isla de Barro Colorado entre septiembre de 1993 y febrero de 1995. Los nidos estaban distribuidos uniformemente a través de toda la parcela, y se asociaban de manera significativa con el tipo de hábitat, existían más nidos de los esperados en las planicies altas y en la sección de bosque más joven de la parcela. La densidad promedio era de 6.2 nidos por hectárea. Los nidos con un mayor número de vecinos entre 0 y 20 m de distancia, tenían una mayor probabilidad de morir, si se comparaban con aquéllos que se encontraban separados por distancias mayores. La mortalidad era entre 13.36 y 69.64% dependiendo del intervalo de censo, y el reclutamiento fue del 22.63 y 31.72%. Los nidos se encontraron en las bases de 84 especies de plantas, en 34 familias con cuatro categorías de forma de vida: 76 especies eran árboles, 5 especies eran arbustos, 2 especies eran palmas y 1 era liana. Ocho especies de plantas se asociaban positivamente con los nidos de la hormiga. Plantas medianas entre 8 y 63.9 cm de DAP eran las más utilizadas. Arboles y arbustos pequeños presentan muy poca asociación con los nidos. La hormiga no se asocia con árboles que tienen nectarios extraflorales. El 53% de los nidos tenían a Phrynus gervaisii (Amblypygi: Phrynidae habitando en el interior. Estos nidos presentaron menores tasas de mortalidad en comparación con el resto.We studied the distribution, mortality and association with plants, of 308 nests of the neotropical ant Paraponera clavata, in a permanent 50 hectare plot in old-growth forest on Barro Colorado island between September 1993 and February 1995. Ant nests were uniformly dispersed throughout the plot, and significantly associated with the high plateau and patch of young forest in the plot. The average

  10. Design of x-ray diagnostic beam line for a synchrotron radiation source and measurement results

    Energy Technology Data Exchange (ETDEWEB)

    Garg, Akash Deep, E-mail: akash-deep@rrcat.gov.in; Karnewar, A.K.; Ojha, A.; Shrivastava, B.B.; Holikatti, A.C.; Puntambekar, T.A.; Navathe, C.P.

    2014-08-01

    Indus-2 is a 2.5 GeV synchrotron radiation source (SRS) operational at the Raja Ramanna Centre for Advanced Technology (RRCAT) in India. We have designed, developed and commissioned x-ray diagnostic beam line (X-DBL) at the Indus-2. It is based on pinhole array imaging (8–18 keV). We have derived new equations for online measurements of source position and emission angle with pinhole array optics. Measured values are compared with the measurements at an independent x-ray beam position monitor (staggered pair blade monitor) installed in the X-DBL. The measured values are close to the theoretical expected values within ±12 µm (or ±1.5 μrad) for sufficiently wide range of the beam movements. So, beside the beam size and the beam emittance, online information for the vertical position and angle is also used in the orbit steering. In this paper, the various design considerations of the X-DBL and online measurement results are presented.

  11. The dynamic of urban and protected areas at Balai Raja Wildlife Reserve, Riau, Indonesia: a social ecology approach

    Science.gov (United States)

    Suwondo; Darmadi; Yunus, M.

    2018-01-01

    The development process has resulted in deforestation. A comprehensive study is needed to obtain an objective solution by integrating the ecological dimension and human dimension. This study was conducted within Balai Raja Wildlife Reserve (BRWR), Bengkalis Regency, Riau Province, Indonesia. We used the social-ecological systems (SES) approach based on local characteristics, categorized into ecological status, social status and actors. Each factoris ranked using Multi-Dimensional Scaling (MDS).BRWR sustainability levels are in moderate condition. The ecological dimension is in a less sustainable state, with leverage: (1) forest conversion; (2) local ecological knowledge; (3) high conservation value. The social dimension is in a less sustainable state, with leverage: (1) community empowerment; (2) social conflict; (3) participation in landscape management. Dimensions actors are on a fairly sustainable status, with leverage: (1) institutional interaction; (2) stakeholder’s commitment; (3) law enforcement. We recommend strengthening community empowerment, local ecological knowledge, interaction, and stakeholder commitment

  12. Nitric oxide production by nurse shark (Ginglymostoma cirratum) and clearnose skate (Raja eglanteria) peripheral blood leucocytes.

    Science.gov (United States)

    Walsh, Cathy J; Toranto, Jason D; Gilliland, C Taylor; Noyes, David R; Bodine, Ashby B; Luer, Carl A

    2006-01-01

    Reactive nitrogen intermediates, such as nitric oxide (NO), are important immunomodulators in vertebrate immune systems, but have yet to be identified as mediators of host defence in any member of class Chondrichthyes, the cartilaginous fishes. In the present study, production of NO by nurse shark (Ginglymostoma cirratum) peripheral blood leucocytes (PBL) stimulated with bacterial cell wall lipopolysaccharide (LPS) was investigated. PBL were cultured for 24 to 96 h following stimulation with LPS at concentrations ranging from 0 to 25 microg ml(-1), in both serum-supplemented and serum-free culture conditions. Production of NO was measured indirectly using the Griess reaction, with maximal NO production occurring after 72 h using 10% FBS and 10 microg LPS ml(-1). Application of these culture conditions to PBL from another cartilaginous fish (clearnose skate, Raja eglanteria) resulted in a similar NO response. Addition of a specific inhibitor of inducible nitric oxide synthase (iNOS), L-N(6)-(1-iminoethyl)lysine (L-NIL), resulted in a significant decrease in the production of NO by PBL from both species.

  13. Structural and functional diversity of CLAVATA3/ESR (CLE)-like genes from the potato cyst nematode Globodera rostochiensis.

    Science.gov (United States)

    Lu, Shun-Wen; Chen, Shiyan; Wang, Jianying; Yu, Hang; Chronis, Demosthenis; Mitchum, Melissa G; Wang, Xiaohong

    2009-09-01

    Plant CLAVATA3/ESR-related (CLE) peptides have diverse roles in plant growth and development. Here, we report the isolation and functional characterization of five new CLE genes from the potato cyst nematode Globodera rostochiensis. Unlike typical plant CLE peptides that contain a single CLE motif, four of the five Gr-CLE genes encode CLE proteins with multiple CLE motifs. These Gr-CLE genes were found to be specifically expressed within the dorsal esophageal gland cell of nematode parasitic stages, suggesting a role for their encoded proteins in plant parasitism. Overexpression phenotypes of Gr-CLE genes in Arabidopsis mimicked those of plant CLE genes, and Gr-CLE proteins could rescue the Arabidopsis clv3-2 mutant phenotype when expressed within meristems. A short root phenotype was observed when synthetic GrCLE peptides were exogenously applied to roots of Arabidopsis or potato similar to the overexpression of Gr-CLE genes in Arabidopsis and potato hairy roots. These results reveal that G. rostochiensis CLE proteins with either single or multiple CLE motifs function similarly to plant CLE proteins and that CLE signaling components are conserved in both Arabidopsis and potato roots. Furthermore, our results provide evidence to suggest that the evolution of multiple CLE motifs may be an important mechanism for generating functional diversity in nematode CLE proteins to facilitate parasitism.

  14. Cell and molecular biology of marine elasmobranchs: Squalus acanthias and Raja erinacea.

    Science.gov (United States)

    Mattingly, Carolyn; Parton, Angela; Dowell, Lori; Rafferty, Jason; Barnes, David

    2004-01-01

    Elasmobranchs are among the most primitive existing species exhibiting fundamental vertebrate characteristics, such as neural crest, jaws, teeth, and an adaptive immune system. They are also among the earliest-evolved vertebrates with a closed, pressurized circulatory system and related signaling molecules. Although many species are used experimentally, the spiny dogfish shark (Squalus acanthias) and little skate (Raja erinacea) have particular advantages and are the most commonly used elasmobranch biomedical models. These animals display powerful molecular systems for dealing with salt and water homeostasis, cell volume regulation, and environmental and internal osmotic sensing. They have become important unique models in studies of transport-related diseases such as cystic fibrosis and anion or xenobiotic transport. Much of this work has relied on physiological experiments combined with molecular approaches and the advantages of comparative genomic analyses to identify conserved regions representing functional protein domains. Recent work has seen the development of cell cultures and the beginning of expressed sequence tags (EST) and genomic libraries. Other areas in which elasmobranches have played critical roles include immunology and neurobiology. It also appears that sharks have tissue regenerative capability beyond what is commonly seen in mammals. For example, sharks and skates possess a region of renal regeneration, with new tubules being formed continually through adulthood. As comparative functional genomics comes of age, these comparative vertebrate models may play an increasing role in the larger picture of human biomedical research. There is plenty of ocean to share.

  15. The percentage of coral reef cover in Saonek Kecil Island, Raja Ampat, West Papua

    Science.gov (United States)

    Wiguna, D. A.; Masithah, E. D.; Manan, A.

    2018-04-01

    Raja Ampat archipelago is located in the heart of the world’s coral triangle which is the center of the richest tropical marine biodiversity in the world. The Saonek Kecil Island has a location close to the Waisai Harbour (±2 km of sea routes). The Island that has no inhabitants and has a location close to harbour activities potentially damage coral reefs. This research was conducted by Line Intercept Transect (LIT) method that calculate the length of each colony form of growth (life form) of coral reefs on the line transect which stretched along the 50 metres parallel to the coastline at each station to obtain the percentage cover data, diversity index, uniformity index, and dominance index. The results of research precentage cover of coral reeef in the waters of Small Saonek Island reach 68.80% – 79.30% by category according to the decision of the Minister of State for the Environment number 4 of 2001 about the damage the reefs criteria included in the category of good – very good. As for the value of diversity index (H’) of 0.487 – 0.675 (medium-high), uniformity index (J) 0.437 – 0.606 (medium-high), and dominance index (C) 0.338 – 0.502 (medium-high).

  16. Effects of basic fibroblast growth factor and insulin-like growth factor on cultured cartilage cells from skate Raja porasa

    Science.gov (United States)

    Fan, Tingjun; Jin, Lingyun; Wang, Xiaofeng

    2003-12-01

    Effects of basic fibroblast growth factor (bFGF) and insulin-like growth factor II (IGF-II) on cartilage cells from proboscis of skate, Raja porasa Günther, were investigated in this study. The cartilage cells were cultured in 20% FBS-supplemented MEM medium at 24°C. Twelve hours after culture initiation, the cartilage cells were treated with bFGF and IGF-II at different concentration combinations. It was found that 20 ng/ml of bFGF or 80 ng/ml of IGF-II was enough to have obvious stimulating effect on the growth and division of skate cartilage cells. Test of bFGF and IGF-II together, revealed that 20 ng/ml of bFGF and 80 ng/ml of IGF-II together had the best stimulating effect on the growth and division of skate cartilage cells. The cartilage cells cultured could form a monolayer at day 7.

  17. Diel feeding chronology of the skate raja Agassizii (Müller & Henle (Pisces, Elasmobranchii on the continental shelf off Ubatuba, Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Lucy Satiko Hashimoto Soares

    1999-03-01

    Full Text Available The diet and diel feeding pattern of the skate Raja agassizii were investigated through analysis of stomach contents. A total of 280 stomachs were collected by a series of hauls during a daily cycle in three periods, 8-10 January 1987, 22-24 July and 2-4 December 1988, from the inner continental shelf of the coastal ecosystem of Ubatuba, São Paulo State, Brazil (25º35'S; 45º00'W. According to the results of the stomach fullness and of the number of fresh prey, it is suggested that this species presents continuity in the feeding activity during a day. The stomach contents were mainly composed of crustaceans. Nematodes, polychaetes and fishes also occurred. No changes were observed in dietary composition between day and night.

  18. Two novel antioxidant nonapeptides from protein hydrolysate of skate (Raja porosa) muscle.

    Science.gov (United States)

    Hu, Fa-Yuan; Chi, Chang-Feng; Wang, Bin; Deng, Shang-Gui

    2015-04-03

    In the current study, the preparation conditions of neutrase hydrolysate (SMH) from skate (Raja porosa) muscle protein were optimized using orthogonal L9(3)4 tests, and R values indicated that pH was the most important factor affecting HO· scavenging activity of SMH. Under the optimum conditions of pH 7.0, enzymolysis temperature 60 °C, enzyme/substrate ratio (E/S) 2%, and enzymolysis time 5 h, EC50 of SMH on HO· was 2.14 ± 0.17 mg/mL. Using ultrafiltration, gel filtration chromatography, and RP-HPLC, two novel antioxidant nonapeptides (SP-A and SP-B) were isolated from SMH and their amino acid sequences were found to be APPTAYAQS (SP-A) and NWDMEKIWD (SP-B) with calculated molecular masses of 904.98 Da and 1236.38 Da, respectively. Both showed strong antioxidant activities. SP-A and SP-B exhibited good scavenging activities on HO· (EC50 0.390 and 0.176 mg/mL), DPPH· (EC50 0.614 and 0.289 mg/mL), and O2-· (EC50 0.215 and 0.132 mg/mL) in a dose-dependent manner. SP-B was also effective against lipid peroxidation in the model system. The aromatic (2Trp), acidic (2Asp and Glu), and basic (Lys) amino acid residues within the sequences of SP-B might account for its pronounced antioxidant activity. The results of this study suggested that protein hydrolysate and peptides from skate muscle might be effective as food additives for retarding lipid peroxidation occurring in foodstuffs.

  19. Two Novel Antioxidant Nonapeptides from Protein Hydrolysate of Skate (Raja porosa Muscle

    Directory of Open Access Journals (Sweden)

    Fa-Yuan Hu

    2015-04-01

    Full Text Available In the current study, the preparation conditions of neutrase hydrolysate (SMH from skate (Raja porosa muscle protein were optimized using orthogonal L9(34 tests, and R values indicated that pH was the most important factor affecting HO· scavenging activity of SMH. Under the optimum conditions of pH 7.0, enzymolysis temperature 60 °C, enzyme/substrate ratio (E/S 2%, and enzymolysis time 5 h, EC50 of SMH on HO· was 2.14 ± 0.17 mg/mL. Using ultrafiltration, gel filtration chromatography, and RP-HPLC, two novel antioxidant nonapeptides (SP-A and SP-B were isolated from SMH and their amino acid sequences were found to be APPTAYAQS (SP-A and NWDMEKIWD (SP-B with calculated molecular masses of 904.98 Da and 1236.38 Da, respectively. Both showed strong antioxidant activities. SP-A and SP-B exhibited good scavenging activities on HO· (EC50 0.390 and 0.176 mg/mL, DPPH· (EC50 0.614 and 0.289 mg/mL, and O2−· (EC50 0.215 and 0.132 mg/mL in a dose-dependent manner. SP-B was also effective against lipid peroxidation in the model system. The aromatic (2Trp, acidic (2Asp and Glu, and basic (Lys amino acid residues within the sequences of SP-B might account for its pronounced antioxidant activity. The results of this study suggested that protein hydrolysate and peptides from skate muscle might be effective as food additives for retarding lipid peroxidation occurring in foodstuffs.

  20. New tentacled leech Ceratobdella quadricornuta n. g., n. sp. (Hirudinida: Piscicolidae) parasitic on the starry skate Raja georgiana Norman from the Scotia Sea, Antarctica.

    Science.gov (United States)

    Utevsky, Andrei; Gordeev, Ilya

    2015-07-01

    A new fish leech Ceratobdella quadricornuta n. g., n. sp. (Hirudinida: Piscicolidae), a parasite of the Antarctic skate Raja georgiana Norman (Rajiformes: Rajidae) collected between the Falkland Islands and South Georgia Island in the Scotia Sea, is described and compared with related genera. Ceratobdella quadricornuta is characterised by an uncommon appearance of its anterior sucker bearing four well-developed tentacles and a unique combination of features of the reproductive and digestive systems: crop and intestine equally developed, posterior crop caeca separated; accessory glands, conductive tissue and external copulatory area lacking; common part of ejaculatory ducts (common atrium) voluminous and muscular, male copulatory bursa short, small ovisacs opening into female copulatory bursa (vagina).

  1. Uji Aktivitas Senyawa Antioksidan dari Ekstrak Metanol Kulit Pisang Raja (Musa paradisiaca Sapientum

    Directory of Open Access Journals (Sweden)

    Elfira Rosa Pane

    2017-03-01

    Full Text Available AbstrakTelah dilakukan penelitian uji aktivitas senyawa antioksidan dari ekstrak metanol kulit pisang raja (Musa paradisiaca Sapientum. Ekstraksi dilakukan dengan cara maserasi menggunakan pelarut metanol. Ekstraksi bertingkat dilakukan terhadap ekstrak metanol dengan n-heksan dan etil asetat. Dari uji fitokimia terhadap fraksi metanol menunjukkan positif flavonoid. Pengujian aktifitas antioksidan dilakukan dengan reaksi oksidasi asam linoleat dengan metoda feritiosianat (FTC 0,05%. Sebagai standar antioksidan digunakan Butil hidroksianisol (BHA. Hasil penelitian ini menunjukkan ekstrak metanol, fraksi n-heksan dan etil asetat memiliki aktifitas antioksidan yang tidak jauh berbeda dengan BHA. Sedangkan fraksi etil asetat memiliki aktifitas antioksidan yang lebih tinggi daripada BHA.Kata kunci : antioksidan, feritiosianat, Musa paradisiaca SapientumAbstractA research has been done to evaluate the antioxidant activity of metanol extract Musa paradisiaca Sapientum peel’s. Maseration technique was used to get the extract using metanol as solvent. The metanol extract of the peel was re-extracted by solvents into n-hexan and ethyl acetate fractions. Phytochemical screening of metanol extract showed positive flavonoid. The antioxidant activities were tested by using ferric thiocyanate method 0,05% (FTC on linoleic acid and buthyl hydroxyanisole (BHA as antioxidant standard. Metanol extract, n-hexan and ethyl acetate fraction exhibited antioxidative activity that was not significantly different from BHA, on the other hand, the ethyl acetate fraction exhibited significant antioxidative activity, which is better than BHA.Keywords : antioxidant, ferric thiocyanate, Musa paradisiaca Sapientum

  2. Religion and Culture Encounters in Misool Raja Ampat: Marine Ritual Practice of Sasi Laut

    Science.gov (United States)

    Suardi Wekke, Ismail; Aghsari, Diah; Evizariza, Evizariza; Junaidi, Junaidi; Harun, Nurlaila

    2018-05-01

    The acculturation of religion and culture in such a way are gradually accepted without causing the loss of the native culture in one community will influence the social process. When religion and culture arise and merged into one, it can be clear to be found in their rituals. This ethnography study on qualitative in nature was conducted to see how the existence, practices, and acculturation between local culture and Islam in, Sasi marine rituals in Misool Raja Ampat in West Papua Indonesia. Data collection was done through observation, in-depth interview including library research on community manuscript and local government database. Using snowball sampling technique, this study is able to gain solid information from native people in Misoo that willing to take part as the informants. The informants in this study were found as influences native people in Misool community e.g; the head of Fafanlap village, community figures, female figures and youth figures. This study considers Misool community which still strongly maintains their cultures including sasi laut as a sign to start and stop harvesting the specific sea resources to maintain the sustainability of nature. The acculturation between the culture of Islam runs smoothly in changing the native mindset to eliminate the things that can cause syirik but did not eliminate the characteristics and the main part of the ritual of sasi laut.

  3. Effect of ion beam irradiation on metal particle doped polymer ...

    Indian Academy of Sciences (India)

    and converts polymeric structure into hydrogen depleted carbon network. ... Composite materials; ion beam irradiation; dielectric properties; X-ray diffraction. ..... Coat. Technol. 201 8225. Raja V, Sharma A K and Narasimha V V R 2004 Mater.

  4. JCSC_128_8_1265_1275_SI.docx

    Indian Academy of Sciences (India)

    mypc

    SUPPLEMENTARY INFORMATION. Synthesis, X-Ray crystal structure, DNA binding and nuclease activity of lanthanide (III) complexes of 2-benzoylpyridine acetyl hydrazone. KARREDDULA RAJA, AKKILI SUSEELAMMA and KATREDDI HUSSAIN REDDY*. Department of Chemistry, Sri Krishnadevaraya University, ...

  5. cDNA cloning and characterization of Type I procollagen alpha1 chain in the skate Raja kenojei.

    Science.gov (United States)

    Hwang, Jae-Ho; Yokoyama, Yoshihiro; Mizuta, Shoshi; Yoshinaka, Reiji

    2006-05-01

    A full-length cDNA of the Type I procollagen alpha1 [pro-alpha1(I)] chain (4388 bp), coding for 1463 amino acid residues in the total length, was determined by RACE PCR using a cDNA library constructed from 4-week embryo of the skate Raja kenojei. The helical region of the skate pro-alpha1(I) chain consisted of 1014 amino acid residues - the same as other fibrillar collagen alpha chains from higher vertebrates. Comparison on denaturation temperatures of Type I collagens from the skate, rainbow trout (Oncorhynchus mykiss) and rat (Rattus norvegicus) revealed that the number of Gly-Pro-Pro and Gly-Gly in the alpha1(I) chains could be directly related to the thermal stability of the helix. The expression property of the skate pro-alpha1(I) chain mRNA and phylogenetic analysis with other vertebrate pro-alpha1(I) chains suggested that skate pro-alpha1(I) chain could be a precursor form of the skate Type I collagen alpha1 chain. The present study is the first evidence for the primary structure of full-length pro-alpha1(I) chain in an elasmobranch.

  6. X-ray fluorescence in Member States (India): Micro-beam X-ray fluorescence spectroscopy using Indus-2 synchrotron radiation facility: beamline BL-16

    Energy Technology Data Exchange (ETDEWEB)

    Tiwari, M. K.; Lodha, G. S.; Deb, S.K., E-mail: mktiwari@rrcat.gov.in [Indus Synchrotrons Utilization Division, Raja Ramanna Centre for Advanced Technology, Indore-452013 (MP) (India)

    2014-02-15

    Indus-1 and Indus-2, are India’s national synchrotron radiation facilities located at Raja Ramanna Centre for Advanced Technology (RRCAT), Indore. Indus-1 is a 450 MeV electron storage ring which provides synchrotron radiation in the VUV soft x-ray range with a critical wavelength of 61 Å whereas Indus-2 is a 2.5 GeV, 300 mA synchrotron radiation machine with a critical wavelength of 2 Å for its bending magnet source. The Indus-2 is at present operating at 2.5 GeV, 100 mA in round-theclock operation mode. Both synchrotron sources exist in the same premises of RRCAT, Indore and have very good air/rail connectivities with major cities of India. The RRCAT centre also fosters research and development activities in the fields of particle accelerators, Lasers and related advanced technologies like cryogenics, ultra high vacuum, superconducting cavities, RF power, magnet and their application in different fields of science, thus the centre provides a unique platform covering a wide range of experiments for the synchrotron users in the Indian subcontinent.

  7. Anticancer Activity of a Hexapeptide from Skate (Raja porosa Cartilage Protein Hydrolysate in HeLa Cells

    Directory of Open Access Journals (Sweden)

    Xin Pan

    2016-08-01

    Full Text Available In this study, the hexapeptide Phe-Ile-Met-Gly-Pro-Tyr (FIMGPY, which has a molecular weight of 726.9 Da, was separated from skate (Raja porosa cartilage protein hydrolysate using ultrafiltration and chromatographic methods, and its anticancer activity was evaluated in HeLa cells. Methylthiazolyldiphenyl-tetrazolium bromide (MTT assay indicated that FIMGPY exhibited high, dose-dependent anti-proliferation activities in HeLa cells with an IC50 of 4.81 mg/mL. Acridine orange/ethidium bromide (AO/EB fluorescence staining and flow cytometry methods confirmed that FIMGPY could inhibit HeLa cell proliferation by inducing apoptosis. Western blot assay revealed that the Bax/Bcl-2 ratio and relative intensity of caspase-3 in HeLa cells treated with 7-mg/mL FIMGPY were 2.63 and 1.83, respectively, significantly higher than those of the blank control (p < 0.01. Thus, FIMGPY could induce apoptosis by upregulating the Bax/Bcl-2 ratio and caspase-3 activation. Using a DNA ladder method further confirmed that the anti-proliferation activity of FIMGPY was attributable to its role in inducing apoptosis. These results suggest that FIMGPY from skate cartilage protein hydrolysate may have applications as functional foods and nutraceuticals for the treatment and prevention of cancer.

  8. SINERGI RAJA ALIM DAN THINK TANK-NYA: KERATON DAN PEMBENTUKAN TRADISI KEILMUAN ISLAM NUSANTARA

    Directory of Open Access Journals (Sweden)

    Dawam Multazami

    2016-12-01

    Full Text Available Abstrak:In general, theories about the arrival of Islam in this country came in the 7th century BC, by various methods and strategies of endeavors. The preacher came and tried to blend with the occupants by using native language and their customs, and then mate with the natives. Finally, they made small community to maintain friendship with the potentate. Palace or castle has an important role as part of forming the Islamic nation tradition. The close Relationship between parsons and potentate drawn in the role of co-operation through educational institutions outside the palace and in palace, the parsons are instructed to write scientific papers and served as state law, palace policies lifting parsons in strategic positions as mufti or qodhi, palace become a place to discuss intellectual matters and so forth. The relationship between palace and the forming of Islamic nation tradition depicted into some areas in this country such: the scientific tradition of Islam in Aceh Darussalam. Its began from meunasah (madrasah in which students learned the Arabic alphabet, read al-Qur'an, prayer procedures, morality, monotheism study, fiqh study, tasawwuf study, the Islamic roles in building a mosque then used as a place of higher education. Collective leadership between sultan and Wali Songo in Demak Bintoro, Sultan Banjar attend to Islamic development through education build by Shaikh Arshad, and the establishment of Shari'ah court Keywords: Raja Alim, Kesultanan Aceh, Musawaratan Wali dan Daeng Ta Kaliya.

  9. Biogeochemical studies of technetium in marine and estuarine ecosystems. Progress report, 1 July 1979-30 June 1980

    International Nuclear Information System (INIS)

    Beasley, T.M.

    1980-01-01

    Progress is reported in research dealing with the biogeochemical behavior of technetium in marine and estuarine ecosystems. Studies were planned to elaborate the biokinetic behavior of Tc as TcO 4 - in selected marine and estuarine organisms and to determine the affinity of TcO 4 - for different marine sediments under oxygenated conditions. It is concluded that concentration factors for TcO 4 - in bivalve molluscs (oysters and mussels) do not exceed 2 when calculated for whole animals and when uptake is directly from water. Direct uptake from water by limpets (archeogastropod) are very much lower than have been reported for red abalone (archeogastropod). Whole body concentration factors for TcO 4 - in the plaice, Pleuronectes platessa, where uptake is directly from labeled seawater, do not exceed 10 at equilibrium. Both the lobster, Homarus gammaris and the polychaete, Nereis diversicolor appear to concentrate Tc efficiently from water labelled intially with TcO 4 - . Both plaice and rays (Raja clavata) fed /sup 95m/Tc labeled Nereis show an initial rapid loss of the isotope for approximately five days. Thereafter, loss is much reduced. Shrimp (Palaemon elegans), Cragnon sp.) and Crab (Cancer pagurus) show concentration factors similar to plaice (C.F. is less than 10). Isopods, however, have concentration factors of only 3 following four weeks exposure to labeled seawater. Uptake of TcO 4 - by phytoplankton is extremely low, which precludes experiments in which TcO 4 - labeled phytoplankton can be fed to either bivalve molluscs or microzooplankton. Sediment distribution coefficients for TcO 4 - are essentially zero and are independent of sediment type in well oxygenated seawater. Experiments to date have shown that it is not possible to make generalizations concerning the bioavailability of TcO 4 - to marine organisms

  10. Mid-Atlantic elasmobranchs: Suitable metal scouts?

    International Nuclear Information System (INIS)

    Torres, Paulo; Tristão da Cunha, Regina; Rodrigues, Armindo dos Santos

    2017-01-01

    Heavy metals are a hazard to marine fauna and human health. In this study we assess stable isotopes and metal content in Prionace glauca and Isurus oxyrinchus and analyse these results within and among other species and across regions and geographical areas. Also, we evaluate their suitability, together with Raja clavata and Galeorhinus galeus, as Mid-Atlantic bioindicators. Prionace glauca and I. oxyrinchus shared the same trophic level in a pelagic food web and did not present significant differences between genders or metals, except for As. Arsenic and Hg accumulated while Cd and Pb were not detected. One I. oxyrinchus presented Hg values above regulatory limits. A high Hg exposure was associated with I. oxyrinchus since its maximum weekly intake was exceeded. Elasmobranchs can be used as metal sentinels, each presenting different key features which defines a good marine bioindicator, allowing long-term monitoring at different temporal and spatial scales. - Highlights: • We analysed P. glauca and I. oxyrinchus muscle from Mid-Atlantic. • We determined stable isotopes, trophic ecology and heavy metal content. • Results reflect bioaccumulation for As and Hg. • Oxyrinchus already presented Hg values above regulatory limits. • Mid-Atlantic elasmobranchs appear to be effective metal bioindicators.

  11. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 128; Issue 1. Synthesis, spectral properties and DNA binding and nuclease activity of lanthanide (III) complexes of 2-benzoylpyridine benzhydrazone: X-ray crystal structure, Hirshfeld studies and nitrate- interactions of cerium(III) complex. Karreddula Raja Akkili ...

  12. Japanese Occupation Government Policy in Indonesia on Culture and Literature: A Case Study of Asia Raja Newspaper (1942-1945

    Directory of Open Access Journals (Sweden)

    Maman S Mahayana

    2013-08-01

    Full Text Available There are three views are shown in the movement of Indonesia in responding to the arrival of Japan to Indonesia. First, they welcome and support the arrival of Japan considering the success of Japan drove the Dutch. Second, they have not determined the attitude of supporting or opposing. In this case, they still want to see how Japan would run his administration in Indonesia. Third, they oppose the presence of Japan, although not yet dared to take the fight. Those who oppose the Japanese arrivals in Indonesia consists of two groups, namely (1 of the aristocratic, ambtenaar, and government employees, and (2 the movement of the fighters who put the government of Japan as an imperialist occupation. How is the real politics of the Japanese occupation government in carrying out its colonial administration in the colonies? With the underlying research on the Asia Raja newspapers (April 29, 1942 to September 7, 1945, this paper tries to reveal the political government of Japan in the socio-cultural and literature. How is the newspapers used the Japanese occupation government to gain public support for Indonesia in the face of Greater East Asia war?

  13. Common skate (Raja kenojei) secretes pentraxin into the cutaneous secretion: The first skin mucus lectin in cartilaginous fish.

    Science.gov (United States)

    Tsutsui, Shigeyuki; Yamaguchi, Motoki; Hirasawa, Ai; Nakamura, Osamu; Watanabe, Tasuku

    2009-08-01

    A lactose-specific lectin with a molecular mass of about 25 kDa was purified from the skin mucus of a cartilaginous fish-the common skate (Raja kenojei). The complementary DNA sequence of the lectin was 1540 bp long and contained a reading frame encoding 226 amino acids, which showed approximately 38% identity to pentraxins of mammals and teleosts. Gene expression was observed in the skin, gill, stomach and intestine in the healthy skate. We also identified an isotype gene from the liver whose deduced amino-acid sequence shared 69.0% identity with the skin type gene. The antiserum detected protein in the skin, where the lectin is localized in the epidermal cells, and in the blood plasma. The lectin genes are multicopied in the common skate genome. Although pentraxins are acute phase proteins, mRNAs of both the isotypes were not upregulated after the in vivo challenge with formalin-killed Escherichia coli, which suggests that they are constantly present in the skin mucus and blood plasma to protect against pathogenic invasion. This lectin is the fifth type of lectin found in the cutaneous secretions of fish, demonstrating that skin mucus lectins have evolved with marked molecular diversity in fish.

  14. Rapid Development of Microsatellite Markers with 454 Pyrosequencing in a Vulnerable Fish, the Mottled Skate, Raja pulchra

    Science.gov (United States)

    Kang, Jung-Ha; Park, Jung-Youn; Jo, Hyun-Su

    2012-01-01

    The mottled skate, Raja pulchra, is an economically valuable fish. However, due to a severe population decline, it is listed as a vulnerable species by the International Union for Conservation of Nature. To analyze its genetic structure and diversity, microsatellite markers were developed using 454 pyrosequencing. A total of 17,033 reads containing dinucleotide microsatellite repeat units (mean, 487 base pairs) were identified from 453,549 reads. Among 32 loci containing more than nine repeat units, 20 primer sets (62%) produced strong PCR products, of which 14 were polymorphic. In an analysis of 60 individuals from two R. pulchra populations, the number of alleles per locus ranged from 1–10, and the mean allelic richness was 4.7. No linkage disequilibrium was found between any pair of loci, indicating that the markers were independent. The Hardy–Weinberg equilibrium test showed significant deviation in two of the 28 single-loci after sequential Bonferroni’s correction. Using 11 primer sets, cross-species amplification was demonstrated in nine related species from four families within two classes. Among the 11 loci amplified from three other Rajidae family species; three loci were polymorphic. A monomorphic locus was amplified in all three Rajidae family species and the Dasyatidae family. Two Rajidae polymorphic loci amplified monomorphic target DNAs in four species belonging to the Carcharhiniformes class, and another was polymorphic in two Carcharhiniformes species. PMID:22837688

  15. Rapid development of microsatellite markers with 454 pyrosequencing in a vulnerable fish, the mottled skate, Raja pulchra.

    Science.gov (United States)

    Kang, Jung-Ha; Park, Jung-Youn; Jo, Hyun-Su

    2012-01-01

    The mottled skate, Raja pulchra, is an economically valuable fish. However, due to a severe population decline, it is listed as a vulnerable species by the International Union for Conservation of Nature. To analyze its genetic structure and diversity, microsatellite markers were developed using 454 pyrosequencing. A total of 17,033 reads containing dinucleotide microsatellite repeat units (mean, 487 base pairs) were identified from 453,549 reads. Among 32 loci containing more than nine repeat units, 20 primer sets (62%) produced strong PCR products, of which 14 were polymorphic. In an analysis of 60 individuals from two R. pulchra populations, the number of alleles per locus ranged from 1-10, and the mean allelic richness was 4.7. No linkage disequilibrium was found between any pair of loci, indicating that the markers were independent. The Hardy-Weinberg equilibrium test showed significant deviation in two of the 28 single-loci after sequential Bonferroni's correction. Using 11 primer sets, cross-species amplification was demonstrated in nine related species from four families within two classes. Among the 11 loci amplified from three other Rajidae family species; three loci were polymorphic. A monomorphic locus was amplified in all three Rajidae family species and the Dasyatidae family. Two Rajidae polymorphic loci amplified monomorphic target DNAs in four species belonging to the Carcharhiniformes class, and another was polymorphic in two Carcharhiniformes species.

  16. Novel Compounds From Shark and Stingray Epidermal Mucus With Antimicrobial Activity Against Wound Infection Pathogens

    Science.gov (United States)

    2014-03-01

    consistency compared to mucus from any of the ray species. While this difference is difficult to describe, the terms “ gelatinous ” or “sticky” are...visualized using silver stain (Figure 3). As observed with the ray species, protein patterns for clearnose skates are consistent among individuals of the...three clearnose skates, Raja eglanteria, visualized with silver stain. Molecular weights of standard proteins are in kilodaltons (kD). 9

  17. Ontogenetic dietary shift and feeding strategy of Raja undulata Lacepède, 1802 (Chondrichthyes: Rajidae on the Portuguese continental shelf

    Directory of Open Access Journals (Sweden)

    Teresa Moura

    2008-06-01

    Full Text Available Under the scope of an ecosystem approach to fisheries, the understanding of trophic interactions is important for the assessment and consequently the proposal of suitable management measures. Raja undulata, like other rajids, is an important demersal predator in the Portuguese coastal community for which the biological and ecological information is still scarce. The ontogenetic dietary shift was investigated. Major length groups were defined through cluster analysis of the mean abundance of prey items. Prey diversity and feeding strategy were evaluated by length group. Multivariate analysis of variance was performed to test the influence of the factors sex, season and maturity on the diet of this species. It was concluded that R. undulata has a dietary ontogenetic shift within the definition of three major length groups (MLGs: 200-550 mm; 550-750 mm and 750-1000 mm. Diet varied from small and semi-pelagic to large and benthic prey. The feeding strategy of the species also changed from a generalised to a specialised diet. The decapod Polybius henslowi was the main prey item, especially for larger predators. Differences were found between sexes, maturity stages and seasons in each MLG.

  18. Evolution of hematopoiesis: Three members of the PU.1 transcription factor family in a cartilaginous fish, Raja eglanteria

    Science.gov (United States)

    Anderson, M. K.; Sun, X.; Miracle, A. L.; Litman, G. W.; Rothenberg, E. V.

    2001-01-01

    T lymphocytes and B lymphocytes are present in jawed vertebrates, including cartilaginous fishes, but not in jawless vertebrates or invertebrates. The origins of these lineages may be understood in terms of evolutionary changes in the structure and regulation of transcription factors that control lymphocyte development, such as PU.1. The identification and characterization of three members of the PU.1 family of transcription factors in a cartilaginous fish, Raja eglanteria, are described here. Two of these genes are orthologs of mammalian PU.1 and Spi-C, respectively, whereas the third gene, Spi-D, is a different family member. In addition, a PU.1-like gene has been identified in a jawless vertebrate, Petromyzon marinus (sea lamprey). Both DNA-binding and transactivation domains are highly conserved between mammalian and skate PU.1, in marked contrast to lamprey Spi, in which similarity is evident only in the DNA-binding domain. Phylogenetic analysis of sequence data suggests that the appearance of Spi-C may predate the divergence of the jawed and jawless vertebrates and that Spi-D arose before the divergence of the cartilaginous fish from the lineage leading to the mammals. The tissue-specific expression patterns of skate PU.1 and Spi-C suggest that these genes share regulatory as well as structural properties with their mammalian orthologs.

  19. Structural studies on proton/protonation of the protein molecule

    International Nuclear Information System (INIS)

    Morimoto, Yukio; Kida, Akiko; Chatake, Toshiyuki; Yamaguchi, Hiroshi; Hosokawa, Keiichi; Murakami, Takuto; Umino, Masaaki; Tanaka, Ichiro; Hisatome, Ichiro; Yanagisawa, Yasutake; Fujiwara, Satoshi; Hidaka, Yuji; Shimamoto, Shigeru; Fujiwara, Mitsutoshi; Nakanishi, Takeyoshi

    2015-01-01

    This paper reports three studies involved in the analysis of protons and protonation at physiologically active sites in protein molecules. (1) 'Elucidation of the higher-order structure formation and activity performing mechanism of yeast proteasome.' With an aim to apply to anti-cancer drugs, this study performed the shape analysis of the total structure of 26S proteasome using small-angle X-ray scattering to clarify the complex form where controlling elements bonded to the both ends of 20S catalyst body, and analyzed the complex structure between the active sites of 20S and inhibitor (drug). (2) 'Basic study on the neutron experiment of biomolecules such as physiologically active substances derived from Natto-bacteria.' This study conducted the purification, crystallization, and X-ray analysis experiment of nattokinase; high-grade purification and solution experiment of vitamin K2 (menaquinone-7); and Z-DNA crystal structure study related to the neutron crystal analysis of DNA as another biomolecule structure study. (3) 'Functional evaluation on digestive enzymes derived from Nephila clavata.' As an Alzheimer's disease-related amyloid fibril formation model, this study carried out elucidation on the fibrosis and fiber-forming mechanism of the traction fiber of Nephila clavata, and the functional analysis of its degrading enzyme. (A.O.)

  20. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident.

    Science.gov (United States)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato

    2014-01-01

    We measured the concentrations of radiocesium ((134)Cs and (137)Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g(-1) dry for (134)Cs and 3.955 ± 1.756 Bq g(-1) dry for (137)Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of (134)Cs and (137)Cs were 0.825 ± 0.247 Bq g(-1) dry and 1.470 ± 0.454 Bq g(-1) dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of (134)Cs and (137)Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  1. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato

    2014-01-01

    We measured the concentrations of radiocesium ( 134 Cs and 137 Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g −1 dry for 134 Cs and 3.955 ± 1.756 Bq g −1 dry for 137 Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of 134 Cs and 137 Cs were 0.825 ± 0.247 Bq g −1 dry and 1.470 ± 0.454 Bq g −1 dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of 134 Cs and 137 Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. -- Highlights: • We investigated radiocesium contamination of large web spiders in Fukushima. • Spiders collected at three different sites in Fukushima were contaminated. • Radiocesium concentrations of spiders tended to increase with the air radiation dose rates. • Radiocesium concentrations of spiders did not affect by the amount of prey

  2. Local Strongmen At The Village Level: The Conflict Of The Demolition Of The First Raja Brawijaya ‘Petilasan’ At Sudimoro Village, Jombang

    Directory of Open Access Journals (Sweden)

    Mirojul Huda

    2017-12-01

    Full Text Available Having been enacted since 2014, the Act No. 6/2014 has given a spirit and a huge authority to the villages in developing their potential resources. Unfortunately, those special authorities have not been fcollowed by the leadership’s capacity of the village’s head. This paper attempts to analyze the rise of local actors so-called local strongmen at the village level. This study uses Sidel (1999 perspective on how to seek local strongmen in local area at Sudimoro Village, Megaluh District in Jombang Regency. In case, the head of Sudimoro village produces a despotic action by unloading and dredging the historical land where there was a petilasan from King of Majapahit, well-known as Raja Brawijaya 1. Then, this action eventually triggered a conflict in the middle of its society and has been solved after the hall of cultural heritage of the government of Jombang Regency has intervened. This paper concluded that the high of authority and power would potentially rise the new local strongmen at the village level. Therefore, the existence of the principle of recognition and subsidiarity owned by the village is only used by a few local elites for their interests without any accountability and accessibility for the society.

  3. Mechanism of mercurial inhibition of sodium-coupled alanine uptake in liver plasma membrane vesicles from Raja erinacea

    International Nuclear Information System (INIS)

    Sellinger, M.; Ballatori, N.; Boyer, J.L.

    1991-01-01

    In mammalian hepatocytes the L-alanine carrier contains a sulfhydryl group that is essential for its activity and is inhibited by mercurials. In hepatocytes of the evolutionarily primitive little skate (Raja erinacea), HgCl2 inhibits Na(+)-dependent alanine uptake and Na+/K(+)-ATPase and increase K+ permeability. To distinguish between direct effects of HgCl2 on the Na(+)-alanine cotransporter and indirect effects on membrane permeability, [3H]alanine transport was studied in plasma membrane vesicles. [3H]Alanine uptake was stimulated by an out-to-in Na+ but not K+ gradient and was saturable confirming the presence of Na(+)-alanine cotransport in liver plasma membranes from this species. Preincubation of the vesicles with HgCl2 for 5 min reduced initial rates of Na(+)-dependent but not Na(+)-independent alanine uptake in a dose-dependent manner (10-200 microM). In the presence of equal concentrations of NaCl or KCl inside and outside of the vesicles, 75 microM HgCl2 directly inhibited sodium-dependent alanine-[3H]alanine exchange, demonstrating that HgCl2 directly affected the alanine cotransporter. Inhibition of Na(+)-dependent alanine uptake by 30 microM HgCl2 was reversed by dithiothreitol (1 mM). HgCl2 (10-30 microM) also increased initial rates of 22Na uptake (at 5 sec), whereas 22Na uptake rates were decreased at HgCl2 concentrations greater than 50 microM. Higher concentrations of HgCl2 (100-200 microM) produced nonspecific effects on vesicle integrity. These studies indicate that HgCl2 inhibits Na(+)-dependent alanine uptake in skate hepatocytes by three different concentration-dependent mechanisms: direct interaction with the transporters, dissipation of the driving force (Na+ gradient), and loss of membrane integrity

  4. Phylogeny of the genus Stephomyia Tavares, 1916 (Diptera: Cecidomyiidae

    Directory of Open Access Journals (Sweden)

    V. C. Maia

    2017-06-01

    Full Text Available Abstract Stephomyia Tavares, 1916 comprises seven species, all Neotropical: S. clavata (Tavares, 1920; S. epeugeniae Gagné, 1994; S. espiralis Maia, 1993; S. mina Maia, 1993; S. rotundifoliorum Maia, 1993; S. tetralobae Maia, 1993; and S. eugeniae (Felt, 1913. In the present study, a cladistic analysis based upon adult, pupa, larva and gall morphological characters as well as host plant data is carried out in order to discuss the monophyly of the genus and the relationships among the known species. The Stephomyia monophyly was supported by eight synapomorphies: five homoplastic characters and three non-homoplastic characters. Analyzes showed S. clavata with great instability within the genus, probably due to lack of larva, pupa and female data, so S. clavata was deactivated in analyze. The topology found was (S. mina ((S. eugeniae + S. epeugeniae (S. tetralobae (S. rotundifoliorum + S. espiralis.

  5. Long-term temporal and spatial changes in the richness and relative abundance of the inshore fish community of the British North Sea Coast

    Science.gov (United States)

    Henderson, Peter A.

    2017-09-01

    Changes in temporal and spatial composition of the British inshore North Sea fish community are reviewed. Sampling from the cooling water filter screens of power stations bordering the North Sea commenced in the early 1960s. To date, a total of 112 marine fish species have been recorded, a high proportion of the total inshore fish species complement of shallow North Sea British waters. The unrecorded top predators, such as large sharks, swordfish and tuna are not regularly observed in waters fish diversity and abundance in large industrialised estuaries such as the Thames and the Firth of Forth. Linked to spawning and nursery habitat gain, smelt, Osmerus eperlangus, and bass, Dicentrarchus labrax, have greatly increased in abundance. There is no evidence for a decline in species richness since the 1970s. However, elasmobranch species number has declined while two species Raja clavata and Scyliorhinus canicula have remained abundant and one, Mustelus asterias, has increased in abundance. It is argued that overexploitation and habitat destruction remain, as they have been for the last 300 years, the most serious threats to the health of North Sea inshore fish communities. There are no clear signs that climate change is causing species loss, although it may be influencing relative species abundance as species at the southern edge of their range such as the viviparous blenny, Zoarces viviparous, have declined in the southern British North Sea. Power station water temperature records do not show a warming trend, in some estuarine locations temperature has declined with reduced thermal pollution; the temperature record cannot explain the observed major changes in fish relative abundance observed since the 1970s.

  6. Polygalacturonase production by AR2 pectinolytic bacteria through submerged fermentation of raja nangka banana peel (Musa paradisiaca var. formatypica) with variation of carbon source and pectin

    Science.gov (United States)

    Utami, R.; Widowati, E.; Ivenaria, A.; Mahajoeno, E.

    2017-04-01

    Polygalacturonase (EC 3.1.2.15) catalyzes the hydrolysis of α-1,4-glycosidic bonds on galacturonic acid. Polygalacturonase can be produced from AR2 pectinolytic bacteria isolated from orange peel and vegetable waste. Commonly cost production of enzymes were high. However, with the advancement of technology, enzymes can now be manufactured at a low cost. Production of enzymes in low cost media with agro-industrial waste is interesting. Raja nangka banana peel is agro-industrial waste that is uneconomic. Therefore, this material can be used as a pectin source in polygalacturonase production. Polygalacturonase was produced by AR2 pectinolytic bacteria with the addition of various carbon sources (1% glucose, 1% galactose, 1% lactose) and variation of pectin concentrations (5%; 7.5%; 10%). This study used submerged fermentation with a cultivation temperature of 55°C and an agitation speed of 144 rpm for a 48-h incubation time. The results showed that variation of carbon sources and pectin concentrations affected the production of polygalacturonase. After 48 h fermentation, the results showed that the number of cells of samples ranged from 8.3 to 9.445 log cells/mL; the used pectin of samples ranged from 87.170-93.745%; and the polygalacturonase activity of samples ranged from 0.030 to 0.151 U/mL. The highest polygalacturonase activity was obtained by production of polygalacturonase on 1% glucose and 10% pectin medium.

  7. Rapid Development of Microsatellite Markers with 454 Pyrosequencing in a Vulnerable Fish, the Mottled Skate, Raja pulchra

    Directory of Open Access Journals (Sweden)

    Jung-Ha Kang

    2012-06-01

    Full Text Available The mottled skate, Raja pulchra, is an economically valuable fish. However, due to a severe population decline, it is listed as a vulnerable species by the International Union for Conservation of Nature. To analyze its genetic structure and diversity, microsatellite markers were developed using 454 pyrosequencing. A total of 17,033 reads containing dinucleotide microsatellite repeat units (mean, 487 base pairs were identified from 453,549 reads. Among 32 loci containing more than nine repeat units, 20 primer sets (62% produced strong PCR products, of which 14 were polymorphic. In an analysis of 60 individuals from two R. pulchra populations, the number of alleles per locus ranged from 1–10, and the mean allelic richness was 4.7. No linkage disequilibrium was found between any pair of loci, indicating that the markers were independent. The Hardy–Weinberg equilibrium test showed significant deviation in two of the 28 single-loci after sequential Bonferroni’s correction. Using 11 primer sets, cross-species amplification was demonstrated in nine related species from four families within two classes. Among the 11 loci amplified from three other Rajidae family species; three loci were polymorphic. A monomorphic locus was amplified in all three Rajidae family species and the Dasyatidae family. Two Rajidae polymorphic loci amplified monomorphic target DNAs in four species belonging to the Carcharhiniformes class, and another was polymorphic in two Carcharhiniformes species.

  8. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. S Charles Raja. Articles written in Sadhana. Volume 39 Issue 2 April 2014 pp 377-390. Transaction charges allocation using sensitivity factor methodology · S Charles Raja J Jeslin Drusila Nesamalar P Venkatesh · More Details Abstract Fulltext PDF. Deregulation of the electricity industry aims for ...

  9. Effect of temperature and pH on polygalacturonase production by pectinolytic bacteria Bacillus licheniformis strain GD2a in submerged medium from Raja Nangka (Musa paradisiaca var. formatypica) banana peel waste

    Science.gov (United States)

    Widowati, E.; Utami, R.; Mahadjoeno, E.; Saputro, G. P.

    2017-04-01

    The aim of this research were to determine the effect of temperature (45°C, 55°C, 65°C) and pH (5.0; 6.0; 7.0) on the increase of total cell count and polygalacturonase enzyme activity produced from raja nangka banana (Musa paradisiaca var. formatypica) peel waste by pectinolytic bacterial Bacillus licheniformis strain GD2a. This research applied two sample repetition and one analysis repetition. The result showed temperature and pH affect total cell count. The total cell count on 45°C and pH 7 recorded the highest number at 9.469 log cell/ml. Temperature and pH also affected pectin concentration at the end of fermentation. The lowest pectin concentration recorded at 45°C and pH 7 was 0.425 %. The highest enzyme activity recorded at 65°C and pH 7 was 0.204 U/ml. The highest enzyme protein concentration was recorded at 65°C and resulted as 0.310 mg/ml on pH 6. The highest specific activity was 19.527 U/mg at 65°C and pH 7. By this result, could be concluded that optimum condition process on polygalacturonase production was at 65°C and pH 7 because it gave highest enzyme activity result (0,204 U/ml).

  10. Isolation and characterization of CXC receptor genes in a range of elasmobranchs.

    Science.gov (United States)

    Goostrey, Anna; Jones, Gareth; Secombes, Christopher J

    2005-01-01

    The CXC group of chemokines exert their cellular effects via the CXCR group of G-protein coupled receptors. Six CXCR genes have been identified in humans (CXCR1-6), and homologues to some of these have been isolated from a range of vertebrate species. Here we isolate and characterize CXCR genes from a range of elasmobranch species. One CXCR1/2 gene fragment isolated from Scyliorhinus caniculus (lesser spotted catshark), and two CXCR1/2 copies from each of the elasmobranchs, Cetorhinus maximus (basking shark), Carcharodon carcharias (great white shark), and Raja naevus (cuckoo ray), exhibit high similarity to both CXCR1 and CXCR2. The two copies evident in the cuckoo ray and lamniform sharks provide strong evidence of CXCR1/2 lineage specific duplication in rays and sharks. A CXCR fragment isolated from Lamna ditropis (salmon shark) shows high similarity to a range of CXCR4 genes and strong clustering with CXCR4 gene homologues was apparent during phylogenetic reconstruction.

  11. New specimens and records of chondrichthyan fishes (Vertebrata: Chondrichthyes off the Mexican Pacific coast Nuevos ejemplares y nuevos registros de peces cartilaginosos (Vertebrata: Chondrichthyes de la costa del Pacífico mexicano

    Directory of Open Access Journals (Sweden)

    Gorgonio Ruiz-Campos

    2010-08-01

    Full Text Available New specimens and new records of occurrence for 10 species of chondrichthyan (elasmobranch and chimaeroid fishes previously unknown or little documented for the continental shelf of the Mexican Pacific are reported. This contribution provides the first record of Centroscyllium nigrum, Isurus paucus, and Bathyraja trachura for the Mexican Pacific, as well as new specimens of Hydrolagus colliei, Hexanchus griseus, Echinorhinus cookei, Pseudocarcharias kamoharai, and Raja velezi for the western coast of the Baja California Peninsula, including the intermediate record within the known distribution range for Apristurus kampae, and the southernmost record for Raja inornata.Se reportan nuevos ejemplares y nuevos registros de concurrencia para 10 especies de elasmobranquios previamente desconocidos o con muy poca documentación en aguas del Pacífico mexicano. Esta contribución ofrece el primer registro de Centroscyllium nigrum, Isurus paucus, y Bathyraja trachura en el Pacífico mexicano; así como nuevos ejemplares de Hydrolagus colliei, Hexanchus griseus, Echinorhinus cookei, Pseudocarcharias kamoharai y Raja velezi en la costa occidental de la península de Baja California, con la inclusión del registro intermedio en el ámbito de distribución conocida para Apristurus kampae, y el registro más meridional para Raja inornata.

  12. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

    Science.gov (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

    2015-11-01

    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  13. Oxygen consumption in Mediterranean octocorals under different temperatures

    NARCIS (Netherlands)

    Previati, M.; Scinto, A.; Cerrano, C.; Osinga, R.

    2010-01-01

    Ecosystem resilience to climate anomalies is related to the physiological plasticity of organisms. To characterize the physiological response of some common Mediterranean gorgonians to fluctuations in temperature, four species (Paramuricea clavata, Eunicella singularis, Eunicella cavolinii and

  14. Kopi dan Kakao dalam Kreasi Motif Batik Khas Jember

    Directory of Open Access Journals (Sweden)

    Irfa'ina Rohana Salma

    2015-06-01

    Full Text Available ABSTRAK Batik Jember selama ini identik dengan motif daun tembakau. Visualisasi daun tembakau dalam motif Batik Jember cukup lemah, yaitu kurang berkarakter karena motif yang muncul adalah seperti gambar daun pada umumnya. Oleh karena itu perlu diciptakan desain motif batik khas Jember yang sumber inspirasinya digali dari kekayaan alam lainnya dari Jember yang mempunyai bentuk spesifik dan karakteristik sehingga identitas motif bisa didapatkan dengan lebih kuat. Hasil alam khas Jember tersebut adalah kopi dan kakao. Tujuan penciptaan seni ini adalah untuk menghasilkan motif batik  baru yang mempunyai ciri khas Jember. Metode yang digunakan yaitu pengumpulan data, pengamatan mendalam terhadap objek penciptaan, pengkajian sumber inspirasi, pembuatan desain motif, dan perwujudan menjadi batik. Dari penciptaan seni ini berhasil dikreasikan 6 (enam motif batik yaitu: (1 Motif Uwoh Kopi; (2 Motif Godong Kopi;  (3 Motif Ceplok Kakao; (4 Motif Kakao Raja; (5 Motif Kakao Biru; dan (6 Motif Wiji Mukti. Berdasarkan hasil penilaian “Selera Estetika” diketahui bahwa motif yang paling banyak disukai adalah Motif Uwoh Kopi dan Motif Kakao Raja. Kata kunci: Motif Woh Kopi, Motif Godong Kopi, Motif Ceplok Kakao, Motif Kakao Raja, Motif Kakao Biru, Motif Wiji Mukti ABSTRACTBatik Jember is synonymous with tobacco leaf motif. Tobacco leaf shape is quite weak in the visual appearance characterized as that motif emerges like a picture of leaves in general. Therefore, it is necessary to create a distinctive design motif extracted from other natural resources of Jember that have specific shapes and characteristics that can be obtained as the stronger motif identity. The typical natural resources from Jember are coffee and cocoa. The purpose of the creation of this art is to produce the unique, creative and innovative batik and have specific characteristics of Jember. The method used are data collection, observation of the object, reviewing inspiration sources

  15. Kajian Penundaan Kematangan Pisang Raja (Musa paradisiaca Var. Sapientum L. Melalui Penggunaan Media Penyerap Etilen Kalium Permanganat

    Directory of Open Access Journals (Sweden)

    Sholihati Sholihati

    2015-12-01

    Full Text Available Abstrak. Indonesia adalah salah satu penghasil pisang terbesar di asia. Masa hidup pisang relatif pendek. Sehingga tidak dapat menjangkau jarak jauh dalam pemasaran. Tujuan penelitian ini adalah untuk mempelajari efek penyerap etilen kalium permanganat untuk menunda proses pematangan, untuk mengetahui efektivitas etilen kalium permanganat untuk menyerap etilen dan untuk mengembangkan model penentuan konsentrasi etilen selama penyimpanan sebelum proses pematangan. Hasil penelitian ini menunjukkan bahwa konsentrasi etilen setara dengan 0,16 ml/g.jam pada perlakuan 10 g , diikuti oleh perlakuan penyerap etilen 20 g dengan nilai setara dengan 0,06 ml/g.jam, penyerap 30 g sama dengan 0,03 ml / g.hour dan penyerap 40 g sama dengan 0,02 ml / g.hour pada suhu kamar 25 – 28 oC. Pada suhu dari 13, efektivitas penyerap etilen sama dengan 0,11 ml / g.hour pada perlakuan konsentrasi penyerap 10 g, diikuti oleh penyerap 20 g sama dengan 0,05 ml / g.hour . Penyerap 30 g sama dengan 0,03 ml / g.hour dan penyerap 40 g sama dengan 0,02 ml / g.hour. Fase klimakterik pada pisang dengan suhu 13 oC adalah di hari ke-11 , dengan produksi CO2 sama dengan 47,12 ml/kg dan produksi etilen sama dengan 1.82 ppm pada suhu ruang. Pada penggunaan etilen permanganat potasium diperoleh umur penyimpanan yang lebih panjang pada pisang, yaitu 20 hari pada suhu ruang dan 45 hari pada suhu 13 oC.   Study of Lengthen Shelf Life of Pisang Raja (Musa paradisiaca Var. Sapientum L. by Using Absorber Ethylene  Potassium Permanganate Substance Abstract. Indonesia is one of the biggest bananas producers in Asia. Banana is categorized as perishable  commodity,  therefore it cannot market is limited by distribution time.  Reach a long distance in marketing. This aim of this research is to study the effect of ethylene potassium permanganate to delay  the ripening of the fruit process, to know the effectiveness of ethylene potassium permanganate to absorb the ethylene and to develop

  16. JUSTIFICATION OF MODES THERMAL PROCESSING OF THE SEMIFINISHED THORNY SKATE TO PRODUCTION OF FISH CULINARY PRODUCTS OF FUNCTIONAL PURPOSE

    Directory of Open Access Journals (Sweden)

    V. V. Shchetinskii

    2014-01-01

    Full Text Available Summary. Raja radiatd, the non-conventional object of commercial fishing in North-East Atlantic region which is not under fishing quota should be declared as a cost-effective full bio raw material for the broad line food production enriched with chondroitin sulfate (a valuable biological component with proved anti-inflammatory and anti-tumor acting. The main obstacle for the industrial food processing of the Raja radiatd is a high level of urea in the muscle tissue. The patented technical solution to this problem is being proposed. Justified modes of preliminary and final heat treatment for a wide range of fish culinary products of functional purpose of the Raja radiatd. Assessed by calculation of indicators of the biological value of the protein ready culinary products of the pitch with regard to experimentally established weight loss, protein and fat at all stages of the thermal treatment of the material. The high level of chondroitin sulfate in the culinary finished product is experimentally confirmed. The outcome of the research was the development of formulations and manufacturing fish culinary products functionality of a wide range based on the use of Raja radiatd meat. Complex physico-chemical analysis of raw materials, semi-finished and finished products allowed to develop standards of waste, loss, and output of finished products, to optimize the formulation of products and technological conditions of its production. Experimentally determine some parameters of the nutritional value of new products, comprehensive assessment of its quality, which confirmed its improved handling compared to the same fishery products provided to the consumer market in Murmansk.

  17. Tunnelityömaan poistovesien käsittely

    OpenAIRE

    Paakki, Otto

    2014-01-01

    Insinöörityö tehtiin SRV Rakennus Oy:n toimeksiannosta selvittämään tunnelissa käytettävien puhdistusmenetelmien luonnetta ja niiden tehokkuutta työmaaympäristössä. Poistovedet käsitellään vesilaitoksen määrittelemiin raja-arvoihin, ennen kuin vedet lasketaan hulevesiverkostoon. Vesilaitoksella on oikeus olla ottamatta vastaan vettä, mikäli haitta-ainepitoisuuden kasvavat ja ylittävät toistuvasti raja-arvoja. Poistovesiä syntyy työmaalla monista työvaiheista eli niiden käsittely on erittäin m...

  18. Characterization of the functional and anatomical differences in the atrial and ventricular myocardium from three species of elasmobranch fishes: smooth dogfish (Mustelus canis), sandbar shark (Carcharhinus plumbeus), and clearnose skate (Raja eglanteria).

    Science.gov (United States)

    Larsen, Julie; Bushnell, Peter; Steffensen, John; Pedersen, Morten; Qvortrup, Klaus; Brill, Richard

    2017-02-01

    We assessed the functional properties in atrial and ventricular myocardium (using isolated cardiac strips) of smooth dogfish (Mustelus canis), clearnose skate (Raja eglanteria), and sandbar shark (Carcharhinus plumbeus) by blocking Ca 2+ release from the sarcoplasmic reticulum (SR) with ryanodine and thapsigargin and measuring the resultant changes in contraction-relaxation parameters and the force-frequency relationship at 20 °C and 30 °C. We also examined ultrastructural differences with electron microscopy. In tissues from smooth dogfish, net force (per cross-sectional area) and measures of the speeds of contraction and relaxation were all higher in atrial than ventricular myocardium at both temperatures. Atrial-ventricular differences were evident in the other two species primarily in measures of the rates of contraction and relaxation. Ryanodine-thapsigargin treatment reduced net force and its maximum positive first derivative (i.e., contractility), and increased time to 50 % relaxation in atrial tissue from smooth dogfish at 30 °C. It also increased times to peak force and half relaxation in clearnose skate atrial and ventricular tissue at both temperatures, but only in atrial tissue from sandbar shark at 30 °C; indicating that SR involvement in excitation-contraction (EC) coupling is species- and temperature-specific in elasmobranch fishes, as it is in teleost fishes. Atrial and ventricular myocardium from all three species displayed a negative force-frequency relationship, but there was no evidence that SR involvement in EC coupling was influenced by heart rate. SR was evident in electron micrographs, generally located in proximity to mitochondria and intercalated discs, and to a lesser extent between the myofibrils; with mitochondria being more numerous in ventricular than atrial myocardium in all three species.

  19. In planta processing and glycosylation of a nematode CLE effector and its interaction with a CLV2-like receptor to promote parasitism

    Science.gov (United States)

    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ESR (CLE)-like proteins have been identified in several cyst nematodes including the potato cyst nematode (PCN); however, th...

  20. CLE peptides regulate lateral root development in response to nitrogen nutritional status of plants.

    Science.gov (United States)

    Araya, Takao; von Wirén, Nicolaus; Takahashi, Hideki

    2014-01-01

    CLE (CLAVATA3/embryo surrounding region (ESR)) peptides control meristem functions in plants. Our recent study highlights the critical role of a peptide-receptor signaling module composed of nitrogen (N)-responsive CLE peptides and the CLAVATA1 (CLV1) leucine-rich repeat receptor-like kinase in controlling lateral root development in Arabidopsis thaliana. CLE1, -3, -4 and -7 are expressed in root pericycle cells in Arabidopsis roots under N-limited growth conditions. Overexpression of these CLE genes inhibits lateral root emergence from the primary root. The inhibitory action of N-responsive CLE peptides on lateral root development requires the function of CLV1 expressed in phloem companion cells in roots, suggesting that downstream signals are transferred through phloem for systemic regulation of root system architecture. An additional mechanism downstream of CLV1 feedback-regulates transcript levels of N-responsive CLE genes in roots for fine-tuning the signal amplitude.

  1. Dual roles for the variable domain in protein trafficking and host-specific recognition of Heterodera glycines CLE effector proteins

    Science.gov (United States)

    Soybean cyst nematodes (Heterodera glycines) produce secreted effector proteins that function as peptide mimics of plant CLAVATA3 / ESR (CLE)-like peptides probably involved in the developmental reprogramming of root cells to form specialized feeding cells called syncytia. The site of action and me...

  2. Functional characterization of CLE peptides from a plant-parasitic nematode Globodera rostochiensis

    Science.gov (United States)

    Plant CLAVATA3/ESR (CLE) proteins are a large family of secreted peptide ligands that play important roles in plant growth and development. Recent evidence suggests that plant-parasitic cyst nematodes secrete ligand mimics of plant CLE peptides to modify selected host root cells into multinucleate f...

  3. Cellular targeting and host-specific recognition of cyst nematode CLE proteins

    Science.gov (United States)

    Cyst nematodes produce secreted peptide mimics of plant CLAVATA3/ESR (CLE) peptides likely involved in redirecting CLE signaling pathways active in roots to form unique and essential feeding cells. The hallmark structure of plant CLEs, which includes an N-terminal signal peptide, a highly variable d...

  4. X-ray filter for x-ray powder diffraction

    Science.gov (United States)

    Sinsheimer, John Jay; Conley, Raymond P.; Bouet, Nathalie C. D.; Dooryhee, Eric; Ghose, Sanjit

    2018-01-23

    Technologies are described for apparatus, methods and systems effective for filtering. The filters may comprise a first plate. The first plate may include an x-ray absorbing material and walls defining first slits. The first slits may include arc shaped openings through the first plate. The walls of the first plate may be configured to absorb at least some of first x-rays when the first x-rays are incident on the x-ray absorbing material, and to output second x-rays. The filters may comprise a second plate spaced from the first plate. The second plate may include the x-ray absorbing material and walls defining second slits. The second slits may include arc shaped openings through the second plate. The walls of the second plate may be configured to absorb at least some of second x-rays and to output third x-rays.

  5. X-ray fluorescence imaging with polycapillary X-ray optics

    International Nuclear Information System (INIS)

    Yonehara, Tasuku; Yamaguchi, Makoto; Tsuji, Kouichi

    2010-01-01

    X-ray fluorescence spectrometry imaging is a powerful tool to provide information about the chemical composition and elemental distribution of a specimen. X-ray fluorescence spectrometry images were conventionally obtained by using a μ-X-ray fluorescence spectrometry spectrometer, which requires scanning a sample. Faster X-ray fluorescence spectrometry imaging would be achieved by eliminating the process of sample scanning. Thus, we developed an X-ray fluorescence spectrometry imaging instrument without sample scanning by using polycapillary X-ray optics, which had energy filter characteristics caused by the energy dependence of the total reflection phenomenon. In the present paper, we show that two independent straight polycapillary X-ray optics could be used as an energy filter of X-rays for X-ray fluorescence. Only low energy X-rays were detected when the angle between the two optical axes was increased slightly. Energy-selective X-ray fluorescence spectrometry images with projection mode were taken by using an X-ray CCD camera equipped with two polycapillary optics. It was shown that Fe Kα (6.40 keV) and Cu Kα (8.04 keV) could be discriminated for Fe and Cu foils.

  6. Paratrygon aiereba (Müller & Henle, 1841: the senior synonym of the freshwater stingray disceus thayeri Garman, 1913 (chondrichthyes: potamotrygonidae

    Directory of Open Access Journals (Sweden)

    Ricardo S. Rosa

    1990-01-01

    Full Text Available A review of the original descriptions and available types of the South American freshwater stingrays Trygon aiereba Müller & Henle, 1841, Trygon strogylopterus Schomburgk, 1843 and Disceus thayeri Garman, 1913 indicates that these three nominal species are synonymous. The senior name, placed in the monotypic genus Paratrygon Duméril, 1865, established for Trygon aiereba, is available and valid. Based on its description, T. aiereba is a freshwater stingray. Therefore, this taxon is not the same as Raja ajereba Walbaum and Raja orbicularis Schneider, both names established for the marine "Aiereba" of Marcgrave, and which preferably should be treated as nomina dubia. Paratrygon does not replace Potamotrygon Garman, 1877 as the type genus, because the family name Potamotrygonidae Garman, 1877 has priority over Paratrygonidade Gill, 1893.A revisão das descrições originais e dos tipos existentes das raias de água doce Trygon aiereba Müller & Henle, 1841, Trygon strogylopterus Schomburgk, 1843, e Disceus thayeri Garman, 1913, indica que essas três espécies nominais são sinônimas. O nome sênior, colocado no gênero monotípico Paratrygon Duméril, 1865, estabelecido para T. aiereba, é disponível e válido. A descrição de T. aiereba corresponde claramente a uma raia de agua doce; portanto esta espécie não é um sinônimo de Raja ajereba Walbaum e de Raja orbicularis Schneider, ambos os nomes propostos para a "Aiereba " marinha de Marcgrave, e que preferivelmente devem ser tratados como nomina dubia. Paratrygon não substitui Potamotrygon Garman, 1877 como gênero-tipo, porque o nome de família Potamotrygonidae Garman, 1877 tem prioridade sobre Paratrygonidae Gill. 1893.

  7. Wide field X-ray telescopes: Detecting X-ray transients/afterglows related to gamma ray bursts

    International Nuclear Information System (INIS)

    Hudec, Rene; Pina, Ladislav; Inneman, Adolf; Gorenstein, Paul; Rezek, Tomas

    1999-01-01

    The recent discovery of X-ray afterglows of GRBs opens the possibility of analyses of GRBs by their X-ray detections. However, imaging X-ray telescopes in current use mostly have limited field of view. Alternative X-ray optics geometries achieving very large fields of view have been theoretically suggested in the 70ies but not constructed and used so far. We review the geometries and basic properties of the wide-field X-ray optical systems based on one- and two-dimensional lobster-eye geometry and suggest technologies for their development and construction. First results of the development of double replicated X-ray reflecting flats for use in one-dimensional X-ray optics of lobster eye type are presented and discussed. Optimum strategy for locating GRBs upon their X-ray counterparts is also presented and discussed

  8. Crumbling Diversity: Comparison of Historical Archived and Contemporary Natural Populations Indicate Reduced Genetic Diversity and Increasing Genetic Differentiation in the Golden-Cheeked Warbler

    Science.gov (United States)

    2011-06-01

    clavata. Heredity 101:120–126 Crow JF, Denniston C (1988) Inbreeding and variance effective population numbers. Evolution 42:482–495 Dixo M, Metzger JP...University Press, Cambridge, pp 361–366 Young A, Boyle T, Brown T (1996) The population genetic consequences of habitat fragmentation for plants . Trends

  9. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

    2014-01-01

    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  10. X-Ray Absorption with Transmission X-Ray Microscopes

    NARCIS (Netherlands)

    de Groot, F.M.F.

    2016-01-01

    In this section we focus on the use of transmission X-ray microscopy (TXM) to measure the XAS spectra. In the last decade a range of soft X-ray and hard X-ray TXM microscopes have been developed, allowing the measurement of XAS spectra with 10–100 nm resolution. In the hard X-ray range the TXM

  11. Tallinna esimene elektrijaam saab 24. märtsil 91-aastaseks / Robert Nerman

    Index Scriptorium Estoniae

    Nerman, Robert, 1946-2015

    2004-01-01

    Tallinna Linna Elektri Keskjaama ajaloost. Elektrijaama masinajaama, katlamaja ja kontorihoone projekteeris arhitekt G. (?) Schmidt. Hoonete ehitust juhatas insener P. Kürenius. Telliskorstna rajas insener J. Russwurmi ehituskontor

  12. Raja Roomann 80 / Maimu Raudsepp

    Index Scriptorium Estoniae

    Raudsepp, Maimu

    2001-01-01

    16. septembril 2001 tähistas oma sünnipäeva pedagoogikamagister, Cincinnati Kultuuriühingu asutaja ja ajaloouurija, raamatu "Urban Growth and the Development of an urban Sewer System. City of Cincinnati, 1800-1915" autor

  13. X-ray echoes from gamma-ray bursts

    International Nuclear Information System (INIS)

    Dermer, C.D.; Hurley, K.C.; Hartmann, D.H.

    1991-01-01

    The identification of an echo of reflected radiation in time histories of gamma-ray burst spectra can provide important information about the existence of binary companions or accretion disks in gamma-ray burst systems. Because of the nature of Compton scattering, the spectrum of the echo will be attenuated at gamma-ray energies compared with the spectrum of the primary burst emission. The expected temporal and spectral signatures of the echo and a search for such echoes are described, and implications for gamma-ray burst models are discussed. 35 refs

  14. 76 FR 45570 - Consumer Advisory Committee

    Science.gov (United States)

    2011-07-29

    ... Consumer Action Network--Claude Stout Digital Policy Institute--Barry Umansky Hearing Loss Association of...--Debra Berlyn (Chairperson) Native Public Media--Dr. Traci Morris Rochester Institute of Technology--Raja...

  15. Gastro-intestinal handling of water and solutes in three species of elasmobranch fish, the white-spotted bamboo shark, Chiloscyllium plagiosum, little skate, Leucoraja erinacea and the clear nose skate Raja eglanteria.

    Science.gov (United States)

    Anderson, W Gary; Dasiewicz, Patricia J; Liban, Suadi; Ryan, Calen; Taylor, Josi R; Grosell, Martin; Weihrauch, Dirk

    2010-04-01

    The present study reports aspects of GI tract physiology in the white-spotted bamboo shark, Chiloscyllium plagiosum, little skate, Leucoraja erinacea and the clear nose skate, Raja eglanteria. Plasma and stomach fluid osmolality and solute values were comparable between species, and stomach pH was low in all species (2.2 to 3.4) suggesting these elasmobranchs may maintain a consistently low stomach pH. Intestinal osmolality, pH and ion values were comparable between species, however, some differences in ion values were observed. In particular Ca(2+) (19.67+/-3.65mM) and Mg(2+) (43.99+/-5.11mM) were high in L. erinacea and Mg(2+) was high (130.0+/-39.8mM) in C. palgiosum which may be an indication of drinking. Furthermore, intestinal fluid HCO(3)(-) values were low (8.19+/-2.42 and 8.63+/-1.48mM) in both skates but very high in C. plagiosum (73.3+/-16.3mM) suggesting ingested seawater may be processed by species-specific mechanisms. Urea values from the intestine to the colon dropped precipitously in all species, with the greatest decrease seen in C. plagiosum (426.0+/-8.1 to 0mM). This led to the examination of the molecular expression of both a urea transporter and a Rhesus like ammonia transporter in the intestine, rectal gland and kidney in L. erinacea. Both these transporters were expressed in all tissues; however, expression levels of the Rhesus like ammonia transporter were orders of magnitude higher than the urea transporter in the same tissue. Intestinal flux rates of solutes in L. erinacea were, for the most part, in an inward direction with the notable exception of urea. Colon flux rates of solutes in L. erinacea were all in an outward direction, although absolute rates were considerably lower than the intestine, suggestive of a much tighter epithelia. Results are discussed in the context of the potential role of the GI tract in salt and water, and nitrogen, homeostasis in elasmobranchs.

  16. X-ray astronomy

    International Nuclear Information System (INIS)

    Giacconi, R.; Gursky, H.

    1974-01-01

    This text contains ten chapters and three appendices. Following an introduction, chapters two through five deal with observational techniques, mechanisms for the production of x rays in a cosmic setting, the x-ray sky and solar x-ray emission. Chapters six through ten include compact x-ray sources, supernova remnants, the interstellar medium, extragalactic x-ray sources and the cosmic x-ray background. Interactions of x rays with matter, units and conversion factors and a catalog of x-ray sources comprise the three appendices. (U.S.)

  17. Very high-energy gamma rays from gamma-ray bursts.

    Science.gov (United States)

    Chadwick, Paula M

    2007-05-15

    Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.

  18. Heterologous Production of a Novel Cyclic Peptide Compound, KK-1, in Aspergillus oryzae

    Directory of Open Access Journals (Sweden)

    Akira Yoshimi

    2018-04-01

    Full Text Available A novel cyclic peptide compound, KK-1, was originally isolated from the plant-pathogenic fungus Curvularia clavata. It consists of 10 amino acid residues, including five N-methylated amino acid residues, and has potent antifungal activity. Recently, the genome-sequencing analysis of C. clavata was completed, and the biosynthetic genes involved in KK-1 production were predicted by using a novel gene cluster mining tool, MIDDAS-M. These genes form an approximately 75-kb cluster, which includes nine open reading frames, containing a non-ribosomal peptide synthetase (NRPS gene. To determine whether the predicted genes were responsible for the biosynthesis of KK-1, we performed heterologous production of KK-1 in Aspergillus oryzae by introduction of the cluster genes into the genome of A. oryzae. The NRPS gene was split in two fragments and then reconstructed in the A. oryzae genome, because the gene was quite large (approximately 40 kb. The remaining seven genes in the cluster, excluding the regulatory gene kkR, were simultaneously introduced into the strain of A. oryzae in which NRPS had already been incorporated. To evaluate the heterologous production of KK-1 in A. oryzae, gene expression was analyzed by RT-PCR and KK-1 productivity was quantified by HPLC. KK-1 was produced in variable quantities by a number of transformed strains, along with expression of the cluster genes. The amount of KK-1 produced by the strain with the greatest expression of all genes was lower than that produced by the original producer, C. clavata. Therefore, expression of the cluster genes is necessary and sufficient for the heterologous production of KK-1 in A. oryzae, although there may be unknown factors limiting productivity in this species.

  19. Heterologous Production of a Novel Cyclic Peptide Compound, KK-1, in Aspergillus oryzae.

    Science.gov (United States)

    Yoshimi, Akira; Yamaguchi, Sigenari; Fujioka, Tomonori; Kawai, Kiyoshi; Gomi, Katsuya; Machida, Masayuki; Abe, Keietsu

    2018-01-01

    A novel cyclic peptide compound, KK-1, was originally isolated from the plant-pathogenic fungus Curvularia clavata . It consists of 10 amino acid residues, including five N -methylated amino acid residues, and has potent antifungal activity. Recently, the genome-sequencing analysis of C. clavata was completed, and the biosynthetic genes involved in KK-1 production were predicted by using a novel gene cluster mining tool, MIDDAS-M. These genes form an approximately 75-kb cluster, which includes nine open reading frames, containing a non-ribosomal peptide synthetase (NRPS) gene. To determine whether the predicted genes were responsible for the biosynthesis of KK-1, we performed heterologous production of KK-1 in Aspergillus oryzae by introduction of the cluster genes into the genome of A. oryzae . The NRPS gene was split in two fragments and then reconstructed in the A. oryzae genome, because the gene was quite large (approximately 40 kb). The remaining seven genes in the cluster, excluding the regulatory gene kkR , were simultaneously introduced into the strain of A. oryzae in which NRPS had already been incorporated. To evaluate the heterologous production of KK-1 in A. oryzae , gene expression was analyzed by RT-PCR and KK-1 productivity was quantified by HPLC. KK-1 was produced in variable quantities by a number of transformed strains, along with expression of the cluster genes. The amount of KK-1 produced by the strain with the greatest expression of all genes was lower than that produced by the original producer, C. clavata . Therefore, expression of the cluster genes is necessary and sufficient for the heterologous production of KK-1 in A. oryzae , although there may be unknown factors limiting productivity in this species.

  20. High-Resolution X-ray Emission and X-ray Absorption Spectroscopy

    NARCIS (Netherlands)

    Groot, F.M.F. de

    2000-01-01

    In this review, high-resolution X-ray emission and X-ray absorption spectroscopy will be discussed. The focus is on the 3d transition-metal systems. To understand high-resolution X-ray emission and reso-nant X-ray emission, it is first necessary to spend some time discussing the X-ray absorption

  1. Flash X-ray

    International Nuclear Information System (INIS)

    Sato, Eiichi

    2003-01-01

    Generation of quasi-monochromatic X-ray by production of weakly ionized line plasma (flash X-ray), high-speed imaging by the X-ray and high-contrast imaging by the characteristic X-ray absorption are described. The equipment for the X-ray is consisted from the high-voltage power supply and condenser, turbo molecular pump, and plasma X-ray tube. The tube has a long linear anticathode to produce the line plasma and flash X-ray at 20 kA current at maximum. X-ray spectrum is measured by the imaging plate equipped in the computed radiography system after diffracted by a LiF single crystal bender. Cu anticathode generates sharp peaks of K X-ray series. The tissue images are presented for vertebra, rabbit ear and heart, and dog heart by X-ray fluoroscopy with Ce anticathode. Generation of K-orbit characteristic X-ray with extremely low bremsstrahung is to be attempted for medical use. (N.I.)

  2. Metamaterials for light rays: ray optics without wave-optical analog in the ray-optics limit

    International Nuclear Information System (INIS)

    Hamilton, Alasdair C; Courtial, Johannes

    2009-01-01

    Volumes of sub-wavelength electromagnetic elements can act like homogeneous materials: metamaterials. In analogy, sheets of optical elements such as prisms can act ray-optically like homogeneous sheet materials. In this sense, such sheets can be considered to be metamaterials for light rays (METATOYs). METATOYs realize new and unusual transformations of the directions of transmitted light rays. We study here, in the ray-optics and scalar-wave limits, the wave-optical analog of such transformations, and we show that such an analog does not always exist. Perhaps, this is the reason why many of the ray-optical possibilities offered by METATOYs have never before been considered.

  3. Kas tõesti ainult Vene propaganda / Magnus Ilmjärv

    Index Scriptorium Estoniae

    Ilmjärv, Magnus, 1961-

    2007-01-01

    Kommentaar artiklile: Kagge, Rasmus ; Lõhmus, Alo. Vene propagandafilmide ajaloovalede välimääraja // Postimees Extra, 29. Sept. 2007. Autori täpsustused Konstantin Pätsi tegevuse kohta 1930. aastatel

  4. X-Ray

    Science.gov (United States)

    ... enema. What you can expect During the X-ray X-rays are performed at doctors' offices, dentists' offices, ... as those using a contrast medium. Your child's X-ray Restraints or other techniques may be used to ...

  5. Structure, composition and mechanical properties of the silk fibres of ...

    Indian Academy of Sciences (India)

    The silk egg case and orb web of spiders are elaborate structures that are assembled from a number of components. We analysed the structure, the amino acid and fibre compositions, and the tensile properties of the silk fibres of the egg case of Nephila clavata. SEM shows that the outer and inner covers of the egg case ...

  6. Relation between X-Ray and γ-Ray Emissions for Fermi Blazars ...

    Indian Academy of Sciences (India)

    Abstract. Using γ-ray band data detected by Fermi Large Area Tele- scope (LAT) and X-ray band data for 78 blazars, we find a medium cor- relation between X-ray and γ-ray fluxes in the average state. A medium anticorrelation is also found between X-ray (1 KeV) mean spectral index αx and γ-ray mean spectral index αγ for ...

  7. Synchrotron x-ray microbeam characteristics for x-ray fluorescence analysis

    International Nuclear Information System (INIS)

    Iida, Atsuo; Noma, Takashi

    1995-01-01

    X-ray fluorescence analysis using a synchrotron x-ray microprobe has become an indispensable technique for non-destructive micro-analysis. One of the most important parameters that characterize the x-ray microbeam system for x-ray fluorescence analysis is the beam size. For practical analysis, however, the photon flux, the energy resolution and the available energy range are also crucial. Three types of x-ray microbeam systems, including monochromatic and continuum excitation systems, were compared with reference to the sensitivity, the minimum detection limit and the applicability to various types of x-ray spectroscopic analysis. 16 refs., 5 figs

  8. X-ray sky

    International Nuclear Information System (INIS)

    Gruen, M.; Koubsky, P.

    1977-01-01

    The history is described of the discoveries of X-ray sources in the sky. The individual X-ray detectors are described in more detail, i.e., gas counters, scintillation detectors, semiconductor detectors, and the principles of X-ray spectrometry and of radiation collimation aimed at increased resolution are discussed. Currently, over 200 celestial X-ray sources are known. Some were identified as nebulae, in some pulsations were found or the source was identified as a binary star. X-ray bursts of novae were also observed. The X-ray radiation is briefly mentioned of spherical star clusters and of extragalactic X-ray sources. (Oy)

  9. Neljapaadis pole rikkumised lubatud / Ann Hiiemaa

    Index Scriptorium Estoniae

    Hiiemaa, Ann

    2008-01-01

    Vt. ka Postimees : na russkom jazõke 27. juuni, lk. 13. Eesti paarisaerulise neljapaadi koosseisus on kaks politseinikku, üks logistik ja veebidisainer - Allar Raja, Vladimir Latin, Igor Kuzmin ja Kaspar Taimsoo

  10. List of participants

    Indian Academy of Sciences (India)

    Banerjee S, Department of Atomic Energy, Bhabha Atomic Research Centre, Mumbai .... Gupta Chintan, LMPD, Raja Ramanna Centre for Advanced Technology, ... Kale Mayuri, Department of Biotechnology, M.B. Khalsa College, Indore 452 ...

  11. Skull x-ray

    Science.gov (United States)

    X-ray - head; X-ray - skull; Skull radiography; Head x-ray ... There is low radiation exposure. X-rays are monitored and regulated to provide the minimum amount of radiation exposure needed to produce the image. Most ...

  12. Neck x-ray

    Science.gov (United States)

    X-ray - neck; Cervical spine x-ray; Lateral neck x-ray ... There is low radiation exposure. X-rays are monitored so that the lowest amount of radiation is used to produce the image. Pregnant women and ...

  13. Cosmic rays

    International Nuclear Information System (INIS)

    Tkachev, I.I.

    2014-01-01

    In this talk I will review results of cosmic ray observations at the highest energies. This year the new results on energy spectra, composition and the study of arrival directions of cosmic ray primaries came from the Telescope Array collaboration. I present these results in comparison with measurements done by other recent experiments and discuss their implications for the search of cosmic ray sources. Some related results in gamma-ray astronomy and selected recent advances in theory are also covered. (author)

  14. Soft x-ray emission from gamma-ray bursts observed with ginga

    International Nuclear Information System (INIS)

    Yoshida, Atsumasa; Murakami, Toshio; Itoh, Masayuki

    1989-01-01

    The soft X-ray emission of gamma-ray bursts below 10 keV provides information about size, location, and emission mechanism. The Gamma-ray Burst Detector (GBD) on board Ginga, which consists of a proportional counter and a scintillation detector, covers an energy range down to 1.5 keV with 63 cm 2 effective area. In several of the observed gamma-ray bursts, the intensity of the soft X-ray emission showed a longer decay time of 50 to 100s after the higher energy gamma-ray emission had ended. Although we cannot rule out other models, such as bremsstrahlung and thermal cyclotron types, due to poor statistics, the soft X-ray spectra are consistent with a blackbody of 1 to 2 keV in the late phase of the gamma-ray bursts. This enables us to estimate the size of the blackbody responsible for the X-ray emission. (author)

  15. X-ray astronomy

    International Nuclear Information System (INIS)

    Culhane, J.L.; Sanford, P.W.

    1981-01-01

    X-ray astronomy has been established as a powerful means of observing matter in its most extreme form. The energy liberated by sources discovered in our Galaxy has confirmed that collapsed stars of great density, and with intense gravitational fields, can be studied by making observations in the X-ray part of the electromagnetic spectrum. The astronomical objects which emit detectable X-rays include our own Sun and extend to quasars at the edge of the Universe. This book describes the history, techniques and results obtained in the first twenty-five years of exploration. Space rockets and satellites are essential for carrying the instruments above the Earth's atmosphere where it becomes possible to view the X-rays from stars and nebulae. The subject is covered in chapters, entitled: the birth of X-ray astronomy; the nature of X-radiation; X-rays from the Sun; solar-flare X-rays; X-rays from beyond the solar system; supernovae and their remnants; X-rays from binary stars; white dwarfs and neutron stars; black holes; X-rays from galaxies and quasars; clusters of galaxies; the observatories of the future. (author)

  16. X-ray filter for chest X-rays

    International Nuclear Information System (INIS)

    Ferlic, D.J.

    1984-01-01

    A description is given of an X-ray filter comprised of a sheet of radiation absorbing material with an opening corresponding to the spine and central portion of the heart. The upper portion of the filter exhibits a relatively narrow opening which becomes gradually wider toward the lower portion of the filter. This filter will permit an acceptable density level of x-ray exposure for the lungs while allowing a higher level of x-ray exposure for the mediastinum areas of the body. (author)

  17. Gamma ray astronomy and the origin of galactic cosmic rays

    International Nuclear Information System (INIS)

    Gabici, Stefano

    2011-01-01

    Diffusive shock acceleration operating at expanding supernova remnant shells is by far the most popular model for the origin of galactic cosmic rays. Despite the general consensus received by the model, an unambiguous and conclusive proof of the supernova remnant hypothesis is still missing. In this context, the recent developments in gamma ray astronomy provide us with precious insights into the problem of the origin of galactic cosmic rays, since production of gamma rays is expected both during the acceleration of cosmic rays at supernova remnant shocks and during their subsequent propagation in the interstellar medium. In particular, the recent detection of a number of supernova remnants at TeV energies nicely fits with the model, but it still does not constitute a conclusive proof of it, mainly due to the difficulty of disentangling the hadronic and leptonic contributions to the observed gamma ray emission. The main goal of my research is to search for an unambiguous and conclusive observational test for proving (or disproving) the idea that supernova remnants are the sources of galactic cosmic rays with energies up to (at least) the cosmic ray knee. Our present comprehension of the mechanisms of particle acceleration at shocks and of the propagation of cosmic rays in turbulent magnetic fields encourages beliefs that such a conclusive test might come from future observations of supernova remnants and of the Galaxy in the almost unexplored domain of multi-TeV gamma rays. (author)

  18. Mandal, Dr Asit Baran

    Indian Academy of Sciences (India)

    Assemblies and Nanomaterials Address: Central Glass & Ceramic Research Institute, 196, Raja SC Mullick Road, Jadavpur, Kolkata 700 032, W.B.. Contact: Office: (033) 2322 3402, (033) 2473 5829. Residence: 80561 43732. Mobile: 99401 21703

  19. Efficacy of Some Combination Regimens of Oral Hypoglycaemic ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research July 2015; 14 (7): 1279-1284 ... Faculty of Pharmacy, Universiti Kebangsaan Malaysia, Jalan Raja Muda Abdul Aziz, .... Overweight. 63. 40.38. Obesity. 45. 28.85. Co-morbidity. DM + Hypertension.

  20. Remote planetary geochemical exploration with the NEAR X-ray/gamma-ray spectrometer

    International Nuclear Information System (INIS)

    Trombka, J.I.; Boynton, W.V.; Brueckner, J.; Squyres, S.; Clark, P.E.; Starr, R.; Evans, L.G.; Floyd, S.R.; McClanahan, T.P.; Goldsten, J.; Mcnutt, R.; Schweitzer, J.S.

    1999-01-01

    The X-ray/gamma-ray spectrometer (XGRS) instrument onboard the Near Earth Asteroid Rendezvous (NEAR) spacecraft will map asteroid 433 Eros in the 0.2 keV to 10 MeV energy region. Measurements of the discrete line X-ray and gamma-ray emissions in this energy domain can be used to obtain both qualitative and quantitative elemental composition maps of the asteroid surface. The NEAR X-ray/gamma-ray spectrometer (XGRS) was turned on for the first time during the week of 7 April 1996. Rendezvous with Eros 433 is expected during December 1998. Observations of solar X-ray spectra during both quiescent and active periods have been made. A gamma-ray transient detection system has been implemented and about three gamma-ray transient events a week have been observed which are associated with either gamma-ray bursts or solar flares

  1. X-ray geometrical smoothing effect in indirect x-ray-drive implosion

    International Nuclear Information System (INIS)

    Mochizuki, Takayasu; Sakabe, Shuji; Yamanaka, Chiyoe

    1983-01-01

    X-ray geometrical smoothing effect in indirect X-ray drive pellet implosion for inertial confinement fusion has been numerically analyzed. Attainable X-ray driven ablation pressure has been found to be coupled with X-ray irradiation uniformity. (author)

  2. X-ray optics and X-ray microscopes: new challenges

    International Nuclear Information System (INIS)

    Susini, J.

    2004-01-01

    Soon after the discovery of X-rays in 1895 by W. Roentgen, it became rapidly clear that the methods traditionally used in the visible light regime, namely refraction, diffraction and reflection were difficult to apply for X-ray optics. The physical origins of these difficulties are closely linked to the very nature of interaction of X-rays with matter. The small deviation δ of the refractive index of condensed matter from unity makes it difficult to extend refraction-based optics from the optical spectral region to the X-ray region because the refraction angle is proportional to δ. Similarly it is very challenging to extend diffraction-based focusing techniques to X-rays because the diffraction angle scales inversely with wavelength. Finally, the use of reflection-based optics is also limited by the very small critical angle for total reflection. All those fundamental limitations prevented for almost one century, the development of X-ray microscopy whereas electron microscopy became a standard tool. In the past twenty years, interests for X-ray microscopy revived, mainly because of several major advances in X-ray sources and X-ray optics. X-ray microscopy techniques are now emerging as powerful and complementary tools for submicron investigations. Soft X-ray microscopes offer traditionally the possibility to form direct images of thick hydrated biological material in near-native environment, at a spatial resolution well beyond that achievable with visible light microscopy. Natural contrast is available in the soft X-ray region, in the so-called ''water-window'', due to the presence of absorption edges of the major constituents (C,N,O). Recent advances in manufacturing techniques have enlarged the accessible energy range of micro-focussing optics and offer new applications in a broad range of disciplines. X-ray microscopy in the 1 - 30 keV energy range is better suited for fluorescence to map trace elements, tomography for 3D imaging and micro-diffraction. The

  3. X-ray filter for chest x-rays

    International Nuclear Information System (INIS)

    Ferlic, D.J.

    1984-01-01

    Filter for use in medical x-ray apparatus to permit higher intensity x-ray exposure in the heart and mediastinum area while maintaining a normal level of x-ray exposure in other areas of the body, particlarly in the lung area. The filter comprises a sheet of radiation absorbing material having an opening therein, said opening corresponding to the spine and central portion of the heart. Accordingly, the upper portion of the filter exhibits a relatively narrow opening which becomes gradually wider toward the lower portion of the filter

  4. Gamma ray generator

    Science.gov (United States)

    Firestone, Richard B; Reijonen, Jani

    2014-05-27

    An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.

  5. Humidity measurement using alpha-ray and beta-ray

    International Nuclear Information System (INIS)

    Matsumoto, Shigeaki; Kobayashi, Hisanobu

    1981-01-01

    Two new hygrometers using radioisotopes were proposed, and the results of tests are described. The one is a dew-point hygrometer utilizing the backscattering phenomena of beta-ray by dew, and the other is a hygrometer by measuring the variation of ionization current by alpha ray due to humidity. The backscattering of beta-ray depends on the atomic number of scatters and the energy of beta-ray. Therefore, the backscattering from dew on a gold plate is different from that from the gold itself. The temperature dependence of the backscattering intensity was measured with a GM counter. Decrease of the intensity was seen at the dew point. A control circuit was designed to measure the dew point automatically. The error of the measurement was within 1 degree C. An alpha-ray ionization hygrometer was constructed. The dependence of ionization current on humidity was measured with an operational amplifier. The resolution of humidity measurement was within 5 percent. (Kato, T.)

  6. Age estimation of burbot using pectoral fin rays, brachiostegal rays, and otoliths

    Science.gov (United States)

    Klein, Zachary B.; Terrazas, Marc M.; Quist, Michael C.

    2014-01-01

    Throughout much of its native distribution, burbot (Lota lota) is a species of conservation concern. Understanding dynamic rate functions is critical for the effective management of sensitive burbot populations, which necessitates accurate and precise age estimates. Managing sensitive burbot populations requires an accurate and precise non-lethal alternative. In an effort to identify a non-lethal ageing structure, we compared the precision of age estimates obtained from otoliths, pectoral fin rays, dorsal fin rays and branchiostegal rays from 208 burbot collected from the Green River drainage, Wyoming. Additionally, we compared the accuracy of age estimates from pectoral fin rays, dorsal fin rays and branchiostegal rays to those of otoliths. Dorsal fin rays were immediately deemed a poor ageing structure and removed from further analysis. Age-bias plots of consensus ages derived from branchiostegal rays and pectoral fin rays were appreciably different from those obtained from otoliths. Exact agreement between readers and reader confidence was highest for otoliths and lowest for branchiostegal rays. Age-bias plots indicated that age estimates obtained from branchiostegal rays and pectoral fin rays were substantially different from age estimates obtained from otoliths. Our results indicate that otoliths provide the most precise age estimates for burbot.

  7. Comparison of x-ray output of inverter-type x-ray equipment

    International Nuclear Information System (INIS)

    Asano, Hiroshi; Miyake, Hiroyuki; Yamamoto, Keiichi

    2000-01-01

    The x-ray output of 54 inverter-type x-ray apparatuses used at 18 institutions was investigated. The reproducibility and linearity of x-ray output and variations among the x-ray equipment were evaluated using the same fluorescence meter. In addition, the x-ray apparatuses were re-measured using the same non-invasive instrument to check for variations in tube voltage, tube current, and irradiation time. The non-invasive instrument was calibrated by simultaneously obtaining measurements with an invasive instrument, employing the tube voltage and current used for the invasive instrument, and the difference was calculated. Reproducibility of x-ray output was satisfactory for all x-ray apparatuses. The coefficient of variation was 0.04 or less for irradiation times of 5 ms or longer. In 84.3% of all x-ray equipment, variation in the linearity of x-ray output was 15% or less for an irradiation time of 5 ms. However, for all the apparatuses, the figure was 50% when irradiation time was the shortest (1 to 3 ms). Variation in x-ray output increased as irradiation time decreased. Variation in x-ray output ranged between 1.8 and 2.5 compared with the maximum and minimum values, excluding those obtained at the shortest irradiation time. The relative standard deviation ranged from ±15.5% to ±21.0%. The largest variation in x-ray output was confirmed in regions irradiated for the shortest time, with smaller variations observed for longer irradiation times. The major factor responsible for variation in x-ray output in regions irradiated for 10 ms or longer, which is a relatively long irradiation time, was variation in tube current. Variation in tube current was slightly greater than 30% at maximum, with an average value of 7% compared with the preset tube current. Variations in x-ray output in regions irradiated for the shortest time were due to photographic effects related to the rise and fall times of the tube voltage waveform. Accordingly, in order to obtain constant x-ray

  8. Irradiated ISM : Discriminating between cosmic rays and X-rays

    NARCIS (Netherlands)

    Meijerink, R.; Spaans, M.; Israel, F. P.

    2006-01-01

    The interstellar medium ( ISM) at the centers of active galaxies is exposed to a combination of cosmic-ray, far-ultraviolet (FUV), and X-ray radiation. We apply photodissociation region (PDR) models to this ISM with both "normal" and highly elevated (5 x 10(-15) s(-1)) cosmic- ray (CR) rates and

  9. Chest X-Ray

    Medline Plus

    Full Text Available ... about chest radiography also known as chest x-rays. Chest x-rays are the most commonly performed x-ray exams and use a very small dose of ... of the inside of the chest. A chest x-ray is used to evaluate the lungs, heart and ...

  10. Ikoonide maalimisest Peipsi ääre vanausuliste juures / Külli Erikson

    Index Scriptorium Estoniae

    Erikson, Külli

    1997-01-01

    19. saj. lõpul ja 20. saj. algul tegutses Raja külas vanausuliste ikoonmaali töökoda. Kunstnikud Gavriil Frolov (1854-1930), Pimen Sofronov (Safronov) (1898-1973). Ka vene 17.-19. saj. ikoonimaalist

  11. Novel X-ray telescopes for wide-field X-ray monitoring

    International Nuclear Information System (INIS)

    Hudec, R.; Inneman, A.; Pina, L.; Sveda, L.

    2005-01-01

    We report on fully innovative very wide-field of view X-ray telescopes with high sensitivity as well as large field of view. The prototypes are very promising, allowing the proposals for space projects with very wide-field Lobster-eye X-ray optics to be considered. The novel telescopes will monitor the sky with unprecedented sensitivity and angular resolution of order of 1 arcmin. They are expected to contribute essentially to study and to understand various astrophysical objects such as AGN, SNe, Gamma-ray bursts (GRBs), X-ray flashes (XRFs), galactic binary sources, stars, CVs, X-ray novae, various transient sources, etc. The Lobster optics based X-ray All Sky Monitor is capable to detect around 20 GRBs and 8 XRFs yearly and this will surely significantly contribute to the related science

  12. Sample analysis using gamma ray induced fluorescent X-ray emission

    Energy Technology Data Exchange (ETDEWEB)

    Sood, B S; Allawadhi, K L; Gandhi, R; Batra, O P; Singh, N [Punjabi Univ., Patiala (India). Nuclear Science Labs.

    1983-01-01

    A non-destructive method for the analysis of materials using gamma ray-induced fluorescent x-ray emission has been developed. In this method, special preparation of very thin samples in which the absorption of the incident gamma rays and the emitted fluorescent x-rays is negligible, is not needed, and the absorption correction is determined experimentally. A suitable choice of the incident gamma ray energies is made to minimise enhancement effects through selective photoionization of the elements in the sample. The method is applied to the analysis of a typical sample of the soldering material using 279 keV and 59.5 keV gamma rays from /sup 203/Hg and /sup 241/Am radioactive sources respectively. The results of the analysis are found to agree well with those obtained from the chemical analysis.

  13. X-Ray and Gamma-Ray Radiation Detector

    DEFF Research Database (Denmark)

    2015-01-01

    Disclosed is a semiconductor radiation detector for detecting X-ray and / or gamma-ray radiation. The detector comprises a converter element for converting incident X-ray and gamma-ray photons into electron-hole pairs, at least one cathode, a plurality of detector electrodes arranged with a pitch...... (P) along a first axis, a plurality of drift electrodes, a readout circuitry being configured to read out signals from the plurality of detector electrodes and a processing unit connected to the readout circuitry and being configured to detect an event in the converter element. The readout circuitry...... is further configured to read out signals from the plurality of drift electrodes, and the processing unit is further configured to estimate a location of the event along the first axis by processing signals obtained from both the detector electrodes and the drift electrodes, the location of the event along...

  14. Kuues üritus tõi Roman Šebrlele maailmameistritiitli / Raigo Pajula, Peep Pahv

    Index Scriptorium Estoniae

    Pajula, Raigo, 1971-

    2007-01-01

    32-aastane tšehh Roman Šeberle on nüüd mitmevõistlejana triumfeerinud kõikidel tiitlivõistlustel. Jaapanis Osakas sai ta MMi kuldmedali. Esimest korda suurvõistlusel osalenud Andres Raja sai 16. koha

  15. Mammaste maksakaste ootab turule tulekut / Mati Määrits

    Index Scriptorium Estoniae

    Määrits, Mati, 1958-

    2004-01-01

    AS Nordic Foods rajas Põlva piima kunagisse spordi- ja laohoonesse valmistoidutehase, kus töötab 45 inimest. Järgmisel aastal loodab ettevõtte toota 2000 tonni valmistoite ja saavutada 60 milj. kr. käibe

  16. Different X-ray spectral evolution for black hole X-ray binaries in dual tracks of radio-X-ray correlation

    International Nuclear Information System (INIS)

    Cao, Xiao-Feng; Wu, Qingwen; Dong, Ai-Jun

    2014-01-01

    Recently, an 'outlier' track of radio-X-ray correlation was found, which is much steeper than the former universal correlation, where dual tracks were speculated to be triggered by different accretion processes. In this work, we test this issue by exploring hard X-ray spectral evolution in four black-hole X-ray binaries with multiple, quasi-simultaneous radio and X-ray observations. First, we find that hard X-ray photon indices, Γ, are negatively and positively correlated with X-ray fluxes when the X-ray flux, F 3-9 keV , is below and above a critical flux, F X, crit , which are consistent with predictions of the advection-dominated accretion flow and the disk-corona model, respectively. Second, and most importantly, we find that the radio-X-ray correlations are also clearly different when the X-ray fluxes are higher and lower than the critical flux as defined by X-ray spectral evolution. The data points with F 3-9 keV ≳ F X, crit have a steeper radio-X-ray correlation (F X ∝F R b and b ∼ 1.1-1.4), which roughly forms the ''outlier'' track. However, the data points with anti-correlation of Γ – F 3-9 keV either stay in the universal track with b ∼ 0.61 or stay in the transition track (from the universal to 'outlier' tracks or vice versa). Therefore, our results support that the universal and ''outlier'' tracks of radio-X-ray correlations are regulated by radiatively inefficient and radiatively efficient accretion model, respectively.

  17. X-Ray and Near-Infrared Spectroscopy of Dim X-Ray Point Sources Constituting the Galactic Ridge X-Ray Emission

    Directory of Open Access Journals (Sweden)

    Kumiko Morihana

    2014-12-01

    Full Text Available We present the results of X-ray and Near-Infrared observations of the Galactic Ridge X-ray Emission (GRXE. We extracted 2,002 X-ray point sources in the Chandra Bulge Field (l =0°.113, b = 1°.424 down to ~10-14.8 ergscm-2s-1 in 2-8 keV band with the longest observation (900 ks of the GRXE. Based on X-ray brightness and hardness, we classied the X-ray point sources into three groups: A (hard, B (soft and broad spectrum, and C (soft and peaked spectrum. In order to know populations of the X-ray point sources, we carried out NIR imaging and spectroscopy observation. We identied 11% of X-ray point sources with NIR and extracted NIR spectra for some of them. Based on X-ray and NIR properties, we concluded that non-thermal sources in the group A are mostly active galactic nuclei and the thermal sources are mostly white dwarf binaries such as cataclysmic variables (CVs and Pre-CVs. We concluded that the group B and C sources are X-ray active stars in flare and quiescence, respectively.

  18. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small ... X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive medical ...

  19. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small dose ... limitations of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is ...

  20. Bone X-Ray (Radiography)

    Science.gov (United States)

    ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small ... of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive ...

  1. Abdomen X-Ray (Radiography)

    Science.gov (United States)

    ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Abdomen Abdominal x-ray uses a very small ... of an abdominal x-ray? What is abdominal x-ray? An x-ray (radiograph) is a noninvasive medical ...

  2. Bright x-ray flares in gamma-ray burst afterglows.

    Science.gov (United States)

    Burrows, D N; Romano, P; Falcone, A; Kobayashi, S; Zhang, B; Moretti, A; O'brien, P T; Goad, M R; Campana, S; Page, K L; Angelini, L; Barthelmy, S; Beardmore, A P; Capalbi, M; Chincarini, G; Cummings, J; Cusumano, G; Fox, D; Giommi, P; Hill, J E; Kennea, J A; Krimm, H; Mangano, V; Marshall, F; Mészáros, P; Morris, D C; Nousek, J A; Osborne, J P; Pagani, C; Perri, M; Tagliaferri, G; Wells, A A; Woosley, S; Gehrels, N

    2005-09-16

    Gamma-ray burst (GRB) afterglows have provided important clues to the nature of these massive explosive events, providing direct information on the nearby environment and indirect information on the central engine that powers the burst. We report the discovery of two bright x-ray flares in GRB afterglows, including a giant flare comparable in total energy to the burst itself, each peaking minutes after the burst. These strong, rapid x-ray flares imply that the central engines of the bursts have long periods of activity, with strong internal shocks continuing for hundreds of seconds after the gamma-ray emission has ended.

  3. CRL X-ray tube

    International Nuclear Information System (INIS)

    Kolchevsky, N.N.; Petrov, P.V.

    2015-01-01

    A novel types of X-ray tubes with refractive lenses are proposed. CRL-R X-ray tube consists of Compound Refractive Lens- CRL and Reflection X-ray tube. CRL acts as X-ray window. CRL-T X-ray consists of CRL and Transmission X-ray tube. CRL acts as target for electron beam. CRL refractive lens acts as filter, collimator, waveguide and focusing lens. Properties and construction of the CRL X-ray tube are discussed. (authors)

  4. Human soft tissue analysis using x-ray or gamma-ray techniques

    International Nuclear Information System (INIS)

    Theodorakou, C; Farquharson, M J

    2008-01-01

    This topical review is intended to describe the x-ray techniques used for human soft tissue analysis. X-ray techniques have been applied to human soft tissue characterization and interesting results have been presented over the last few decades. The motivation behind such studies is to provide improved patient outcome by using the data obtained to better understand a disease process and improve diagnosis. An overview of theoretical background as well as a complete set of references is presented. For each study, a brief summary of the methodology and results is given. The x-ray techniques include x-ray diffraction, x-ray fluorescence, Compton scattering, Compton to coherent scattering ratio and attenuation measurements. The soft tissues that have been classified using x-rays or gamma rays include brain, breast, colon, fat, kidney, liver, lung, muscle, prostate, skin, thyroid and uterus. (topical review)

  5. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very ... of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive ...

  6. X-Ray Exam: Pelvis

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Pelvis KidsHealth / For Parents / X-Ray Exam: ... Ray Exam: Hip Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small ... of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive ...

  8. THE RADIATIVE X-RAY AND GAMMA-RAY EFFICIENCIES OF ROTATION-POWERED PULSARS

    International Nuclear Information System (INIS)

    Vink, Jacco; Bamba, Aya; Yamazaki, Ryo

    2011-01-01

    We present a statistical analysis of the X-ray luminosity of rotation-powered pulsars and their surrounding nebulae using the sample of Kargaltsev and Pavlov, and we complement this with an analysis of the γ-ray emission of Fermi-detected pulsars. We report a strong trend in the efficiency with which spin-down power is converted to X-ray and γ-ray emission with characteristic age: young pulsars and their surrounding nebulae are efficient X-ray emitters, whereas in contrast old pulsars are efficient γ-ray emitters. We divided the X-ray sample in a young (τ c 4 yr) and old sample and used linear regression to search for correlations between the logarithm of the X-ray and γ-ray luminosities and the logarithms of the periods and period derivatives. The X-ray emission from young pulsars and their nebulae are both consistent with L X ∝ P-dot 3 /P 6 . For old pulsars and their nebulae the X-ray luminosity is consistent with a more or less constant efficiency η≡L X / E-dot rot ∼8x10 -5 . For the γ-ray luminosity we confirm that L γ ∝ √E-dot rot . We discuss these findings in the context of pair production inside pulsar magnetospheres and the striped wind model. We suggest that the striped wind model may explain the similarity between the X-ray properties of the pulsar wind nebulae and the pulsars themselves, which according to the striped wind model may both find their origin outside the light cylinder, in the pulsar wind zone.

  9. Gamma-ray astronomy and cosmic-ray origin theory

    International Nuclear Information System (INIS)

    Ginzburg, V.L.

    1973-01-01

    A theory of the origin of cosmic radiation is discussed in light of the advances made in gamma-ray astronomy. Arguments against metagalactic models for the origin of cosmic rays are emphasized. (U.S.)

  10. Perfect-crystal x-ray optics to treat x-ray coherence

    International Nuclear Information System (INIS)

    Yamazaki, Hiroshi; Ishikawa, Tetsuya

    2007-01-01

    X-ray diffraction of perfect crystals, which serve as x-ray monochromator and collimator, modifies coherence properties of x-ray beams. From the time-dependent Takagi-Taupin equations that x-ray wavefields obey in crystals, the reflected wavefield is formulated as an integral transform of a general incident wavefield with temporal and spatial inhomogeneity. A reformulation of rocking-curve profiles from the field solution of the Takagi-Taupin equations allows experimental evaluation of the mutual coherence function of x-ray beam. The rigorous relationship of the coherence functions between before and after reflection clarifies how the coherence is transferred by a crystal. These results will be beneficial to developers of beamline optics for the next generation synchrotron sources. (author)

  11. X-ray scattering in X-ray fluorescence spectra with X-ray tube excitation - Modelling, experiment, and Monte-Carlo simulation

    International Nuclear Information System (INIS)

    Hodoroaba, V.-D.; Radtke, M.; Vincze, L.; Rackwitz, V.; Reuter, D.

    2010-01-01

    X-ray scattering may contribute significantly to the spectral background of X-ray fluorescence (XRF) spectra. Based on metrological measurements carried out with a scanning electron microscope (SEM) having attached a well characterised X-ray source (polychromatic X-ray tube) and a calibrated energy dispersive X-ray spectrometer (EDS) the accuracy of a physical model for X-ray scattering is systematically evaluated for representative samples. The knowledge of the X-ray spectrometer efficiency, but also of the spectrometer response functions makes it possible to define a physical spectral background of XRF spectra. Background subtraction relying on purely mathematical procedures is state-of-the-art. The results produced by the analytical model are at least as reliable as those obtained by Monte-Carlo simulations, even without considering the very challenging contribution of multiple scattering. Special attention has been paid to Compton broadening. Relevant applications of the implementation of the analytical model presented in this paper are the prediction of the limits of detection for particular cases or the determination of the transmission of X-ray polycapillary lenses.

  12. SHORT COMMUNICATION GOSSIPIUM HIRSUTUM L. EXTRACT ...

    African Journals Online (AJOL)

    Preferred Customer

    inhibit acid corrosion of aluminum in acid solutions, using chemical and electrochemical techniques. ... nitric acid at room temperature, scrubbed with a bristle brush under running water, dried and .... Desalination 2009, 249, 922. 9. Raja, P.B. ...

  13. Impact of higher-order dispersion in the modulational instability ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... journal of ... A theoretical analysis of modulational instability (MI) of optical pulses .... have a quantitative picture of the MI in the presence of exponential saturation .... Raja thanks DST, Government of India for financial support.

  14. Kuulsa veinipatriarhi lahkumine / Kertu Ruus

    Index Scriptorium Estoniae

    Ruus, Kertu, 1977-

    2007-01-01

    Ernest Gallo rajas koos oma venna Julioga maailma suuruselt teise veinitööstuse E. & J. Gallo Winery. Vt. samas: Skandaalide keerises: Gallo jäänud perefirmaks; Ernest Gallo: hea vein on see, mida tahad veel

  15. Gamma-ray astrophysics

    International Nuclear Information System (INIS)

    Fichtel, C.E.

    1977-01-01

    The most striking feature of the celestial sphere when viewed in the frequency range of γ-rays is the emission from the galactic plane, which is particularly intense in the galactic longitudinal region from 300 0 to 50 0 . The longitudinal and latitudinal distributions are generally correlated with galactic structural features and when studied in detail suggest a non-uniform distribution of cosmic rays in the galaxy. Several point γ-ray sources have now been observed, including four radio pulsars. This last result is particularly striking since only one radio pulsar has been seen at either optical or X-ray frequencies. Nuclear γ-ray lines have been seen from the Sun during a large solar flare and future satellite experiments are planned to search for γ-ray lines from supernovae and their remnants. A general apparently diffuse flux of γ-rays has also been seen whose energy spectrum has interesting implications; however, in view of the possible contribution of point sources and the observation of galactic features such as Gould's belt, its interpretation must await γ-ray experiments with finer spatial and energy resolution, as well as greater sensitivity. (Auth.)

  16. Providing x-rays

    International Nuclear Information System (INIS)

    Mallozzi, P.J.; Epstein, H.M.

    1985-01-01

    This invention provides an apparatus for providing x-rays to an object that may be in an ordinary environment such as air at approximately atmospheric pressure. The apparatus comprises: means (typically a laser beam) for directing energy onto a target to produce x-rays of a selected spectrum and intensity at the target; a fluid-tight enclosure around the target; means for maintaining the pressure in the first enclosure substantially below atmospheric pressure; a fluid-tight second enclosure adjoining the first enclosure, the common wall portion having an opening large enough to permit x-rays to pass through but small enough to allow the pressure reducing means to evacuate gas from the first enclosure at least as fast as it enters through the opening; the second enclosure filled with a gas that is highly transparent to x-rays; the wall of the second enclosure to which the x-rays travel having a portion that is highly transparent to x-rays (usually a beryllium or plastic foil), so that the object to which the x-rays are to be provided may be located outside the second enclosure and adjacent thereto and thus receive the x-rays substantially unimpeded by air or other intervening matter. The apparatus is particularly suited to obtaining EXAFS (extended x-ray fine structure spectroscopy) data on a material

  17. X-Ray Scattering Applications Using Pulsed X-Ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Larson, B.C.

    1999-05-23

    Pulsed x-ray sources have been used in transient structural phenomena investigations for over fifty years; however, until the advent of synchrotrons sources and the development of table-top picosecond lasers, general access to ligh temporal resolution x-ray diffraction was relatively limited. Advances in diffraction techniques, sample excitation schemes, and detector systems, in addition to IncEased access to pulsed sources, have ld tO what is now a diverse and growing array of pulsed-source measurement applications. A survey of time-resolved investigations using pulsed x-ray sources is presented and research opportunities using both present and planned pulsed x-ray sources are discussed.

  18. X-ray diagnostic installation for X-ray tomographic images

    International Nuclear Information System (INIS)

    Haendle, J.; Sklebitz, H.

    1984-01-01

    An exemplary embodiment includes at least one x-ray tube for the generation of an x-ray beam, a patient support, an image detector, and a control generator-connected with the x-ray tube and the image detector-for the purpose of moving the x-ray beam, and in opposition thereto, the image field of the image detector. There is connected to the control generator a layer height computer which calculates the enlargement from the geometric data for the tomogram. The image detector has a circuit-connected with the layer height computer-for the purpose of fading-in a marking for the dimensions in the layer plane

  19. Observations of the highest energy gamma-rays from gamma-ray bursts

    International Nuclear Information System (INIS)

    Dingus, Brenda L.

    2001-01-01

    EGRET has extended the highest energy observations of gamma-ray bursts to GeV gamma rays. Such high energies imply the fireball that is radiating the gamma-rays has a bulk Lorentz factor of several hundred. However, EGRET only detected a few gamma-ray bursts. GLAST will likely detect several hundred bursts and may extend the maximum energy to a few 100 GeV. Meanwhile new ground based detectors with sensitivity to gamma-ray bursts are beginning operation, and one recently reported evidence for TeV emission from a burst

  20. X-ray imaging with compound refractive lens and microfocus X-ray tube

    OpenAIRE

    Pina, Ladislav; Dudchik, Yury; Jelinek, Vaclav; Sveda, Libor; Marsik, Jiri; Horvath, Martin; Petr, Ondrej

    2008-01-01

    Compound refractive lenses (CRL), consisting of a lot number in-line concave microlenses made of low-Z material were studied. Lenses with focal length 109 mm and 41 mm for 8-keV X-rays, microfocus X-ray tube and X-ray CCD camera were used in experiments. Obtained images show intensity distribution of magnified microfocus X-ray source focal spot. Within the experiments, one lens was also used as an objective lens of the X-ray microscope, where the copper anode X-ray microfocus tube served as a...

  1. Ultra-high energy cosmic rays and prompt TeV gamma rays from ...

    Indian Academy of Sciences (India)

    physics pp. 789-792. Ultra-high energy cosmic rays and prompt. TeV gamma rays from gamma ray bursts ... The origin of the observed ultra-high energy cosmic ray (UHECR) events with ... are proton and electron rest mass, respectively.

  2. Combining genetic and demographic data for the conservation of a Mediterranean marine habitat-forming species.

    Directory of Open Access Journals (Sweden)

    Rosana Arizmendi-Mejía

    Full Text Available The integration of ecological and evolutionary data is highly valuable for conservation planning. However, it has been rarely used in the marine realm, where the adequate design of marine protected areas (MPAs is urgently needed. Here, we examined the interacting processes underlying the patterns of genetic structure and demographic strucuture of a highly vulnerable Mediterranean habitat-forming species (i.e. Paramuricea clavata (Risso, 1826, with particular emphasis on the processes of contemporary dispersal, genetic drift, and colonization of a new population. Isolation by distance and genetic discontinuities were found, and three genetic clusters were detected; each submitted to variations in the relative impact of drift and gene flow. No founder effect was found in the new population. The interplay of ecology and evolution revealed that drift is strongly impacting the smallest, most isolated populations, where partial mortality of individuals was highest. Moreover, the eco-evolutionary analyses entailed important conservation implications for P. clavata. Our study supports the inclusion of habitat-forming organisms in the design of MPAs and highlights the need to account for genetic drift in the development of MPAs. Moreover, it reinforces the importance of integrating genetic and demographic data in marine conservation.

  3. The Radiative X-ray and Gamma-ray Efficiencies of Rotation-powered Pulsars

    Science.gov (United States)

    Vink, Jacco; Bamba, Aya; Yamazaki, Ryo

    2011-02-01

    We present a statistical analysis of the X-ray luminosity of rotation-powered pulsars and their surrounding nebulae using the sample of Kargaltsev & Pavlov, and we complement this with an analysis of the γ-ray emission of Fermi-detected pulsars. We report a strong trend in the efficiency with which spin-down power is converted to X-ray and γ-ray emission with characteristic age: young pulsars and their surrounding nebulae are efficient X-ray emitters, whereas in contrast old pulsars are efficient γ-ray emitters. We divided the X-ray sample in a young (τ c < 1.7 × 104 yr) and old sample and used linear regression to search for correlations between the logarithm of the X-ray and γ-ray luminosities and the logarithms of the periods and period derivatives. The X-ray emission from young pulsars and their nebulae are both consistent with L_X ∝ \\dot{P}^3/P^6. For old pulsars and their nebulae the X-ray luminosity is consistent with a more or less constant efficiency η ≡ L_X/\\dot{E}_{rot} ≈ 8× 10^{-5}. For the γ-ray luminosity we confirm that L_γ ∝ √{\\dot{E}_{rot}}. We discuss these findings in the context of pair production inside pulsar magnetospheres and the striped wind model. We suggest that the striped wind model may explain the similarity between the X-ray properties of the pulsar wind nebulae and the pulsars themselves, which according to the striped wind model may both find their origin outside the light cylinder, in the pulsar wind zone.

  4. Abdominal x-ray

    Science.gov (United States)

    Abdominal film; X-ray - abdomen; Flat plate; KUB x-ray ... There is low radiation exposure. X-rays are monitored and regulated to provide the minimum amount of radiation exposure needed to produce the image. Most ...

  5. X-Ray Spectral Characteristics of Ginga Gamma-Ray Bursts

    International Nuclear Information System (INIS)

    Strohmayer, T.E.; Fenimore, E.E.; Murakami, T.; Yoshida, A.

    1998-01-01

    We have investigated the spectral characteristics of a sample of bright gamma-ray bursts detected with the gamma-ray burst sensors aboard the satellite Ginga. This instrument employed a proportional and scintillation counter to provide sensitivity to photons in the 2 endash 400 keV region and as such provided a unique opportunity to characterize the largely unexplored X-ray properties of gamma-ray bursts. The photon spectra of the Ginga bursts are well described by a low-energy slope, a bend energy, and a high-energy slope. In the energy range where they can be compared, this result is consistent with burst spectral analyses obtained from the BATSE experiment aboard the Compton Gamma-Ray Observatory. However, below 20 keV we find evidence for a positive spectral number index in approximately 40% of our burst sample, with some evidence for a strong rolloff at lower energies in a few events. There is a correlation (Pearson's r = -0.62) between the low-energy slope and the bend energy. We find that the distribution of spectral bend energies extends below 10 keV. There has been some concern in cosmological models of gamma-ray bursts (GRBs) that the bend energy covers only a small dynamic range. Our result extends the observed dynamic range, and, since we observe bend energies down to the limit of our instrument, perhaps observations have not yet limited the range. The Ginga trigger range was virtually the same as that of BATSE, yet we find a different range of fit parameters. One possible explanation might be that GRBs have two break energies, one often in the 50 endash 500 keV range and the other near 5 keV. Both BATSE and Ginga fit with only a single break energy, so BATSE tends to find breaks near the center of its energy range, and we tend to find breaks in our energy range. The observed ratio of energy emitted in the X-rays relative to the gamma rays can be much larger than a few percent and, in fact, is sometimes larger than unity. The average for our 22 bursts

  6. X-ray emission spectroscopy. X-ray fluorescence

    International Nuclear Information System (INIS)

    Despujols, J.

    1992-01-01

    Principles of X-ray emission spectrometry are first recalled, then wave-length dispersive and energy dispersive X-ray fluorescence spectrometer are described. They are essentially designed for qualitative and quantitative analysis of elements (Z>10). Sample preparation, calibration, corrections, interferences, accuracy are reviewed. Examples of use in different industries are given. (71 refs.)

  7. X-ray and. gamma. -ray sources: a comparison of their characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Freund, A K [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)

    1979-11-01

    A comparison of the various source characteristics, in particular the available fluxes of radiation in the X-ray/..gamma..-ray region from (1) high power rotary anode X-ray generators, (2) radioactive ..gamma..-ray sources and (3) high energy electron storage rings is presented. Some of the specific characteristics and possible applications of synchrotron radiation as a source are discussed in detail, together with problems associated with the monochromatization of the continuous radiation in the X-ray/..gamma..-ray region. The new high energy machines PEP at Stanford, the 8 GeV storage ring CESR at Cornell and the PETRA storage ring in Hamburg, which will soon come into operation provide a spectrum of high intensity radiation reaching well above h..gamma..sub(photon)=100 keV. The possibilities of using ondulators (wigglers), and laser-electron scattering for constructing high repetition rate tunable ..gamma..-ray sources are also discussed. Finally the potentials of using the powerful spontaneous emission of ..gamma..-quanta by relativistic channeled particles are mentioned.

  8. X-ray spectroscopy and X-ray crystallography of metalloenzymes at XFELs

    International Nuclear Information System (INIS)

    Yano, Junko

    2016-01-01

    The ultra-bright femtosecond X-ray pulses provided by X-ray Free Electron Lasers (XFELs) open capabilities for studying the structure and dynamics of a wide variety of biological and inorganic systems beyond what is possible at synchrotron sources. Although the structure and chemistry at the catalytic sites have been studied intensively in both biological and inorganic systems, a full understanding of the atomic-scale chemistry requires new approaches beyond the steady state X-ray crystallography and X-ray spectroscopy at cryogenic temperatures. Following the dynamic changes in the geometric and electronic structure at ambient conditions, while overcoming X-ray damage to the redox active catalytic center, is key for deriving reaction mechanisms. Such studies become possible by using the intense and ultra-short femtosecond X-ray pulses from an XFEL, where sample is probed before it is damaged. We have developed methodology for simultaneously collecting crystallography data and X-ray emission spectra, using an energy dispersive spectrometer at ambient conditions. In addition, we have developed a way to collect metal L-edge data of dilute samples using soft X-rays at XFELs. The advantages and challenges of these methods will be described in this review. (author)

  9. Study of X-rays and nuclear gamma -rays in muonic thallium

    CERN Document Server

    Backe, H; Jahnke, U; Kankeleit, E; Pearce, R M; Petitjean, C; Schellenberg, L; Schneuwly, H; Schröder, W U; Walter, H K; Zehnder, A

    1972-01-01

    Energies and intensities of muonic X-rays, nuclear gamma -rays and mu -capture gamma -rays were measured in natural muonic thallium with Ge (Li) detectors. The absolute intensities of higher mu X-rays were reproduced by a cascade calculation starting with a statistical population at n=20 including K-, L- and M-conversion. The electron screening effect was deduced from energies of higher mu X-rays. Eight prompt nuclear gamma -rays were found. This excitation explains the anomalous intensity ratios of the 2p-1s and 3d-2p fine structure components. From the nuclear gamma -rays of the first excited states were deduced: the magnetic h.f. splittings, muonic isomer shifts E2/M1 mixing ratios and the half-life in the presence of the muon in /sup 205/Tl. Evidence for a magnetic nuclear polarization was found. An isotope shift of Delta E=10.35+or-0.25 keV was measured for the 1s/sub 1/2/ state which is compared with data from optical spectroscopy. From an analysis of the time distribution of delayed gamma -rays from mu...

  10. Development of confocal micro X-ray fluorescence instrument using two X-ray beams

    International Nuclear Information System (INIS)

    Tsuji, Kouichi; Nakano, Kazuhiko; Ding Xunliang

    2007-01-01

    A new confocal micro X-ray fluorescence instrument was developed. This instrument has two independent micro X-ray tubes with Mo targets. A full polycapillary X-ray lens was attached to each X-ray tube. Another half polycapillary lens was attached to a silicon drift X-ray detector (SDD). The focal spots of the three lenses were adjusted to a common position. The effects of the excitation of two X-ray beams were investigated. The instrument enabled highly sensitive three-dimensional X-ray fluorescence analysis. We confirmed that the X-ray fluorescence intensity from the sample increased by applying the two independent X-ray tubes in confocal configuration. Elemental depth profiling of black wheat was demonstrated with the result that each element in the surface coat of a wheat grain showed unique distribution

  11. Chest X-Ray

    Medline Plus

    Full Text Available ... talk with you about chest radiography also known as chest x-rays. Chest x-rays are the ... treatment for a variety of lung conditions such as pneumonia, emphysema and cancer. A chest x-ray ...

  12. Gamma-ray Burst X-ray Flares Light Curve Fitting

    Science.gov (United States)

    Aubain, Jonisha

    2018-01-01

    Gamma Ray Bursts (GRBs) are the most luminous explosions in the Universe. These electromagnetic explosions produce jets demonstrated by a short burst of prompt gamma-ray emission followed by a broadband afterglow. There are sharp increases of flux in the X-ray light curves known as flares that occurs in about 50% of the afterglows. In this study, we characterized all of the X-ray afterglows that were detected by the Swift X-ray Telescope (XRT), whether with flares or without. We fit flares to the Norris function (Norris et al. 2005) and power laws with breaks where necessary (Racusin et al. 2009). After fitting the Norris function and power laws, we search for the residual pattern detected in prompt GRB pulses (Hakkila et al. 2014, 2015, 2017), that may indicate a common signature of shock physics. If we find the same signature in flares and prompt pulses, it provides insight into what causes them, as well as, how these flares are produced.

  13. X-ray examination apparatus

    NARCIS (Netherlands)

    2000-01-01

    The invention relates to an X-ray apparatus which includes an adjustable X-ray filter. In order to adjust an intensity profile of the X-ray beam, an X-ray absorbing liquid is transported to filter elements of the X-ray filter. Such transport is susceptible to gravitational forces which lead to an

  14. A Tale of cosmic rays narrated in γ rays by Fermi

    International Nuclear Information System (INIS)

    Tibaldo, Luigi

    2014-01-01

    Because cosmic rays are charged particles scrambled by magnetic fields, combining direct measurements with other observations is crucial to understanding their origin and propagation. As energetic particles traverse matter and electromagnetic fields, they leave marks in the form of neutral interaction products. Among those, γ rays trace interactions of nuclei that inelastically collide with interstellar gas, as well as of leptons that undergo Bremsstrahlung and inverse-Compton scattering. Data collected by the Fermi large area telescope (LAT) are therefore telling the story of cosmic rays along their journey from sources through their home galaxies. Supernova remnants emerge as a notable γ -ray source population, and older remnants interacting with interstellar matter finally show strong evidence of the presence of accelerated nuclei. Yet the maximum energy attained by shock accelerators is poorly constrained by observations. Cygnus X, a massive star-forming region established by the LAT as housing cosmic-ray sources, provides a test case to study the impact of wind-driven turbulence on the early propagation. Interstellar emission resulting from the large-scale propagation of cosmic rays in the Milky Way is revealed in unprecedented detail that challenges some of the simple assumptions used for the modeling. Moreover, the cosmic-ray induced γ -ray luminosities of galaxies-scale quasi-linearly with their massive-star formation rates: the overall normalization of that relation below the calorimetric limit suggests that for most systems, a substantial fraction of energy in cosmic rays escapes into the intergalactic medium. The nuclear production models and the distribution of target gas and radiation fields, not determined precisely enough yet, are key to exploiting the full potential of γ - ray data. Nevertheless, data being collected by Fermi and complementary multiwavelength/multi messenger observations are bringing ever closer to solving the cosmic-ray mystery

  15. A Tale of cosmic rays narrated in γ rays by Fermi

    Energy Technology Data Exchange (ETDEWEB)

    Tibaldo, Luigi, E-mail: ltibaldo@slac.stanford.edu [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park (United States)

    2014-07-01

    Because cosmic rays are charged particles scrambled by magnetic fields, combining direct measurements with other observations is crucial to understanding their origin and propagation. As energetic particles traverse matter and electromagnetic fields, they leave marks in the form of neutral interaction products. Among those, γ rays trace interactions of nuclei that inelastically collide with interstellar gas, as well as of leptons that undergo Bremsstrahlung and inverse-Compton scattering. Data collected by the Fermi large area telescope (LAT) are therefore telling the story of cosmic rays along their journey from sources through their home galaxies. Supernova remnants emerge as a notable γ -ray source population, and older remnants interacting with interstellar matter finally show strong evidence of the presence of accelerated nuclei. Yet the maximum energy attained by shock accelerators is poorly constrained by observations. Cygnus X, a massive star-forming region established by the LAT as housing cosmic-ray sources, provides a test case to study the impact of wind-driven turbulence on the early propagation. Interstellar emission resulting from the large-scale propagation of cosmic rays in the Milky Way is revealed in unprecedented detail that challenges some of the simple assumptions used for the modeling. Moreover, the cosmic-ray induced γ -ray luminosities of galaxies-scale quasi-linearly with their massive-star formation rates: the overall normalization of that relation below the calorimetric limit suggests that for most systems, a substantial fraction of energy in cosmic rays escapes into the intergalactic medium. The nuclear production models and the distribution of target gas and radiation fields, not determined precisely enough yet, are key to exploiting the full potential of γ - ray data. Nevertheless, data being collected by Fermi and complementary multiwavelength/multi messenger observations are bringing ever closer to solving the cosmic-ray mystery

  16. Ritual and reflexes of lost sovereignty in Sikka, a regency of Flores in eastern Indonesia

    Directory of Open Access Journals (Sweden)

    E.D. Lewis

    2008-12-01

    Full Text Available In 1993 some among the Sikkanese population of the town of Maumere on the north coast of Flores in eastern Indonesia attended a ritual to reconcile the members of two branches of the family of the rajas of Sikka, a dynasty that had once ruled the district. The two branches had fallen out over differences in opinion about the last succession to the office of raja a few years before the end of the rajadom in the late 1950s. A description of the ritual, which was conducted in an urban rather than a village setting, and an analysis of the performance demonstrate much about the persistence of elements of the old Sikkanese religion in modern Sikkanese society. The contemporary Sikkanese are Christians and the regency of Sikka is part of the modern Indonesian nation-state.

  17. Modern X-ray spectroscopy 3. X-ray fluorescence holography

    International Nuclear Information System (INIS)

    Hayashi, Kouichi

    2008-01-01

    X-ray fluorescence holography (XFH) provides three dimensional atomic images around specified elements. The XFH uses atoms as a wave source or monitor of interference field within a crystal sample, and therefore it can record both intensity and phase of scattered X-rays. Its current performance makes it possible to apply to ultra thin film, impurity and quasicrystal. In this article, I show the theory including solutions for twin image problem, advanced measuring system, data processing for reconstruction of the atomic images and for obtaining accurate atomic positions, applications using resonant X-ray scattering and X-ray excited optical luminescence, and an example of XFH result on the local structure around copper in silicon steal. (author)

  18. X-ray holography: X-ray interactions and their effects

    International Nuclear Information System (INIS)

    London, R.A.; Trebes, J.E.; Rosen, M.D.

    1988-01-01

    The authors summarize a theoretical study of the interactions of x-rays with a biological sample during the creation of a hologram. The choice of an optimal wavelength for x-ray holography is discussed, based on a description of scattering by objects within an aqueous environment. The problem of the motion resulting from the absorption of x-rays during a short exposure is described. The possibility of using very short exposures in order to capture the image before motion can compromise the resolution is explored. The impact of these calculation on the question of the feasibility of using an x-ray laser for holography of biological structures is discussed. 12 refs., 2 figs

  19. Development of x-ray laminography under an x-ray microscopic condition

    International Nuclear Information System (INIS)

    Hoshino, Masato; Uesugi, Kentaro; Takeuchi, Akihisa; Suzuki, Yoshio; Yagi, Naoto

    2011-01-01

    An x-ray laminography system under an x-ray microscopic condition was developed to obtain a three-dimensional structure of laterally-extended planar objects which were difficult to observe by x-ray tomography. An x-ray laminography technique was introduced to an x-ray transmission microscope with zone plate optics. Three prototype sample holders were evaluated for x-ray imaging laminography. Layered copper grid sheets were imaged as a laminated sample. Diatomite powder on a silicon nitride membrane was measured to confirm the applicability of this method to non-planar micro-specimens placed on the membrane. The three-dimensional information of diatom shells on the membrane was obtained at a spatial resolution of sub-micron. Images of biological cells on the membrane were also obtained by using a Zernike phase contrast technique.

  20. Chest X-Ray

    Medline Plus

    Full Text Available ... by Image/Video Gallery Your Radiologist Explains Chest X-ray Transcript Welcome to Radiology Info dot org! Hello, ... you about chest radiography also known as chest x-rays. Chest x-rays are the most commonly performed ...

  1. RAY-UI: A powerful and extensible user interface for RAY

    Energy Technology Data Exchange (ETDEWEB)

    Baumgärtel, P., E-mail: peter.baumgaertel@helmholtz-berlin.de; Erko, A.; Schäfers, F. [Institute for Nanometre Optics and Technology Helmholtz Zentrum Berlin für Materialien und Energie Albert-Einstein-Str. 15, 12489 Berlin (Germany); Witt, M. [Department Operation Accelerator BESSY II Helmholtz Zentrum Berlin für Materialien und Energie Albert-Einstein-Str. 15, 12489 Berlin (Germany); Baensch, J.; Fabarius, M.; Schirmacher, H. [Fachbereich VI – Informatik und Medien Beuth Hochschule für Technik Berlin, Luxemburger Str. 10, 13353 Berlin (Germany)

    2016-07-27

    The RAY-UI project started as a proof-of-concept for an interactive and graphical user interface (UI) for the well-known ray tracing software RAY [1]. In the meantime, it has evolved into a powerful enhanced version of RAY that will serve as the platform for future development and improvement of associated tools. The software as of today supports nearly all sophisticated simulation features of RAY. Furthermore, it delivers very significant usability and work efficiency improvements. Beamline elements can be quickly added or removed in the interactive sequence view. Parameters of any selected element can be accessed directly and in arbitrary order. With a single click, parameter changes can be tested and new simulation results can be obtained. All analysis results can be explored interactively right after ray tracing by means of powerful integrated image viewing and graphing tools. Unlimited image planes can be positioned anywhere in the beamline, and bundles of image planes can be created for moving the plane along the beam to identify the focus position with live updates of the simulated results. In addition to showing the features and workflow of RAY-UI, we will give an overview of the underlying software architecture as well as examples for use and an outlook for future developments.

  2. New challenges in ray tracing simulations of X-ray optics

    International Nuclear Information System (INIS)

    Río, M Sánchez del

    2013-01-01

    The construction of new synchrotron sources and the refurbishment and upgrade of existing ones has boosted in the last years the interest in X-ray optics simulations for beamline design and optimization. In the last years we conducted a full renewal of the well established SHADOW ray tracing code, ending with a modular version SHADOW3 interfaced to multiple programming languages (C, C++, IDL, Python). Some of the new features of SHADOW3 are presented. From the physics point of view, SHADOW3 has been upgraded for dealing with lens systems. X-ray partial coherence applications demand an extension of traditional ray tracing methods into a hybrid ray-tracing wave-optics approach. The software development is essential for fulfilling the requests of the ESRF Upgrade Programme, and some examples of calculations are also presented.

  3. X-ray instrumentation in astronomy

    International Nuclear Information System (INIS)

    Cuhlane, J.L.

    1985-01-01

    This book presents the proceedings of a conference devoted to x-ray instrumentation in astronomy. Special sections are: AXAF X-Ray Optical Systems; Specialized X-Ray Systems; X-Ray Optical Systems I; X-Ray Optical Systems II; Gas Filled X-Ray Detectors II; The NASA Advanced X-Ray Astrophysics Facility; X-Ray and EUV Spectrometers; Microchannel Plates; and Solid State Detectors

  4. X-ray detector array

    International Nuclear Information System (INIS)

    Houston, J.M.

    1980-01-01

    The object of the invention (an ionization chamber X-ray detector array for use with high speed computerised tomographic imaging apparatus) is to reduce the time required to produce a tomographic image. The detector array described determines the distribution of X-ray intensities in one or more flat, coplanar X-ray beams. It comprises three flat anode sheets parallel to the X-ray beam, a plurality of rod-like cathodes between the anodes, a detector gas between the electrodes and a means for applying a potential between the electrodes. Each of the X-ray sources is collimated to give a narrow, planar section of X-ray photons. Sets of X-ray sources in the array are pulsed simultaneously to obtain X-ray transmission data for tomographic image reconstruction. (U.K.)

  5. Eesti vanausuliste ikoonimaali iseärasustest = Особенности староверческой иконописи Эстонии / Mari-Liis Paaver

    Index Scriptorium Estoniae

    Paaver, Mari-Liis

    2011-01-01

    Gavriil Frolovi elust ja loomingust ning tema Raja külas Peipsi ääres rajatud ikoonimaalitöökojast ning seal tegutsenud õpilastest-ikoonimaalijatest, ka selle koolkonna ikoonide filigraansest teostusest, ikonograafilistest ja maalitehnilistest iseärasustest ning erinevustest

  6. Design and development of long-period grating sensors for ...

    Indian Academy of Sciences (India)

    Raja Ramanna Centre for Advanced Technology, Indore 450 213. ∗ e-mail: ... Home built CO2 laser (Max power 20 Watt) is focused onto .... Claus R O 1997 Temperature-insensitive and strain insensitive long-period grating sensors for smart.

  7. Microfocussing of synchrotron X-rays using X-ray refractive lens

    Indian Academy of Sciences (India)

    X-ray lenses are fabricated in polymethyl methacrylate using deep X-ray lithography beamline of Indus-2. The focussing performance of these lenses is evaluated using Indus-2 and Diamond Light Source Ltd. The process steps for the fabrication of X-ray lenses and microfocussing at 10 keV at moderate and low emittance ...

  8. Laser plasma x-ray source for ultrafast time-resolved x-ray absorption spectroscopy

    Directory of Open Access Journals (Sweden)

    L. Miaja-Avila

    2015-03-01

    Full Text Available We describe a laser-driven x-ray plasma source designed for ultrafast x-ray absorption spectroscopy. The source is comprised of a 1 kHz, 20 W, femtosecond pulsed infrared laser and a water target. We present the x-ray spectra as a function of laser energy and pulse duration. Additionally, we investigate the plasma temperature and photon flux as we vary the laser energy. We obtain a 75 μm FWHM x-ray spot size, containing ∼106 photons/s, by focusing the produced x-rays with a polycapillary optic. Since the acquisition of x-ray absorption spectra requires the averaging of measurements from >107 laser pulses, we also present data on the source stability, including single pulse measurements of the x-ray yield and the x-ray spectral shape. In single pulse measurements, the x-ray flux has a measured standard deviation of 8%, where the laser pointing is the main cause of variability. Further, we show that the variability in x-ray spectral shape from single pulses is low, thus justifying the combining of x-rays obtained from different laser pulses into a single spectrum. Finally, we show a static x-ray absorption spectrum of a ferrioxalate solution as detected by a microcalorimeter array. Altogether, our results demonstrate that this water-jet based plasma source is a suitable candidate for laboratory-based time-resolved x-ray absorption spectroscopy experiments.

  9. An algorithm to resolve γ-rays from charged cosmic rays with DAMPE

    Science.gov (United States)

    Xu, Zun-Lei; Duan, Kai-Kai; Shen, Zhao-Qiang; Lei, Shi-Jun; Dong, Tie-Kuang; Gargano, Fabio; Garrappa, Simone; Guo, Dong-Ya; Jiang, Wei; Li, Xiang; Liang, Yun-Feng; Mazziotta, Mario Nicola; Munoz Salinas, Maria Fernanda; Su, Meng; Vagelli, Valerio; Yuan, Qiang; Yue, Chuan; Zang, Jing-Jing; Zhang, Ya-Peng; Zhang, Yun-Long; Zimmer, Stephan

    2018-03-01

    The DArk Matter Particle Explorer (DAMPE), also known as Wukong in China, which was launched on 2015 December 17, is a new high energy cosmic ray and γ-ray satellite-borne observatory. One of the main scientific goals of DAMPE is to observe GeV-TeV high energy γ-rays with accurate energy, angular and time resolution, to indirectly search for dark matter particles and for the study of high energy astrophysics. Due to the comparatively higher fluxes of charged cosmic rays with respect to γ-rays, it is challenging to identify γ-rays with sufficiently high efficiency, minimizing the amount of charged cosmic ray contamination. In this work we present a method to identify γ-rays in DAMPE data based on Monte Carlo simulations, using the powerful electromagnetic/hadronic shower discrimination provided by the calorimeter and the veto detection of charged particles provided by the plastic scintillation detector. Monte Carlo simulations show that after this selection the number of electrons and protons that contaminate the selected γ-ray events at ∼ 10GeV amounts to less than 1% of the selected sample. Finally, we use flight data to verify the effectiveness of the method by highlighting known γ-ray sources in the sky and by reconstructing preliminary light curves of the Geminga pulsar.

  10. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... ray examination. X-rays usually have no side effects in the typical diagnostic range for this exam. ... x-rays. A Word About Minimizing Radiation Exposure Special care is taken during x-ray examinations to ...

  11. Panoramic Dental X-Ray

    Science.gov (United States)

    ... Physician Resources Professions Site Index A-Z Panoramic Dental X-ray Panoramic dental x-ray uses a very small dose of ... x-ray , is a two-dimensional (2-D) dental x-ray examination that captures the entire mouth ...

  12. Anisotropic ray trace

    Science.gov (United States)

    Lam, Wai Sze Tiffany

    Optical components made of anisotropic materials, such as crystal polarizers and crystal waveplates, are widely used in many complex optical system, such as display systems, microlithography, biomedical imaging and many other optical systems, and induce more complex aberrations than optical components made of isotropic materials. The goal of this dissertation is to accurately simulate the performance of optical systems with anisotropic materials using polarization ray trace. This work extends the polarization ray tracing calculus to incorporate ray tracing through anisotropic materials, including uniaxial, biaxial and optically active materials. The 3D polarization ray tracing calculus is an invaluable tool for analyzing polarization properties of an optical system. The 3x3 polarization ray tracing P matrix developed for anisotropic ray trace assists tracking the 3D polarization transformations along a ray path with series of surfaces in an optical system. To better represent the anisotropic light-matter interactions, the definition of the P matrix is generalized to incorporate not only the polarization change at a refraction/reflection interface, but also the induced optical phase accumulation as light propagates through the anisotropic medium. This enables realistic modeling of crystalline polarization elements, such as crystal waveplates and crystal polarizers. The wavefront and polarization aberrations of these anisotropic components are more complex than those of isotropic optical components and can be evaluated from the resultant P matrix for each eigen-wavefront as well as for the overall image. One incident ray refracting or reflecting into an anisotropic medium produces two eigenpolarizations or eigenmodes propagating in different directions. The associated ray parameters of these modes necessary for the anisotropic ray trace are described in Chapter 2. The algorithms to calculate the P matrix from these ray parameters are described in Chapter 3 for

  13. Miniature x-ray point source for alignment and calibration of x-ray optics

    International Nuclear Information System (INIS)

    Price, R.H.; Boyle, M.J.; Glaros, S.S.

    1977-01-01

    A miniature x-ray point source of high brightness similar to that of Rovinsky, et al. is described. One version of the x-ray source is used to align the x-ray optics on the Argus and Shiva laser systems. A second version is used to determine the spatial and spectral transmission functions of the x-ray optics. The spatial and spectral characteristics of the x-ray emission from the x-ray point source are described. The physical constraints including size, intensity and thermal limitations, and useful lifetime are discussed. The alignment and calibration techniques for various x-ray optics and detector combinations are described

  14. Modern X-ray difraction. X-ray diffractometry for material scientists, physicists, and chemicists

    International Nuclear Information System (INIS)

    Spiess, L.; Schwarzer, R.; Behnken, H.; Teichert, G.

    2005-01-01

    The book yields a comprehensive survey over the applications of X-ray diffraction in fields like material techniques, metallurgy, electrotechniques, machine engineering, as well as micro- and nanotechniques. The necessary fundamental knowledge on X-ray diffraction are mediated foundedly and illustratively. Thereby new techniques and evaluation procedures are presented as well as well known methods. The content: Production and properties of X radiation, diffraction of X radiation, hardware for X-ray diffraction, methods of X-ray diffraction, lattice-constant determination, phase analysis, X-ray profile analysis, crystal structure analysis, X-ray radiographic stress analysis, X-ray radiographic texture analysis, crystal orientation determination, pecularities at thin films, small angle scattering

  15. X-Ray Exam: Forearm

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Forearm KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  16. X-Ray Exam: Foot

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Foot KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  17. X-Ray Exam: Wrist

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Wrist KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  18. Thoracic spine x-ray

    Science.gov (United States)

    Vertebral radiography; X-ray - spine; Thoracic x-ray; Spine x-ray; Thoracic spine films; Back films ... There is low radiation exposure. X-rays are monitored and regulated to provide the minimum amount of radiation exposure needed to produce the image. Most ...

  19. X-Ray Exam: Finger

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Finger KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  20. Chest X-Ray

    Medline Plus

    Full Text Available ... I’d like to talk with you about chest radiography also known as chest x-rays. Chest x-rays are the most ... far outweighs any risk. For more information about chest x-rays, visit Radiology Info dot org. Thank you for your time! ...

  1. Rapid communication: K 0

    Indian Academy of Sciences (India)

    Author Affiliations. A SINGH1 A KUMAR1 R RAJA2 V BHATNAGAR1 V SINGH3. Department of Physics, Panjab University, Chandigarh 160 014, India; Fermi National Accelerator Laboratory, Batavia 50610, USA; Banarus Hindu University, Varanasi 221 005, India ...

  2. Vtoroje dõhanije / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2001-01-01

    Ehtekunstnik Jaan Pärna projektist Meistrite hoov. Dolomiidi kasutamist kunstis kajastavast näitusest "Pae aeg" Meistrite hoovi galeriis. Kujundas Urve Küttner. Jaan Pärna, Urve Küttneri, Andrei Balashovi ja Helmet Raja töödest näitusel

  3. Medalisadu Ateenas saatis Eesti sõudjad kauaoodatud puhkusele / Ann Hiiemaa

    Index Scriptorium Estoniae

    Hiiemaa, Ann

    2008-01-01

    Vt. ka Postimees : na russkom jazõke, 22. sept., lk. 13. Allar Raja, Andrei Jämsa, Tõnu Endrekson ja Jüri Jaanson võitsid Euroopa meistrivõistlustel paarisaerulisel neljapaadil kulla ning Kaspar Taimsoo ja Vladimir Latin paarisaerulisel kahepaadil hõbemedali

  4. 120 aastat Gonzago Mierzeyewski sünnist / Joosep Reinaru

    Index Scriptorium Estoniae

    Reinaru, Joosep, 1921-2008

    2004-01-01

    Peterburi günekoloog-akushöörist Wladislav Mierzeyewskist (1841-1919), kes rajas Kuressaarde 1876. aastal valminud mudaravila ja tema pojast Gonzago Mierzeyewskist, kes töötas Kuressaare haiglas kirurg-günekoloogina ja akushöörina

  5. Soft x-ray lasers

    International Nuclear Information System (INIS)

    Matthews, D.L.; Rosen, M.D.

    1988-01-01

    One of the elusive dreams of laser physicists has been the development of an x-ray laser. After 25 years of waiting, the x-ray laser has at last entered the scientific scene, although those now in operation are still laboratory prototypes. They produce soft x rays down to about five nanometers. X-ray lasers retain the usual characteristics of their optical counterparts: a very tight beam, spatial and temporal coherence, and extreme brightness. Present x-ray lasers are nearly 100 times brighter that the next most powerful x-ray source in the world: the electron synchrotron. Although Lawrence Livermore National Laboratory (LLNL) is widely known for its hard-x-ray laser program which has potential applications in the Strategic Defense Initiative, the soft x-ray lasers have no direct military applications. These lasers, and the scientific tools that result from their development, may one day have a place in the design and diagnosis of both laser fusion and hard x-ray lasers. The soft x-ray lasers now in operation at the LLNL have shown great promise but are still in the primitive state. Once x-ray lasers become reliable, efficient, and economical, they will have several important applications. Chief among them might be the creation of holograms of microscopic biological structures too small to be investigated with visible light. 5 figs

  6. Simulation of transmitted X-rays in a polycapillary X-ray lens

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Shiqi [The Key Laboratory of Beam Technology and Material Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Liu, Zhiguo, E-mail: liuzhiguo512@126.com [The Key Laboratory of Beam Technology and Material Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Sun, Tianxi; Wang, Kai; Yi, Longtao; Yang, Kui; Chen, Man; Wang, Jinbang [The Key Laboratory of Beam Technology and Material Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China)

    2015-09-21

    The geometrical description of capillary systems adjusted for the controlled guiding of X-rays and the basic theory of the transmission of X-rays are presented. A method of numerical calculation, based on Ray-Tracing theory, is developed to simulate the transmission efficiency of an X-ray parallel lens and the shape and size of the light spot gain from it. The simulation results for two half-lenses are in good agreement with the experimental results.

  7. Frequency filter of seed x-ray by use of x-ray laser medium. Toward the generation of the temporally coherent x-ray laser

    International Nuclear Information System (INIS)

    Hasegawa, Noboru; Kawachi, Tetsuya; Kishimoto, Maki; Sukegawa, Kouta; Tanaka, Momoko; Ochi, Yoshihiro; Nishikino, Masaharu; Nagashima, Keisuke; Kato, Yoshiaki; Renzhong, Tai

    2009-01-01

    We evaluate the characteristics of a higher-order harmonics light as a seed X-ray amplified through a laser-produced X-ray amplifier. The narrow spectral bandwidth of the X-ray amplifier works as the frequency filter of the seed X-ray, resulting in that only the temporally coherent X-ray is amplified. Experimental investigation using the 29th-order harmonic light of the Ti:sapphire laser at a wavelength of 26.9 nm together with a neon-like manganese X-ray laser medium shows evident spectral narrowing of the seed X-ray and amplification without serious diffraction effects on the propagation of the amplified X-ray beam. This implies that the present combination is potential to realize temporally coherent X-ray lasers, with an expected duration of approximately 400 fs. (author)

  8. Gamma-Ray Emission from Galaxy Clusters : DARK MATTER AND COSMIC-RAYS

    Science.gov (United States)

    Pinzke, Anders

    The quest for the first detection of a galaxy cluster in the high energy gamma-ray regime is ongoing, and even though clusters are observed in several other wave-bands, there is still no firm detection in gamma-rays. To complement the observational efforts we estimate the gamma-ray contributions from both annihilating dark matter and cosmic-ray (CR) proton as well as CR electron induced emission. Using high-resolution simulations of galaxy clusters, we find a universal concave shaped CR proton spectrum independent of the simulated galaxy cluster. Specifically, the gamma-ray spectra from decaying neutral pions, which are produced by CR protons, dominate the cluster emission. Furthermore, based on our derived flux and luminosity functions, we identify the galaxy clusters with the brightest galaxy clusters in gamma-rays. While this emission is challenging to detect using the Fermi satellite, major observations with Cherenkov telescopes in the near future may put important constraints on the CR physics in clusters. To extend these predictions, we use a dark matter model that fits the recent electron and positron data from Fermi, PAMELA, and H.E.S.S. with remarkable precision, and make predictions about the expected gamma-ray flux from nearby clusters. In order to remain consistent with the EGRET upper limit on the gamma-ray emission from Virgo, we constrain the minimum mass of substructures for cold dark matter halos. In addition, we find comparable levels of gamma-ray emission from CR interactions and dark matter annihilations without Sommerfeld enhancement.

  9. What's in a ray set: moving towards a unified ray set format

    Science.gov (United States)

    Muschaweck, Julius

    2011-10-01

    For the purpose of optical simulation, a plethora of formats exist to describe the properties of a light source. Except for the EULUMDAT and IES formats which describe sources in terms of aperture area and far field intensity, all these formats are vendor specific, and no generally accepted standard exists. Most illumination simulation software vendors use their own format for ray sets, which describe sources in terms of many rays. Some of them keep their format definition proprietary. Thus, software packages typically can read or write only their own specific format, although the actual data content is not so different. Typically, they describe origin and direction of each ray in 3D vectors, and use one more single number for magnitude, where magnitude may denote radiant flux, luminous flux (equivalently tristimulus Y), or tristimulus X and Z. Sometimes each ray also carries its wavelength, while other formats allow to specify an overall spectrum for the whole source. In addition, in at least one format, polarization properties are also included for each ray. This situation makes it inefficient and potentially error prone for light source manufacturers to provide ray data sets for their sources in many different formats. Furthermore, near field goniometer vendors again use their proprietary formats to store the source description in terms of luminance data, and offer their proprietary software to generate ray sets from this data base. Again, the plethora of ray sets make the ray set production inefficient and potentially error prone. In this paper, we propose to describe ray data sets in terms of phase space, as a step towards a standardized ray set format. It is well known that luminance and radiance can be defined as flux density in phase space: luminance is flux divided by etendue. Therefore, single rays can be thought of as center points of phase space cells, where each cell possesses its volume (i.e. etendue), its flux, and therefore its luminance. In

  10. Wide field x-ray telescopes: Detecting x-ray transients/afterglows related to GRBs

    International Nuclear Information System (INIS)

    Hudec, Rene; Pina, Ladislav; Inneman, Adolf; Gorenstein, Paul

    1998-01-01

    The recent discovery of X-ray afterglows of GRBs opens the possibility of analyses of GRBs by their X-ray detections. However, imaging X-ray telescopes in current use mostly have limited fields of view. Alternative X-ray optics geometries achieving very large fields of view have been theoretically suggested in the 70's but not constructed and used so far. We review the geometries and basic properties of the wide-field X-ray optical systems based on one- and two-dimensional lobster-eye geometry and suggest technologies for their development and construction. First results of the development of double replicated X-ray reflecting flats for use in one-dimensional X-ray optics of lobster-eye type are presented and discussed. The optimum strategy for locating GRBs upon their X-ray counterparts is also presented and discussed

  11. X-ray and gamma ray waveguide, cavity and method

    International Nuclear Information System (INIS)

    Vali, V.; Krogstad, R.S.; Willard, H.R.

    1978-01-01

    An x-ray and gamma ray waveguide, cavity, and method for directing electromagnetic radiation of the x-ray, gamma ray, and extreme ultraviolet wavelengths are described. A hollow fiber is used as the waveguide and is manufactured from a material having an index of refraction less than unity for these wavelengths. The internal diameter of the hollow fiber waveguide and the radius of curvature for the waveguide are selectively predetermined in light of the wavelength of the transmitted radiation to minimize losses. The electromagnetic radiation is obtained from any suitable source ad upon introduction into the waveguide is transmitted along a curvilinear path. The waveguide may be formed as a closed loop to create a cavity or may be used to direct the electromagnetic radiation to a utilization site

  12. X-ray scattering measurements from thin-foil x-ray mirrors

    DEFF Research Database (Denmark)

    Christensen, Finn Erland; BYRNAK, BP; Hornstrup, Allan

    1992-01-01

    Thin foil X-ray mirrors are to be used as the reflecting elements in the telescopes of the X-ray satellites Spectrum-X-Gamma (SRG) and ASTRO-D. High resolution X-ray scattering measurements from the Au coated and dip-lacquered Al foils are presented. These were obtained from SRG mirrors positioned...... in a test quadrant of the telescope structure and from ASTRO-D foils held in a simple fixture. The X-ray data is compared with laser data and other surface structure data such as STM, atomic force microscopy (AFM), TEM, and electron micrography. The data obtained at Cu K-alpha(1), (8.05 keV) from all...

  13. X-ray diagnostics for TFTR

    International Nuclear Information System (INIS)

    von Goeler, S.; Hill, K.W.; Bitter, M.

    1982-12-01

    A short description of the x-ray diagnostic preparation for the TFTR tokamak is given. The x-ray equipment consists of the limiter x-ray monitoring system, the soft x-ray pulse-height-analysis-system, the soft x-ray imaging system and the x-ray crystal spectrometer. Particular attention is given to the radiation protection of the x-ray systems from the neutron environment

  14. Fast and robust ray casting algorithms for virtual X-ray imaging

    International Nuclear Information System (INIS)

    Freud, N.; Duvauchelle, P.; Letang, J.M.; Babot, D.

    2006-01-01

    Deterministic calculations based on ray casting techniques are known as a powerful alternative to the Monte Carlo approach to simulate X- or γ-ray imaging modalities (e.g. digital radiography and computed tomography), whenever computation time is a critical issue. One of the key components, from the viewpoint of computing resource expense, is the algorithm which determines the path length travelled by each ray through complex 3D objects. This issue has given rise to intensive research in the field of 3D rendering (in the visible light domain) during the last decades. The present work proposes algorithmic solutions adapted from state-of-the-art computer graphics to carry out ray casting in X-ray imaging configurations. This work provides an algorithmic basis to simulate direct transmission of X-rays, as well as scattering and secondary emission of radiation. Emphasis is laid on the speed and robustness issues. Computation times are given in a typical case of radiography simulation

  15. Fast and robust ray casting algorithms for virtual X-ray imaging

    Energy Technology Data Exchange (ETDEWEB)

    Freud, N. [CNDRI, Laboratory of Nondestructive Testing Using Ionizing Radiations, INSA-Lyon Scientific and Technical University, Bat. Antoine de Saint-Exupery, 20, Avenue Albert Einstein, 69621 Villeurbanne Cedex (France)]. E-mail: Nicolas.Freud@insa-lyon.fr; Duvauchelle, P. [CNDRI, Laboratory of Nondestructive Testing Using Ionizing Radiations, INSA-Lyon Scientific and Technical University, Bat. Antoine de Saint-Exupery, 20, Avenue Albert Einstein, 69621 Villeurbanne Cedex (France); Letang, J.M. [CNDRI, Laboratory of Nondestructive Testing Using Ionizing Radiations, INSA-Lyon Scientific and Technical University, Bat. Antoine de Saint-Exupery, 20, Avenue Albert Einstein, 69621 Villeurbanne Cedex (France); Babot, D. [CNDRI, Laboratory of Nondestructive Testing Using Ionizing Radiations, INSA-Lyon Scientific and Technical University, Bat. Antoine de Saint-Exupery, 20, Avenue Albert Einstein, 69621 Villeurbanne Cedex (France)

    2006-07-15

    Deterministic calculations based on ray casting techniques are known as a powerful alternative to the Monte Carlo approach to simulate X- or {gamma}-ray imaging modalities (e.g. digital radiography and computed tomography), whenever computation time is a critical issue. One of the key components, from the viewpoint of computing resource expense, is the algorithm which determines the path length travelled by each ray through complex 3D objects. This issue has given rise to intensive research in the field of 3D rendering (in the visible light domain) during the last decades. The present work proposes algorithmic solutions adapted from state-of-the-art computer graphics to carry out ray casting in X-ray imaging configurations. This work provides an algorithmic basis to simulate direct transmission of X-rays, as well as scattering and secondary emission of radiation. Emphasis is laid on the speed and robustness issues. Computation times are given in a typical case of radiography simulation.

  16. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.

    1980-01-01

    Intra-oral dental X-ray apparatus for panoramic radiography is described in detail. It comprises a tubular target carrier supporting at its distal end a target with an inclined forward face. Image definition is improved by positioning in the path of the X-rays a window of X-ray transmitting ceramic material, e.g. 90% oxide of Be, or Al, 7% Si0 2 . The target carrier forms a probe which can be positioned in the patient's mouth. X-rays are directed forwardly and laterally of the target to an X-ray film positioned externally. The probe is provided with a detachable sleeve having V-form arms of X-ray opaque material which serve to depress the tongue out of the radiation path and also shield the roof of the mouth and other regions of the head from the X-ray pattern. A cylindrical lead shield defines the X-ray beam angle. (author)

  17. Semiconductor X-ray detectors

    CERN Document Server

    Lowe, Barrie Glyn

    2014-01-01

    Identifying and measuring the elemental x-rays released when materials are examined with particles (electrons, protons, alpha particles, etc.) or photons (x-rays and gamma rays) is still considered to be the primary analytical technique for routine and non-destructive materials analysis. The Lithium Drifted Silicon (Si(Li)) X-Ray Detector, with its good resolution and peak to background, pioneered this type of analysis on electron microscopes, x-ray fluorescence instruments, and radioactive source- and accelerator-based excitation systems. Although rapid progress in Silicon Drift Detectors (SDDs), Charge Coupled Devices (CCDs), and Compound Semiconductor Detectors, including renewed interest in alternative materials such as CdZnTe and diamond, has made the Si(Li) X-Ray Detector nearly obsolete, the device serves as a useful benchmark and still is used in special instances where its large, sensitive depth is essential. Semiconductor X-Ray Detectors focuses on the history and development of Si(Li) X-Ray Detect...

  18. An X-ray perspective on a gamma-ray mission

    DEFF Research Database (Denmark)

    Lund, Niels

    2003-01-01

    The most recent astrophysics mission of ESA is INTEGRAL, a mission dedicated to gamma-ray astronomy (Winkler et al. 2003). INTEGRAL carries two gamma-ray instruments: the imager, IBIS, and the spectrometer, SPI, and in addition an optical monitor, OMC, and an X-ray monitor, JEM-X. INTEGRAL is an ...... is an observatory mission with 70% of the observation time available to the general astronomical community through a peer-reviewed selection process. This paper describes the INTEGRAL mission primarily as seen from the JEM-X perspective....

  19. Are gamma-ray bursts the sources of ultra-high energy cosmic rays?

    International Nuclear Information System (INIS)

    Baerwald, Philipp

    2014-07-01

    We reconsider the possibility that gamma-ray bursts (GRBs) are the sources of the ultra-high energy cosmic rays (UHECRs) within the internal shock model, assuming a pure proton composition of the UHECRs. For the first time, we combine the information from gamma-rays, cosmic rays, prompt neutrinos, and cosmogenic neutrinos quantitatively in a joint cosmic ray production and propagation model, and we show that the information on the cosmic energy budget can be obtained as a consequence. In addition to the neutron model, we consider alternative scenarios for the cosmic ray escape from the GRBs, i.e., that cosmic rays can leak from the sources. We find that the dip model, which describes the ankle in UHECR observations by the pair production dip, is strongly disfavored in combination with the internal shock model because (a) unrealistically high baryonic loadings (energy in protons versus energy in electrons/gamma-rays) are needed for the individual GRBs and (b) the prompt neutrino flux easily overshoots the corresponding neutrino bound. On the other hand, GRBs may account for the UHECRs in the ankle transition model if cosmic rays leak out from the source at the highest energies. In that case, we demonstrate that future neutrino observations can efficiently test most of the parameter space - unless the baryonic loading is much larger than previously anticipated.

  20. X-ray beam generator

    International Nuclear Information System (INIS)

    Koller, T.J.; Randmer, J.A.

    1977-01-01

    A method of minimizing the preferential angular absorption of the divergent beam from an X-ray generator is described. The generator consists of an X-ray shielded housing with an X-ray transmissive window symmetrically placed in radial alignment with a focal spot area on a sloped target surface of an X-ray tube in the housing. The X-ray tube may be of the stationary anode type or of the rotating anode type. (U.K.)

  1. SHOULD ONE USE THE RAY-BY-RAY APPROXIMATION IN CORE-COLLAPSE SUPERNOVA SIMULATIONS?

    International Nuclear Information System (INIS)

    Skinner, M. Aaron; Burrows, Adam; Dolence, Joshua C.

    2016-01-01

    We perform the first self-consistent, time-dependent, multi-group calculations in two dimensions (2D) to address the consequences of using the ray-by-ray+ transport simplification in core-collapse supernova simulations. Such a dimensional reduction is employed by many researchers to facilitate their resource-intensive calculations. Our new code (Fornax) implements multi-D transport, and can, by zeroing out transverse flux terms, emulate the ray-by-ray+ scheme. Using the same microphysics, initial models, resolution, and code, we compare the results of simulating 12, 15, 20, and 25 M ⊙ progenitor models using these two transport methods. Our findings call into question the wisdom of the pervasive use of the ray-by-ray+ approach. Employing it leads to maximum post-bounce/pre-explosion shock radii that are almost universally larger by tens of kilometers than those derived using the more accurate scheme, typically leaving the post-bounce matter less bound and artificially more “explodable.” In fact, for our 25 M ⊙ progenitor, the ray-by-ray+ model explodes, while the corresponding multi-D transport model does not. Therefore, in two dimensions, the combination of ray-by-ray+ with the axial sloshing hydrodynamics that is a feature of 2D supernova dynamics can result in quantitatively, and perhaps qualitatively, incorrect results.

  2. THERMAL X-RAY EMISSION FROM THE SHOCKED STELLAR WIND OF PULSAR GAMMA-RAY BINARIES

    Energy Technology Data Exchange (ETDEWEB)

    Zabalza, V.; Paredes, J. M. [Departament d' Astronomia i Meteorologia, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E08028 Barcelona (Spain); Bosch-Ramon, V., E-mail: vzabalza@am.ub.es [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland)

    2011-12-10

    Gamma-ray-loud X-ray binaries are binary systems that show non-thermal broadband emission from radio to gamma rays. If the system comprises a massive star and a young non-accreting pulsar, their winds will collide producing broadband non-thermal emission, most likely originated in the shocked pulsar wind. Thermal X-ray emission is expected from the shocked stellar wind, but until now it has neither been detected nor studied in the context of gamma-ray binaries. We present a semi-analytic model of the thermal X-ray emission from the shocked stellar wind in pulsar gamma-ray binaries, and find that the thermal X-ray emission increases monotonically with the pulsar spin-down luminosity, reaching luminosities of the order of 10{sup 33} erg s{sup -1}. The lack of thermal features in the X-ray spectrum of gamma-ray binaries can then be used to constrain the properties of the pulsar and stellar winds. By fitting the observed X-ray spectra of gamma-ray binaries with a source model composed of an absorbed non-thermal power law and the computed thermal X-ray emission, we are able to derive upper limits on the spin-down luminosity of the putative pulsar. We applied this method to LS 5039, the only gamma-ray binary with a radial, powerful wind, and obtain an upper limit on the pulsar spin-down luminosity of {approx}6 Multiplication-Sign 10{sup 36} erg s{sup -1}. Given the energetic constraints from its high-energy gamma-ray emission, a non-thermal to spin-down luminosity ratio very close to unity may be required.

  3. Extending the methodology of X-ray crystallography to allow X-ray microscopy without X-ray optics

    International Nuclear Information System (INIS)

    Miao Jianwei; Kirz, Janos; Sayre, David; Charalambous, Pambos

    2000-01-01

    We demonstrate that the soft X-ray diffraction pattern from a micron-size noncrystalline specimen can be recorded and inverted to form a high-resolution image. The phase problem is overcome by oversampling the diffraction pattern. The image is obtained using an iterative algorithm. The technique provides a method for X-ray microscopy requiring no high-resolution X-ray optical elements or detectors. In the present work, a resolution of approximately 60 nm was obtained, but we believe that considerably higher resolution can be achieved

  4. Subluminous X-ray binaries

    NARCIS (Netherlands)

    Armas Padilla, M.

    2013-01-01

    The discovery of the first X-ray binary, Scorpius X-1, by Giacconi et al. (1962), marked the birth of X-ray astronomy. Following that discovery, many additional X-ray sources where found with the first generation of X-ray rockets and observatories (e.g., UHURU and Einstein). The short-timescale

  5. X-ray counterpart candidates for six new γ-ray pulsars

    Science.gov (United States)

    Zyuzin, Dmitry A.; Karpova, Anna V.; Shibanov, Yuriy A.

    2018-05-01

    Using archival X-ray data, we have found point-like X-ray counterpart candidates positionally coincident with six γ-ray pulsars discovered recently in the Fermi Gamma-ray Space Telescope data by the Einstein@Home project. The candidates for PSRs J0002+6216, J0554+3107, J1844-0346, and J1105-6037 are detected with Swift, and those for PSRs J0359+5414 and J2017+3625 are detected with Chandra. Despite a low count statistics for some candidates, assuming plausible constraints on the absorbing column density towards the pulsars, we show that X-ray spectral properties for all of them are consistent with those observed for other pulsars. J0359+5414 is the most reliably identified object. We detect a nebula around it, whose spectrum and extent suggest that this is a pulsar wind nebula powered by the pulsar. Associations of J0002+6216 and J1844-0346 with supernova remnants CTB 1 and G28.6-0.1 are proposed.

  6. X-Ray Spectral Diagnostics of Gamma-Ray Burst Environments.

    Science.gov (United States)

    Paerels; Kuulkers; Heise; Liedahl

    2000-05-20

    Recently, detection of discrete features in the X-ray afterglow spectra of GRB 970508 and GRB 970828 was reported. The most natural interpretation of these features is that they are redshifted Fe K emission complexes. The identification of the line emission mechanism has drastic implications for the inferred mass of radiating material and hence the nature of the burst site. X-ray spectroscopy provides a direct observational constraint on these properties of gamma-ray bursters. We briefly discuss how these constraints arise in the context of an application to the spectrum of GRB 970508.

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Raja Chauhan1 Sadhna Singh2. Truba Institute of Engineering and Information Technology, Karod-Gandhinagar Bypass Road, Bhopal 462 038, India; Centre for Basic Sciences and M.P. Bhoj (Open) University, Gas Rahat Bhavan, Govindpura, Bhopal 462 023, India ...

  8. Destructive fishing and fisheries enforcement in eastern Indonesia

    NARCIS (Netherlands)

    Bailey, M.L.; Sumaila, U.R.

    2015-01-01

    A simple bioeconomic leader-follower model was constructed to simulate snapper (family Lutjanidae) and grouper (family Serranidae) fisheries in Raja Ampat, Indonesia, an area of significant coral and fish biodiversity. We developed a leader-follower game, wherein the Regency government as the leader

  9. ACKNOWLEDGEMENTS

    Indian Academy of Sciences (India)

    ... Raha, Soumen Basak , Amitava Majumder, Mousumi Basu, Smarajit Polley, Raja Bhattacharya, and all other lab members. OUR COLLABORATORS: Prof. S. Roy, Bose Institute, Kolkata. Prof.M.S.Shaila, IISC, Bangalore. GRANTING AGENCIES: Dept. of Science and Technology. All India Council for Technical Education.

  10. African Journal of Biotechnology - Vol 15, No 38 (2016)

    African Journals Online (AJOL)

    Antibacterial potential of silver nanoparticle synthesized by marine actinomycetes in reference with standard antibiotics against hospital acquired infectious pathogens · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Raja M. Mohamed Mahroop, John S. Ahmed ...

  11. Vstretilis poet i hudozhnik.. / Nadezhda Borissova

    Index Scriptorium Estoniae

    Borissova, Nadezhda

    1998-01-01

    Tutvustatakse Raja külas sündinud ja Kohtla-Järvel elavat ning töötavat kunstnikku Jevgeni Kolpakovi, kelle tööde näitus oli hiljuti Mustvee kultuurimajas. Mainitakse ikoonikooli Tiheda külas, juhatajaks Pimen Safonov

  12. Eelarvamustest lahti / Katt Hansen

    Index Scriptorium Estoniae

    Hansen, Katt

    2003-01-01

    PÖFFi naistekeskseid mängufilme : taanlase Morten Arnfredi "Õnne tänav", tšehh Michaela Pavlatova "Truudusetud mängud", prantsuse filmid "29 Palms" (Bruno Dumont) ja "Väike Lili" (Claude Miller) ning prantsuse-tuneesia "Satin Rouge" (Raja Amari)

  13. Evidence of lacustrine sedimentation in the Upper Permian Bijori ...

    Indian Academy of Sciences (India)

    cent areas. On the basis ...... Coaly layers formed from the accumulations of ... indicative of a continental affinity. 3. ..... rior of the Tethys margin (Veevers and Tewari ..... Petrol. 51 1147–1156. Raja Rao C S 1983 Coalfields of India. Vol-III, Coal.

  14. Vibrational spectra and normal coordinate analysis on structure of ...

    Indian Academy of Sciences (India)

    as high as 840 cm−1. For simple organic chlorine compounds, C–Cl absorptions are in the region 750–700 cm−1 whereas .... Ph.D. Thesis (Bharathidasan University, Tiruchirappalli, Tamil Nadu, India, 1997). [26] S Xavier Jesu Raja, A William ...

  15. Method for spatially modulating X-ray pulses using MEMS-based X-ray optics

    Science.gov (United States)

    Lopez, Daniel; Shenoy, Gopal; Wang, Jin; Walko, Donald A.; Jung, Il-Woong; Mukhopadhyay, Deepkishore

    2015-03-10

    A method and apparatus are provided for spatially modulating X-rays or X-ray pulses using microelectromechanical systems (MEMS) based X-ray optics. A torsionally-oscillating MEMS micromirror and a method of leveraging the grazing-angle reflection property are provided to modulate X-ray pulses with a high-degree of controllability.

  16. Optical and X-ray studies of Compact X-ray Binaries in NGC 5904

    Science.gov (United States)

    Bhalotia, Vanshree; Beck-Winchatz, Bernhard

    2018-06-01

    Due to their high stellar densities, globular cluster systems trigger various dynamical interactions, such as the formation of compact X-ray binaries. Stellar collisional frequencies have been correlated to the number of X-ray sources detected in various clusters and we hope to measure this correlation for NGC 5904. Optical fluxes of sources from archival HST images of NGC 5904 have been measured using a DOLPHOT PSF photometry in the UV, optical and near-infrared. We developed a data analysis pipeline to process the fluxes of tens of thousands of objects using awk, python and DOLPHOT. We plot color magnitude diagrams in different photometric bands in order to identify outliers that could be X-ray binaries, since they do not evolve the same way as singular stars. Aligning previously measured astrometric data for X-ray sources in NGC 5904 from Chandra with archival astrometric data from HST will filter out the outlier objects that are not X-ray producing, and provide a sample of compact binary systems that are responsible for X-ray emission in NGC 5904. Furthermore, previously measured X-ray fluxes of NGC 5904 from Chandra have also been used to measure the X-ray to optical flux ratio and identify the types of compact X-ray binaries responsible for the X-ray emissions in NGC 5904. We gratefully acknowledge the support from the Illinois Space Grant Consortium.

  17. SHOULD ONE USE THE RAY-BY-RAY APPROXIMATION IN CORE-COLLAPSE SUPERNOVA SIMULATIONS?

    Energy Technology Data Exchange (ETDEWEB)

    Skinner, M. Aaron; Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Dolence, Joshua C., E-mail: burrows@astro.princeton.edu, E-mail: askinner@astro.princeton.edu, E-mail: jdolence@lanl.gov [CCS-2, Los Alamos National Laboratory, P.O. Box 1663 Los Alamos, NM 87545 (United States)

    2016-11-01

    We perform the first self-consistent, time-dependent, multi-group calculations in two dimensions (2D) to address the consequences of using the ray-by-ray+ transport simplification in core-collapse supernova simulations. Such a dimensional reduction is employed by many researchers to facilitate their resource-intensive calculations. Our new code (Fornax) implements multi-D transport, and can, by zeroing out transverse flux terms, emulate the ray-by-ray+ scheme. Using the same microphysics, initial models, resolution, and code, we compare the results of simulating 12, 15, 20, and 25 M {sub ⊙} progenitor models using these two transport methods. Our findings call into question the wisdom of the pervasive use of the ray-by-ray+ approach. Employing it leads to maximum post-bounce/pre-explosion shock radii that are almost universally larger by tens of kilometers than those derived using the more accurate scheme, typically leaving the post-bounce matter less bound and artificially more “explodable.” In fact, for our 25 M {sub ⊙} progenitor, the ray-by-ray+ model explodes, while the corresponding multi-D transport model does not. Therefore, in two dimensions, the combination of ray-by-ray+ with the axial sloshing hydrodynamics that is a feature of 2D supernova dynamics can result in quantitatively, and perhaps qualitatively, incorrect results.

  18. X rays and condensed matter

    International Nuclear Information System (INIS)

    Daillant, J.

    1997-01-01

    After a historical review of the discovery and study of X rays, the various interaction processes between X rays and matter are described: Thomson scattering, Compton scattering, X-photon absorption through photoelectric effect, and magnetic scattering. X ray sources such as the European Synchrotron Radiation Facility (ESRF) are described. The various X-ray applications are presented: imagery such as X tomography, X microscopy, phase contrast; X-ray photoelectron spectroscopy and X-ray absorption spectroscopy; X-ray scattering and diffraction techniques

  19. Cosmic-ray contribution in measurement of environmental gamma-ray dose

    International Nuclear Information System (INIS)

    Nagaoka, Kazunori; Honda, Kouichirou; Miyano, Keiji

    1996-01-01

    Nowadays several kinds of dosimeters are being used for environmental gamma-ray monitoring. However the results measured by those instruments are not always in good agreement. It may be caused from the different characteristics of dosimeters. In particular the different responses of the instruments to cosmic-rays give significant influence on the results. Environmental radiation measurements at various altitudes on Mt. Fuji were carried out using a scintillation spectrometer with 3''φ spherical NaI(Tl), a pressurized ionization chamber (PIC), an air-equivalent ionization chamber (IC), thermoluminescence dosimeters (TLD), radiophotoluminescence glass dosimeters (RPLD) and NaI(Tl) scintillation survey meters so that the response characteristics of these instruments to cosmic-rays could be clarified. Cosmic-ray contributions for all instruments were correlated with counting rate over 3 MeV by the spectrometer. Each contribution can be estimated by measurement of the counting rate. Conversion factors (nGy/h/cpm) for IC, PIC, TLD, RPLD and NaI survey meters (TCS166 and TCS121C) were 0.33, 0.32, 0.25, 0.24, 0.06 and -0.01, respectively. Self-doses of these instruments were estimated by measurements at Nokogiriyama facilities of the Institute for Cosmic Ray Research, University of Tokyo. Self-doses for TLD and RPLD were approximately 6 nGy/h. The self dose effect should be taken into consideration in environmental dose measurements. These data are expected to be useful in estimating the cosmic-ray contribution and self-dose in the measurement of environmental gamma-ray dose. (author)

  20. Basics of Gamma Ray Detection

    Energy Technology Data Exchange (ETDEWEB)

    Stinnett, Jacob [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Venkataraman, Ram [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-09-13

    The objective of this training is to explain the origin of x-rays and gamma rays, gamma ray interactions with matter, detectors and electronics used in gamma ray-spectrometry, and features of a gamma-ray spectrum for nuclear material that is safeguarded.

  1. CCD-based X-ray detectors for X-ray diffraction studies

    International Nuclear Information System (INIS)

    Ito, K.; Amemiya, Y.

    1999-01-01

    CCD-based X-ray detectors are getting to be used for X-ray diffraction studies especially in the studies where real time (automated) measurements and time-resolved measurements are required. Principles and designs of two typical types of CCD-based detectors are described; one is ths system in which x-ray image intensifiers are coupled to maximize the detective quantum efficiency for time-resolved measurements, and the other is the system in which tapered optical fibers are coupled for the reduction of the image into the CCD, which is optimized for automated measurements for protein crystallography. These CCD-based X-ray detectors have an image distortion and non-uniformity of response to be corrected by software. Correction schemes which we have developed are also described. (author)

  2. Microfocussing of synchrotron X-rays using X-ray refractive lens developed at Indus-2 deep X-ray lithography beamline

    International Nuclear Information System (INIS)

    Dhamgaye, V.P.; Tiwari, M.K.; Lodha, G.S.; Sawhney, K.J.S.

    2014-01-01

    X-ray lenses are fabricated in polymethyl methacrylate using deep X-ray lithography beamline of Indus-2. The focussing performance of these lenses is evaluated using Indus-2 and Diamond Light Source Ltd. The process steps for the fabrication of X-ray lenses and microfocussing at 10 keV at moderate and low emittance sources are compared. (author)

  3. Phase-contrast X-ray imaging using an X-ray interferometer for biological imaging

    Energy Technology Data Exchange (ETDEWEB)

    Momose, Atsushi; Koyama, Ichiro [Tokyo Univ., Dept. of Applied Physics, Tokyo (Japan); Takeda, Tohoru; Itai, Yuji [Tsukuba Univ., Inst. of Clinical Medicine, Tsukuba, Ibaraki (Japan); Yoneyama, Akio [Hitachi Ltd., Advanced Research Laboratory, Saitama (Japan)

    2002-04-01

    The potential of phase-contrast X-ray imaging using an X-ray interferometer is discussed comparing with other phase-contrast X-ray imaging methods, and its principle of contrast generation is presented including the case of phase-contrast X-ray computed tomography. The status of current instrumentation is described and perspectives for practical applications are discussed. (author)

  4. X-ray detector for a panoramic X-ray unit

    Energy Technology Data Exchange (ETDEWEB)

    Cowell, D; Ensslin, F H

    1976-01-15

    The discovery deals with an X-ray detector suitable for the controlling of panoramic X-ray systems. It consists of a fluorescent image screen and a semiconductor photo cell. The output signal of the detector is proportional to the intensity of the X-radiation and the response time is large enough to follow the change of amplitude of the contours of the modulated X radiation. The detector with band-pass filter regulates, via a control system, the moving rate of the X-ray source and of the film opposite it in dependence of the intensity, so that a uniform exposure is ensured.

  5. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Fichtel, C.E.

    1975-01-01

    The first certain detection of celestial high energy gamma rays came from a satellite experiment flown on the third Orbiting Solar Observatory (OSO-111). A Gamma ray spark chamber telescope with substantively greater sensitivity and angular resolution (a few degrees) flown on the second Small Astronomy Satellite (SAS-II) has now provided a better picture of the gamma ray sky, and particularly the galactic plane and pulsars. This paper will summarize the present picture of gamma ray astronomy as it has developed at this conference from measurements made with experiments carried out on balloons, those remaining on the ground, and ones flown on satellites. (orig.) [de

  6. Projection-type X-ray microscope based on a spherical compound refractive X-ray lens

    OpenAIRE

    Dudchik, Yu. I.; Gary, C. K.; Park, H.; Pantell, R. H.; Piestrup, M. A.

    2007-01-01

    New projection- type X-ray microscope with a compound refractive lens as the optical element is presented. The microscope consists of an X-ray source that is 1-2 mm in diameter, compound X-ray lens and X-ray camera that are placed in-line to satisfy the lens formula. The lens forms an image of the X-ray source at camera sensitive plate. An object is placed between the X-ray source and the lens as close as possible to the source, and the camera shows a shadow image of the object. Spatial resol...

  7. Summary of existing information on gamma-ray and X-ray attenuation coefficients of solutions

    DEFF Research Database (Denmark)

    Singh, K.; Gerward, Leif

    2002-01-01

    Accurate values of X-ray and gamma-ray attenuation coefficients of different chemicals are required in spectrometry as well as in many other scientific, engineering and medical disciplines involving photon radiation. The current state of knowledge of experimental and theoretical gamma-ray and X-r......-ray attenuation coefficients in aqueous solutions of salts is presented and exemplified by recent work. The results presented provide a basis for studying X-ray and gamma-ray photon interactions with ions in solution (hydrated ions) rather than ion compounds in solid form....

  8. Natural background gamma-ray spectrum. List of gamma-rays ordered in energy from natural radionuclides

    International Nuclear Information System (INIS)

    Ichimiya, Tsutomu; Narita, Tsutomu; Kitao, Kensuke.

    1998-03-01

    A quick index to γ-rays and X-rays from natural radionuclides is presented. In the list, γ-rays are arranged in order of increasing energy. The list also contains γ-rays from radioactive nuclides produced in a germanium detector and its surrounding materials by interaction with cosmic neutrons, as well as direct γ-rays from interaction with the neutrons. Artificial radioactive nuclides emitting γ-rays with same or near energy value as that of the natural γ-rays and X-rays are also listed. In appendix, γ-ray spectra from a rock, uranium ore, thorium, monazite and uraninite and also background spectra obtained with germanium detectors placed in iron or lead shield have been given. The list is designed for use in γ-ray spectroscopy under the conditions of highly natural background, such as in-situ environmental radiation monitoring or low-level activity measurements, with a germanium detector. (author)

  9. Natural background gamma-ray spectrum. List of gamma-rays ordered in energy from natural radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Ichimiya, Tsutomu [Japan Radioisotope Association, Tokyo (Japan); Narita, Tsutomu; Kitao, Kensuke

    1998-03-01

    A quick index to {gamma}-rays and X-rays from natural radionuclides is presented. In the list, {gamma}-rays are arranged in order of increasing energy. The list also contains {gamma}-rays from radioactive nuclides produced in a germanium detector and its surrounding materials by interaction with cosmic neutrons, as well as direct {gamma}-rays from interaction with the neutrons. Artificial radioactive nuclides emitting {gamma}-rays with same or near energy value as that of the natural {gamma}-rays and X-rays are also listed. In appendix, {gamma}-ray spectra from a rock, uranium ore, thorium, monazite and uraninite and also background spectra obtained with germanium detectors placed in iron or lead shield have been given. The list is designed for use in {gamma}-ray spectroscopy under the conditions of highly natural background, such as in-situ environmental radiation monitoring or low-level activity measurements, with a germanium detector. (author)

  10. Development of X-ray excitable luminescent probes for scanning X-ray microscopy

    International Nuclear Information System (INIS)

    Moronne, M.M.

    1999-01-01

    Transmission soft X-ray microscopy is now capable of achieving resolutions that are typically 5 times better than the best-visible light microscopes. With expected improvements in zone plate optics, an additional factor of two may be realized within the next few years. Despite the high resolution now available with X-ray microscopes and the high X-ray contrast provided by biological molecules in the soft X-ray region (λ=2-5 nm), molecular probes for localizing specific biological targets have been lacking. To circumvent this problem, X-ray excitable molecular probes are needed that can target unique biological features. In this paper we report our initial results on the development of lanthanide-based fluorescent probes for biological labeling. Using scanning luminescence X-ray microscopy (SLXM, Jacobsen et al., J. Microscopy 172 (1993) 121-129), we show that lanthanide organo-polychelate complexes are sufficiently bright and radiation resistant to be the basis of a new class of X-ray excitable molecular probes capable of providing at least a fivefold improvement in resolution over visible light microscopy. Lanthanide probes, able to bind 80-100 metal ions per molecule, were found to give strong luminescent signals with X-ray doses exceeding 10 8 Gy, and were used to label actin stress fibers and in vitro preparations of polymerized tubulin. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  11. COSMIC-RAY AND X-RAY HEATING OF INTERSTELLAR CLOUDS AND PROTOPLANETARY DISKS

    International Nuclear Information System (INIS)

    Glassgold, Alfred E.; Galli, Daniele; Padovani, Marco

    2012-01-01

    Cosmic-ray and X-ray heating are derived from the electron energy-loss calculations of Dalgarno, Yan, and Liu for hydrogen-helium gas mixtures. These authors treated the heating from elastic scattering and collisional de-excitation of rotationally excited hydrogen molecules. Here we consider the heating that can arise from all ionization and excitation processes, with particular emphasis on the reactions of cosmic-ray and X-ray generated ions with the heavy neutral species, which we refer to as chemical heating. In molecular regions, chemical heating dominates and can account for 50% of the energy expended in the creation of an ion pair. The heating per ion pair ranges in the limit of negligible electron fraction from ∼4.3 eV for diffuse atomic gas to ∼13 eV for the moderately dense regions of molecular clouds and to ∼18 eV for the very dense regions of protoplanetary disks. An important general conclusion of this study is that cosmic-ray and X-ray heating depends on the physical properties of the medium, i.e., on the molecular and electron fractions, the total density of hydrogen nuclei, and, to a lesser extent, on the temperature. It is also noted that chemical heating, the dominant process for cosmic-ray and X-ray heating, plays a role in UV irradiated molecular gas.

  12. Measurements of x-rays and γ-rays from stopped kaons

    International Nuclear Information System (INIS)

    Godfrey, G.L.

    1975-01-01

    Intensities of x rays and γ rays from negative kaons stopped in elements, pure isotopes, and some compounds ranging from Z = 2 through Z = 92 have been measured. Included were x rays from K - atoms, Σ - atoms, and π - atoms. Also some nuclear γ rays associated with the stopped kaons were observed. The kaonic x-ray intensities for low n, Δn = 1 transitions, varied from .1 to .5 x rays/K/sub stop/ and showed a remarkable oscillation as Z changed. Peaks occurred near elements with closed electron shells. Within experimental accuracy, isotopes of the same elements yielded equal intensities. By searching for μ - from K - → μ - anti ν it was concluded that less than or equal to 5 percent of the stopped kaons decayed before nuclear capture in those elements studied. A cascade calculation was performed that reasonably reproduced the Δn = 1 intensities but gave Δn = 2 intensities high by a factor of 2. Initial kaon distributions in n = 30 proportional to (2l + 1) out to some l/sub max/ were used to begin the cascade. The value of l/sub max/ changed with Z. It is suggested that l/sub max/ might be related to an impact parameter picture with the lever arm equal to one-half the distance between the atoms in their lattice. (U.S.)

  13. Compact X-ray sources: X-rays from self-reflection

    Science.gov (United States)

    Mangles, Stuart P. D.

    2012-05-01

    Laser-based particle acceleration offers a way to reduce the size of hard-X-ray sources. Scientists have now developed a simple scheme that produces a bright flash of hard X-rays by using a single laser pulse both to generate and to scatter an electron beam.

  14. X-ray crystallography

    Science.gov (United States)

    2001-01-01

    X-rays diffracted from a well-ordered protein crystal create sharp patterns of scattered light on film. A computer can use these patterns to generate a model of a protein molecule. To analyze the selected crystal, an X-ray crystallographer shines X-rays through the crystal. Unlike a single dental X-ray, which produces a shadow image of a tooth, these X-rays have to be taken many times from different angles to produce a pattern from the scattered light, a map of the intensity of the X-rays after they diffract through the crystal. The X-rays bounce off the electron clouds that form the outer structure of each atom. A flawed crystal will yield a blurry pattern; a well-ordered protein crystal yields a series of sharp diffraction patterns. From these patterns, researchers build an electron density map. With powerful computers and a lot of calculations, scientists can use the electron density patterns to determine the structure of the protein and make a computer-generated model of the structure. The models let researchers improve their understanding of how the protein functions. They also allow scientists to look for receptor sites and active areas that control a protein's function and role in the progress of diseases. From there, pharmaceutical researchers can design molecules that fit the active site, much like a key and lock, so that the protein is locked without affecting the rest of the body. This is called structure-based drug design.

  15. Combined optic system based on polycapillary X-ray optics and single-bounce monocapillary optics for focusing X-rays from a conventional laboratory X-ray source

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Xuepeng; Liu, Zhiguo [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Sun, Tianxi, E-mail: stx@bnu.edu.cn [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Yi, Longtao; Sun, Weiyuan; Li, Fangzuo; Jiang, Bowen [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Ma, Yongzhong [Center for Disease Control and Prevention of Beijing, Beijing 100013 (China); Ding, Xunliang [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China)

    2015-12-01

    Two combined optic systems based on polycapillary X-ray optics and single-bounce monocapillary optics (SBMO) were designed for focusing the X-rays from a conventional laboratory X-ray source. One was based on a polycapillary focusing X-ray lens (PFXRL) and a single-bounce ellipsoidal capillary (SBEC), in which the output focal spot with the size of tens of micrometers of the PFXRL was used as the “virtual” X-ray source for the SBEC. The other system was based on a polycapillary parallel X-ray lens (PPXRL) and a single-bounce parabolic capillary (SBPC), in which the PPXRL transformed the divergent X-ray beam from an X-ray source into a quasi-parallel X-ray beam with the divergence of sever milliradians as the incident illumination of the SBPC. The experiment results showed that the combined optic systems based on PFXRL and SBEC with a Mo rotating anode X-ray generator with the focal spot with a diameter of 300 μm could obtain a focal spot with the total gain of 14,300 and focal spot size of 37.4 μm, and the combined optic systems based on PPXRL and SBPC with the same X-ray source mentioned above could acquire a focal spot with the total gain of 580 and focal spot size of 58.3 μm, respectively. The two combined optic systems have potential applications in micro X-ray diffraction, micro X-ray fluorescence, micro X-ray absorption near edge structure, full field X-ray microscopes and so on.

  16. Panel discussion on: Data analysis trends in X-ray and γ-ray astronomy

    International Nuclear Information System (INIS)

    Ozel, M.F.; Buccheri, R.; Scarsi, L.

    1985-01-01

    This article is a panel discussion that included several participants. The problems of data analysis in x- and gamma-ray astronomy are discussed. Improvements achieved by consecutive gamma-ray experiments since the 1960's are reviewed. The presentation of gamma-ray data in terms of two-dimensional sky maps is examined and different representations of galactic anticenter gamma-ray sky are shown

  17. Effect of annealing on phase transition in poly(vinylidene fluoride ...

    Indian Academy of Sciences (India)

    Administrator

    Laser Materials Development and Devices Division, Raja Ramanna Centre for Advanced Technology,. Indore 452 ... (DMSO) solvent, regardless of preparation temperature. .... The melting point, crystallization and phase transition of α-, β- and γ-phases of PVDF were observed from DSC curves during heating cycle of DSC.

  18. Mukhopadhyay, Prof. Dhrubajyoti

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1988 Section: Earth & Planetary Sciences. Mukhopadhyay, Prof. Dhrubajyoti Ph.D. (London), FNA, FNASc. Date of birth: 19 September 1938. Specialization: Structural Geology, Precambrian Geology Address: G-7, MIG Housing Colony, 25/3, Raja Manindra Road, Kolkata 700 037, ...

  19. State-of-the-art review on fracture analysis of concrete structural ...

    Indian Academy of Sciences (India)

    Structural Engineering Research Centre, CSIR Campus, Taramani, .... Sundara Raja Iyengar et al (1996) applied the fictitious crack ... tic approaches that utilize the concept of fracture mechanics to study crack propagation from .... the structural response significantly, and the local fracture behaviour, for example the crack.

  20. Ancient ports of Kalinga

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    which plied between Kalinga and south east Asian countries. Nanda Raja, is said to have attacked Kalinga with the intention of getting access to the sea for the landlocked Kingdom of Magadha (Bihar). The ancient texa Artha Sastra (3rd-4th century B...

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    https://www.ias.ac.in/article/fulltext/reso/012/07/0061-0078. Keywords. Autonomous robots; machine intelligence; smart structures; universal computers; artificial evolution; personal robots. Author Affiliations. V K Wadhawan1. Raja Ramanna Fellow (DAE), Solid State Physics Division, Bhabha Atomic Research Centre, ...

  2. X-Ray Lasers 2016

    CERN Document Server

    Bulanov, Sergei; Daido, Hiroyuki; Kato, Yoshiaki

    2018-01-01

    These proceedings comprise a selection of invited and contributed papers presented at the 15th International Conference on X-Ray Lasers (ICXRL 2016), held at the Nara Kasugano International Forum, Japan, from May 22 to 27, 2016. This conference was part of an ongoing series dedicated to recent developments in the science and technology of x-ray lasers and other coherent x-ray sources with additional focus on supporting technologies, instrumentation and applications.   The book showcases recent advances in the generation of intense, coherent x-rays, the development of practical devices and their applications across a wide variety of fields. It also discusses emerging topics such as plasma-based x-ray lasers, 4th generation accelerator-based sources and higher harmonic generations, as well as other x-ray generation schemes.

  3. Wavelength dispersive X-ray absorption fine structure imaging by parametric X-ray radiation

    International Nuclear Information System (INIS)

    Inagaki, Manabu; Sakai, Takeshi; Sato, Isamu; Hayakawa, Yasushi; Nogami, Kyoko; Tanaka, Toshinari; Hayakawa, Ken; Nakao, Keisuke

    2008-01-01

    The parametric X-ray radiation (PXR) generator system at Laboratory for Electron Beam Research and Application (LEBRA) in Nihon University is a monochromatic and coherent X-ray source with horizontal wavelength dispersion. The energy definition of the X-rays, which depends on the horizontal size of the incident electron beam on the generator target crystal, has been investigated experimentally by measuring the X-ray absorption near edge structure (XANES) spectra on Cu and CuO associated with conventional X-ray absorption imaging technique. The result demonstrated the controllability of the spectrum resolution of XANES by adjusting of the horizontal electron beam size on the target crystal. The XANES spectra were obtained with energy resolution of several eV at the narrowest case, which is in qualitative agreement with the energy definition of the PXR X-rays evaluated from geometrical consideration. The result also suggested that the wavelength dispersive X-ray absorption fine structure measurement associated with imaging technique is one of the promising applications of PXR. (author)

  4. 13.1 micrometers hard X-ray focusing by a new type monocapillary X-ray optic designed for common laboratory X-ray source

    Science.gov (United States)

    Sun, Xuepeng; zhang, Xiaoyun; Zhu, Yu; Wang, Yabing; Shang, Hongzhong; Zhang, Fengshou; Liu, Zhiguo; Sun, Tianxi

    2018-04-01

    A new type of monocapillary X-ray optic, called 'two bounces monocapillary X-ray optics' (TBMXO), is proposed for generating a small focal spot with high power-density gain for micro X-ray analysis, using a common laboratory X-ray source. TBMXO is consists of two parts: an ellipsoidal part and a tapered part. Before experimental testing, the TBMXO was simulated by the ray tracing method in MATLAB. The simulated results predicted that the proposed TBMXO would produce a smaller focal spot with higher power-density gain than the ellipsoidal monocapillary X-ray optic (EMXO). In the experiment, the TBMXO performance was tested by both an optical device and a Cu target X-ray tube with focal spot of 100 μm. The results indicated that the TBMXO had a slope error of 57.6 μrad and a 13.1 μm focal spot and a 1360 gain in power density were obtained.

  5. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... are the limitations of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray ( ... leg (shin), ankle or foot. top of page What are some common uses of the procedure? A ...

  6. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose ...

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... that might interfere with the x-ray images. Women should always inform their physician and x-ray ... Safety page for more information about radiation dose. Women should always inform their physician or x-ray ...

  8. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... of knee x-rays. A portable x-ray machine is a compact apparatus that can be taken ... of the body being examined, an x-ray machine produces a small burst of radiation that passes ...

  9. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... drawer under the table holds the x-ray film or image recording plate . Sometimes the x-ray ... extended over the patient while an x-ray film holder or image recording plate is placed beneath ...

  10. X-ray astronomy 2000: Wide field X-ray monitoring with lobster-eye telescopes

    International Nuclear Information System (INIS)

    Inneman, A.; Hudec, R.; Pina, L.; Gorenstein, P.

    2001-01-01

    The recently available first prototypes of innovative very wide field X-ray telescopes of Lobster-Eye type confirm the feasibility to develop such flight instruments in a near future. These devices are expected to allow very wide field (more than 1000 square degrees) monitoring of the sky in X-rays (up to 10 keV and perhaps even more) with faint limits. We will discuss the recent status of the development of very wide field X-ray telescopes as well as related scientific questions including expected major contributions such as monitoring and study of X-ray afterglows of Gamma Ray Bursts

  11. Ultrashort X-ray pulse science

    Energy Technology Data Exchange (ETDEWEB)

    Chin, Alan Hap [Univ. of California, Berkeley, CA (US). Dept. of Physics; Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    1998-05-01

    A variety of phenomena involves atomic motion on the femtosecond time-scale. These phenomena have been studied using ultrashort optical pulses, which indirectly probe atomic positions through changes in optical properties. Because x-rays can more directly probe atomic positions, ultrashort x-ray pulses are better suited for the study of ultrafast structural dynamics. One approach towards generating ultrashort x-ray pulses is by 90° Thomson scattering between terawatt laser pulses and relativistic electrons. Using this technique, the author generated ~ 300 fs, 30 keV (0.4 Å) x-ray pulses. These x-ray pulses are absolutely synchronized with ultrashort laser pulses, allowing femtosecond optical pump/x-ray probe experiments to be performed. Using the right-angle Thomson scattering x-ray source, the author performed time-resolved x-ray diffraction studies of laser-perturbated InSb. These experiments revealed a delayed onset of lattice expansion. This delay is due to the energy relaxation from a dense electron-hole plasma to the lattice. The dense electron-hole plasma first undergoes Auger recombination, which reduces the carrier concentration while maintaining energy content. Longitudinal-optic (LO) phonon emission then couples energy to the lattice. LO phonon decay into acoustic phonons, and acoustic phonon propagation then causes the growth of a thermally expanded layer. Source characterization is instrumental in utilizing ultrashort x-ray pulses in time-resolved x-ray spectroscopies. By measurement of the electron beam diameter at the generation point, the pulse duration of the Thomson scattered x-rays is determined. Analysis of the Thomson scattered x-ray beam properties also provides a novel means of electron bunch characterization. Although the pulse duration is inferred for the Thomson scattering x-ray source, direct measurement is required for other x-ray pulse sources. A method based on the laser-assisted photoelectric effect (LAPE) has been demonstrated as a

  12. Ultrashort X-ray pulse science

    International Nuclear Information System (INIS)

    Chin, A.H.; Lawrence Berkeley National Lab., CA

    1998-01-01

    A variety of phenomena involves atomic motion on the femtosecond time-scale. These phenomena have been studied using ultrashort optical pulses, which indirectly probe atomic positions through changes in optical properties. Because x-rays can more directly probe atomic positions, ultrashort x-ray pulses are better suited for the study of ultrafast structural dynamics. One approach towards generating ultrashort x-ray pulses is by 90 o Thomson scattering between terawatt laser pulses and relativistic electrons. Using this technique, the author generated ∼ 300 fs, 30 keV (0.4 (angstrom)) x-ray pulses. These x-ray pulses are absolutely synchronized with ultrashort laser pulses, allowing femtosecond optical pump/x-ray probe experiments to be performed. Using the right-angle Thomson scattering x-ray source, the author performed time-resolved x-ray diffraction studies of laser-perturbated InSb. These experiments revealed a delayed onset of lattice expansion. This delay is due to the energy relaxation from a dense electron-hole plasma to the lattice. The dense electron-hole plasma first undergoes Auger recombination, which reduces the carrier concentration while maintaining energy content. Longitudinal-optic (LO) phonon emission then couples energy to the lattice. LO phonon decay into acoustic phonons, and acoustic phonon propagation then causes the growth of a thermally expanded layer. Source characterization is instrumental in utilizing ultrashort x-ray pulses in time-resolved x-ray spectroscopies. By measurement of the electron beam diameter at the generation point, the pulse duration of the Thomson scattered x-rays is determined. Analysis of the Thomson scattered x-ray beam properties also provides a novel means of electron bunch characterization. Although the pulse duration is inferred for the Thomson scattering x-ray source, direct measurement is required for other x-ray pulse sources. A method based on the laser-assisted photoelectric effect (LAPE) has been

  13. Material Discriminated X-Ray CT System by Using New X-Ray Imager with Energy Discriminate Function

    Directory of Open Access Journals (Sweden)

    Toru Aoki

    2008-04-01

    Full Text Available Material discriminated X-ray CT system has been constructed by using conventional X-ray tube (white X-ray source and photon-counting X-ray imager as an application with energy band detection. We have already reported material identify X-ray CT using K-shell edge method elsewhere. In this report the principle of material discrimination was adapted the separation of electron-density and atomic number from attenuation coefficient mapping in X-ray CT reconstructed image in two wavelength X-ray CT method using white X-ray source and energy discriminated X-ray imager by using two monochrome X-ray source method. The measurement phantom was prepared as four kinds material rods (Carbon(C, Iron(Fe, Copper(Cu, Titanium(Ti rods of 3mm-diameter inside an aluminum(Al rod of 20mm-diameter. We could observed material discriminated X-ray CT reconstructed image, however, the discrimination properties were not good than two monochrome X-ray CT method. This results was could be explained because X-ray scattering, beam-hardening and so on based on white X-ray source, which could not observe in two monochrome X-ray CT method. However, since our developed CdTe imager can be detect five energy-bands at the same time, we can use multi-band analysis to decrease the least square error margin. We will be able to obtain more high separation in atomic number mapping in X-ray CT reconstructed image by using this system.

  14. Molecular Diagnostics of Arthroconidial Yeasts, Frequent Pulmonary Opportunists.

    Science.gov (United States)

    Kaplan, Engin; Al-Hatmi, Abdullah M S; Ilkit, Macit; Gerrits van den Ende, A H G; Hagen, Ferry; Meis, Jacques F; de Hoog, G Sybren

    2018-01-01

    Magnusiomyces capitatus and Saprochaete clavata are members of the clade of arthroconidial yeasts that represent emerging opportunistic pulmonary pathogens in immunocompromised patients. Given that standard ribosomal DNA (rDNA) identification often provides confusing results, in this study, we analyzed 34 isolates with the goal of finding new genetic markers for classification using multilocus sequencing and amplified fragment length polymorphism (AFLP). The interspecific similarity obtained using rDNA markers (the internal transcribed spacer [ITS] and large subunit regions) was in the range of 96 to 99%, whereas that obtained using protein-coding loci ( Rbp2 , Act , and Tef1α ) was lower at 89.4 to 95.2%. Ultimately, Rbp2 was selected as the best marker for species distinction. On the basis of cloned ITS data, some strains proved to be misidentified in comparison with the identities obtained with phenotypic characters, protein sequences, and AFLP profiles, indicating that different copies of the ribosomal operon were present in a single species. Antifungal susceptibility testing revealed that voriconazole had the lowest MIC against M. capitatus , while amphotericin B had the lowest MIC against S. clavata Both species exhibited in vitro resistance to fluconazole and micafungin. Copyright © 2017 American Society for Microbiology.

  15. X-ray cardiovascular examination apparatus

    International Nuclear Information System (INIS)

    1977-01-01

    An X-ray source is mounted in an enclosure for angulating longitudinally about a horizontal axis. An X-ray-permeable, patient-supporting table is mounted on the top of the enclosure for executing lateral and longitudinal movements. An X-ray image-receiving device such as an X-ray image intensifier is mounted above the table on a vertically movable arm which is on a longitudinally movable carriage. Electric control means are provided for angulating the X-ray source and image intensifier synchronously as the image intensifier system is shifted longitudinally or vertically such that the central ray from the X-ray source is kept intensifier

  16. CAN ULTRAHIGH-ENERGY COSMIC RAYS COME FROM GAMMA-RAY BURSTS? COSMIC RAYS BELOW THE ANKLE AND GALACTIC GAMMA-RAY BURSTS

    International Nuclear Information System (INIS)

    Eichler, David; Pohl, Martin

    2011-01-01

    The maximum cosmic-ray energy achievable by acceleration by a relativistic blast wave is derived. It is shown that forward shocks from long gamma-ray bursts (GRBs) in the interstellar medium accelerate protons to large enough energies, and have a sufficient energy budget, to produce the Galactic cosmic-ray component just below the ankle at 4 x 10 18 eV, as per an earlier suggestion. It is further argued that, were extragalactic long GRBs responsible for the component above the ankle as well, the occasional Galactic GRB within the solar circle would contribute more than the observational limits on the outward flux from the solar circle, unless an avoidance scenario, such as intermittency and/or beaming, allows the present-day local flux to be less than 10 -3 of the average. Difficulties with these avoidance scenarios are noted.

  17. X-RAY AND GAMMA-RAY FLASHES FROM TYPE Ia SUPERNOVAE?

    International Nuclear Information System (INIS)

    Hoeflich, Peter; Schaefer, Bradley E.

    2009-01-01

    We investigate two potential mechanisms that will produce X-ray and γ-ray flashes from Type Ia supernovae (SN-Ia). The first mechanism is the breakout of the thermonuclear burning front as it reaches the surface of the white dwarf (WD). The second mechanism is the interaction of the rapidly expanding envelope with material within an accretion disk in the progenitor system. Our study is based on the delayed detonation scenario because this can account for the majority of light curves, spectra, and statistical properties of 'Branch-normal' SN-Ia. Based on detailed radiation-hydro calculations which include nuclear networks, we find that both mechanisms produce brief flashes of high-energy radiation with peak luminosities of 10 48 -10 50 erg s -1 . The breakout from the WD surface produces flashes with a rapid exponential decay by 3-4 orders of magnitude on timescales of a few tenths of a second and with most of the radiation in the X-ray and soft γ-ray range. The shocks produced in gases in and around the binary will produce flashes with a characteristic duration of a few seconds with most of the radiation coming out as X-rays and γ-rays. In both mechanisms, we expect a fast rise and slow decline and, after the peak, an evolution from hard to softer radiation due to adiabatic expansion. In many cases, flashes from both mechanisms will be superposed. The X- and γ-ray visibility of an SN-Ia will depend strongly on self-absorption within the progenitor system, specifically on the properties of the accretion disk and its orientation toward the observer. Such X-ray and γ-ray flashes could be detected as triggered events by gamma-ray burst (GRB) detectors on satellites, with events in current GRB catalogs. We have searched through the GRB catalogs (for the BATSE, HETE, and Swift experiments) for GRBs that occur at the extrapolated time of explosion and in the correct direction for known Type Ia supernovae with radial velocity of less than 3000 km s -1 . For the Burst

  18. X-ray holography

    International Nuclear Information System (INIS)

    Faigel, G.; Tegze, M.; Belakhovsky, M.; Marchesini, S.; Bortel, G.

    2003-01-01

    In the last decade holographic methods using hard X-rays were developed. They are able to resolve atomic distances, and can give the 3D arrangement of atoms around a selected element. Therefore, hard X-ray holography has potential applications in chemistry, biology and physics. In this article we give a general description of these methods and discuss the developments in the experimental technique. The capabilities of hard X-ray holography are demonstrated by examples

  19. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... x-rays. top of page What does the equipment look like? The equipment typically used for bone x-rays consists of ... and joint abnormalities, such as arthritis. X-ray equipment is relatively inexpensive and widely available in emergency ...

  20. Wide-area phase-contrast X-ray imaging using large X-ray interferometers

    Energy Technology Data Exchange (ETDEWEB)

    Momose, Atsushi E-mail: momose@exp.t.u-tokyo.ac.jp; Takeda, Tohoru; Yoneyama, Akio; Koyama, Ichiro; Itai, Yuji

    2001-07-21

    Large X-ray interferometers are developed for phase-contrast X-ray imaging aiming at medical applications. A monolithic X-ray interferometer and a separate one are studied, and currently a 25 mmx20 mm view area can be generated. This paper describes the strategy of our research program and some recent developments.

  1. Wide-area phase-contrast X-ray imaging using large X-ray interferometers

    Science.gov (United States)

    Momose, Atsushi; Takeda, Tohoru; Yoneyama, Akio; Koyama, Ichiro; Itai, Yuji

    2001-07-01

    Large X-ray interferometers are developed for phase-contrast X-ray imaging aiming at medical applications. A monolithic X-ray interferometer and a separate one are studied, and currently a 25 mm×20 mm view area can be generated. This paper describes the strategy of our research program and some recent developments.

  2. A constraint on prompt supernova cosmic ray production from γ-ray observations

    International Nuclear Information System (INIS)

    Morfill, G.E.; Drury, L.O'C.

    1981-01-01

    The consequences of prompt cosmic ray production intrinsic to supernovae are examined for supernova explosions occurring in dense molecular clouds. For reasonable parameters it is shown that prompt cosmic ray production cannot exceed 10 48 erg per supernova. This suggests that cosmic ray production takes place mainly in the intercloud medium. (author)

  3. Chest X-Ray (Chest Radiography)

    Science.gov (United States)

    ... Resources Professions Site Index A-Z X-ray (Radiography) - Chest Chest x-ray uses a very small dose ... Radiography? What is a Chest X-ray (Chest Radiography)? The chest x-ray is the most commonly performed diagnostic ...

  4. X-ray electromagnetic application technology

    International Nuclear Information System (INIS)

    2011-01-01

    The investigating committee aimed at research on electromagnetic fields in functional devices and X-ray fibers for efficient coherent X-ray generation and their material science, high-precision manufacturing, particularly for X-ray electromagnetic application technology from January 2006 to December 2008. In this report, we describe our research results, in particular, on the topics of synchrotron radiation and free-electron laser, Saga Synchrotron Project, X-ray waveguides and waveguide-based lens-less hard-X-ray imaging, X-ray nanofocusing for capillaries and zone plates, dispersion characteristics in photonics crystal consisting of periodic atoms for nanometer waveguides, electromagnetic characteristics of grid structures for scattering fields of nano-meter electromagnetic waves and X-rays, FDTD parallel computing of fundamental scattering and attenuation characteristics of X-ray for medical imaging diagnosis, orthogonal relations of electromagnetic fields including evanescent field in dispersive medium. (author)

  5. High-speed X-ray topography

    International Nuclear Information System (INIS)

    Eckers, W.; Oppolzer, H.

    1977-01-01

    The investigation of lattice defects in semiconductor crystals by conventional X-ray diffraction topography is very time-consuming. Exposure times can be reduced by using high-intensity X-rays and X-ray image intensifiers. The described system comprises a high-power rotating-anode X-ray tube, a remote-controlled X-ray topography camera, and a television system operating with an X-ray sensing VIDICON. System performance is demonstrated with reference to exploratory examples. The exposure time for photographic plates is reduced to 1/20 and for the X-ray TV system (resolution of the order of 30 μm) to 1/100 relative to that required when using a conventional topography system. (orig.) [de

  6. Effects of X-ray tube parameters on thickness measure precision in X-ray profile gauge

    International Nuclear Information System (INIS)

    Miao Jichen; Wu Zhifang; Xing Guilai

    2011-01-01

    Instantaneous profile gauge technology has been widely used in metallurgy industry because it can on-line get the profile of steel strip. It has characters of high measure precision and wide measure range, but the X-ray tube parameters only can be set few different values during measurement. The relations of thickness measure precision and X-ray tube current, X-ray tube voltage were analyzed. The results show that the X-ray tube current affects the thickness measure precision and the X-ray tube voltage determines the thickness measure range. The method of estimating the X-ray current by thickness measure precision was provided in the end. This method is the base of X-ray source selection and X-ray source parameter's setting in the instantaneous profile gauge. (authors)

  7. Constraints on the galactic distribution of cosmic rays from the COS-B gamma-ray data

    International Nuclear Information System (INIS)

    1985-08-01

    The velocity information of the HI and CO observations is used as a distance indicator to ascertain the spatial distribution of the interstellar gas. Using this distance information, the galacto-centric distribution of the gamma-ray emissivity (the production rate per H atom) is determined for three gamma-ray energy ranges from a correlation study of the gamma-ray intensity maps and the gas-tracer maps for selected galacto-centric distance intervals, taking into account the expected IC contribution and pointlike gamma-ray sources. On the assumption that unresolved gamma-ray point sources do not contribute significantly to the observed gamma-ray emission, the gamma-ray emissivity is proportional to the Cosmic ray density and, more specifically, the energy dependence can be used to study separately the distribution of Cosmic ray electrons and nuclei: whereas the emission for the 300 MeV - 5 GeV range is dominated by π 0 -decay, the 70 MeV - 150 MeV range has a large electron bremsstrahlung contribution

  8. Legal directives in the X-ray regulation for the field of X-ray diagnostics

    International Nuclear Information System (INIS)

    Huhn, Walter

    2012-01-01

    The operation of each X-ray device is subject to the requirements of the X-ray regulations (RoeV); for different operational modes or applications like curative diagnostics, X-ray serial examinations, X-ray radiotherapy and teleradiology different directives exist and have to be respected. The report discusses the issues licensing and notification procedures, radiation protection representative, requirements for the commissioning (teleradiology, serial X.ray examinations), technical qualification and radiation protection knowledge of physicians, technical qualification of the assistant personnel.

  9. High energy X-ray observations of COS-B gamma-ray sources from OSO-8

    Science.gov (United States)

    Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.; Caraveo, P. A.

    1985-01-01

    During the three years between satellite launch in June 1975 and turn-off in October 1978, the high energy X-ray spectrometer on board OSO-8 observed nearly all of the COS-B gamma-ray source positions given in the 2CG catalog (Swanenburg et al., 1981). An X-ray source was detected at energies above 20 keV at the 6-sigma level of significance in the gamma-ray error box containing 2CG342 - 02 and at the 3-sigma level of significance in the error boxes containing 2CG065 + 00, 2CG195 + 04, and 2CG311 - 01. No definite association between the X-ray and gamma-ray sources can be made from these data alone. Upper limits are given for the 2CG sources from which no X-ray flux was detected above 20 keV.

  10. Shield device for controlling the dose of x-rays applied in an x-ray machine

    International Nuclear Information System (INIS)

    Charrier, P.

    1983-01-01

    This invention provides an improved shield for use with an x-ray machine. The shield can control the dose of x-rays applied by the machine in different areas without affecting the power of the x-rays. This is achieved with a shield especially designed and positioned to intercept with x-rays for longer or shorter periods in different areas during the taking of the picture, but not for the whole period of time necessary for taking this picture. Each area of the subject being x-rayed is exposed to full power x-rays. However, owing to the shield, the areas that require smaller dose receive these full power x-rays for a shorter portion of the time required to take the picture while the other areas that require larger dose of x-rays, receive the full power x-rays for a longer portion of the full period of time required to take the picture. To ensure this differential exposure, the shield is placed through the path of the x-rays and rotated about an axis which is generally transverse to the direction of travel of the x-rays to cut out some of said x-rays for different portions of the period of time necessary for taking the picture. The shield is preferably shaped to intercept x-rays for a longer period in some areas than in others depending on the required doses. A plurality of differently shaped shields can be provided to suit different picture taking situations

  11. X-Ray Exam: Cervical Spine

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Cervical Spine KidsHealth / For Parents / X-Ray ... MRI): Lumbar Spine Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  12. Synthetic small molecules as machines: a chemistry perspective

    Indian Academy of Sciences (India)

    PGhosh

    2017-07-01

    Jul 1, 2017 ... Indian Association for the Cultivation of Science. 2A & 2B Raja S. C. ... Many research groups reported in the 1950s and 1960s that their reaction .... A molecular-level machine can be defined as “an assembly of a distinct ...

  13. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Fellowship; Associateship. Associate Profile. Period: 2010–2013. Bhattacharyya, Suvendra Nath. Date of birth: 4 October 1975. Address during Associateship: Molecular & Human Genetics Unit, IICB, 4, Raja SC Mullick Road, Kolkata 700 032. Contact: Email: suvendra@iicb.res.in. YouTube; Twitter; Facebook; Blog ...

  14. Mandal, Dr Chitra

    Indian Academy of Sciences (India)

    Address: Distinguished Biotechnology Research Professor, Indian Institute of Chemical Biology, 4, Raja SC Mullick Road, Jadavpur, Kolkata 700 032, W.B.. Contact: Office: (033) 2429 8861. Mobile: 98310 36964. Fax: (033) 2473 5197. Email: chitra_mandal@yahoo.com, cmandal@iicb.res.in. YouTube; Twitter; Facebook ...

  15. Optimization of transfer of laser-cooled atom cloud to a quadrupole ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... Laser Physics Applications Section, Raja Ramanna Centre for Advanced Technology,. Indore 452 013 ... Laser cooling; optical molasses; double-MOT; magnetic trapping; phase-space density. PACS Nos 52.55. ... this method, the transfer of laser-cooled atom cloud to magnetic trap is an important step,.

  16. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. A Sakthivel. Articles written in Journal of Chemical Sciences. Volume 119 Issue 4 July 2007 pp 303-310. Synthesis, spectral characterization of Schiff base transition metal complexes: DNA cleavage and antimicrobial activity studies · N Raman J Dhaveethu Raja A Sakthivel.

  17. First report of alternaria leaf spot of banana caused by Alternaria alternata in the United States

    Science.gov (United States)

    Research efforts were initiated in 2003 to identify and introduce banana (Musa spp.) cultivars suitable for production in Georgia. In spring and summer 2012, seven of the cultivars (Veinte Cohol, Novaria, Cacambou, Chinese Cavendish, Raja Puri, Blue Torres Island, and African Red) grown in the field...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    https://www.ias.ac.in/article/fulltext/reso/010/11/0027-0041. Keywords. Smart structures; adaptronic structures; biomimetics; evolution of machines; smart materials. Author Affiliations. V K Wadhawan1. Raja Ramanna Fellow 2/111/H, Modular laboratories Solid State Physics Division Bhabha Atomic Research Centre Mumbai ...

  19. Maailma kaunid aiad : Nymans'i aed / Ann Tenno

    Index Scriptorium Estoniae

    Tenno, Ann, 1952-

    2004-01-01

    Nymans'i aia Inglismaal rajas 1885. a. Ludwig Messel ning kujundas seda koos oma poja Leonard Messeliga. Aed on tuntud haruldaste puude ja põõsaste rohkuse poolest, aia omapäraks on kerakujuliseks pöetud ja väljalõigatud siiludega jugapuud. 19 ill

  20. Adhya, Dr Samit

    Indian Academy of Sciences (India)

    Elected: 1999 Section: General Biology. Adhya, Dr Samit Ph.D. (New York), FNA. Date of birth: 29 September 1953. Specialization: Mitochondrial Biology, Molecular Genetics of Parasites, Intracellular RNA Trafficking and DNA Diagnostics Address: CSIR Emeritus Scientist, Indian Inst. of Chemical Biology, 4, Raja S.C. ...

  1. Differences of X-ray exposure between X-ray diagnostics with a conventional X-ray screen-system and with an image-intensifier-television-unit

    International Nuclear Information System (INIS)

    Loehr, H.; Vogel, H.; Reinhart, J.; Jantzen, R.

    1977-01-01

    During X-ray diagnostics of patients in the II. Medizinische Poliklinik the X-ray exposure was determined. It corresponded to the data described in literature. Two groups were compared: 518 patients examined with a conventional X-ray screen-system and 642 patients examined with an image-intensifier-television-system. The results demonstrated that with exception of thoracical X-ray examination the replacing of the old system by the television system brought a remarkable increase of the X-ray exposure. The doses depended of the patients constitution to a high degree. (orig.) [de

  2. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... X-rays are a form of radiation like light or radio waves. X-rays pass through most objects, including the body. Once it is carefully aimed at the part of the body being examined, an x-ray machine produces a small ...

  3. X-Ray Exam: Hip

    Science.gov (United States)

    ... for Educators Search English Español X-Ray Exam: Hip KidsHealth / For Parents / X-Ray Exam: Hip What's in this article? What It Is Why ... You Have Questions Print What It Is A hip X-ray is a safe and painless test ...

  4. X-Ray Exam: Ankle

    Science.gov (United States)

    ... for Educators Search English Español X-Ray Exam: Ankle KidsHealth / For Parents / X-Ray Exam: Ankle What's in this article? What It Is Why ... You Have Questions Print What It Is An ankle X-ray is a safe and painless test ...

  5. Compound refractive X-ray lens

    International Nuclear Information System (INIS)

    Nygren, D.R.; Cahn, R.; Cederstrom, B.; Danielsson, M.; Vestlund, J.

    2000-01-01

    An apparatus and method are disclosed for focusing X-rays. In one embodiment, his invention is a commercial-grade compound refractive X-ray lens. The commercial-grade compound refractive X-ray lens includes a volume of low-Z material. The volume of low-Z material has a first surface which is adapted to receive X-rays of commercially-applicable power emitted from a commercial-grade X-ray source. The volume of low-Z material also has a second surface from which emerge the X-rays of commercially-applicable power which were received at the first surface. Additionally, the commercial-grade compound refractive X-ray lens includes a plurality of openings which are disposed between the first surface and the second surface. The plurality of openings are oriented such that the X-rays of commercially-applicable power which are received at the first surface, pass through the volume of low-Z material and through the plurality openings. In so doing, the X-rays which emerge from the second surface are refracted to a focal point

  6. Compound refractive X-ray lens

    Science.gov (United States)

    Nygren, David R.; Cahn, Robert; Cederstrom, Bjorn; Danielsson, Mats; Vestlund, Jonas

    2000-01-01

    An apparatus and method for focusing X-rays. In one embodiment, his invention is a commercial-grade compound refractive X-ray lens. The commercial-grade compound refractive X-ray lens includes a volume of low-Z material. The volume of low-Z material has a first surface which is adapted to receive X-rays of commercially-applicable power emitted from a commercial-grade X-ray source. The volume of low-Z material also has a second surface from which emerge the X-rays of commercially-applicable power which were received at the first surface. Additionally, the commercial-grade compound refractive X-ray lens includes a plurality of openings which are disposed between the first surface and the second surface. The plurality of openings are oriented such that the X-rays of commercially-applicable power which are received at the first surface, pass through the volume of low-Z material and through the plurality openings. In so doing, the X-rays which emerge from the second surface are refracted to a focal point.

  7. Feasibility of using continuous X-ray to simulate cable response under X-ray environment

    International Nuclear Information System (INIS)

    Ma Liang; Zhou Hui; Cheng Yinhui; Wu Wei; Li Jinxi; Zhao Mo; Guo Jinghai

    2014-01-01

    The mechanism and simulating method of cable response induced by X-ray were researched, and the relationship of cable response irradiated by continuous and pulsed X-ray was analyzed. A one-dimension model of strip line irradiation response of X-ray was given, which includes the gap between cable shield and dielectric, and induced conductivity in cable dielectric. The calculation result using the model indicates that the cable responses of continuous and rectangular-pulsed X-ray have the similar current waveform and the same gap voltages. Therefore, continuous X-ray can be used to research some cable responses of pulsed X-ray irradiation under the mechanism described in the one-dimension model. (authors)

  8. Effect of Electric Voltage and Current of X-ray Chamber on the Element inthe Zirconium Alloy Analysis X-ray by X-ray Fluorescence

    International Nuclear Information System (INIS)

    Yusuf-Nampira; Narko-Wibowo, L; Rosika-Krisnawati; Nudia-Barenzani

    2000-01-01

    The using of x-ray fluorescence in the chemical analysis depend heavilyon the parameters of x-ray chamber, for examples : electric voltage andelectric current. That parameter give effect in the result of determine ofSn, Cr, Fe and Ni in the zirconium alloy. 20 kV electric voltages are used onthe Mo x-ray chamber shall product x-ray of zirconium in the sample materialcan give effect in the stability of the analysis result (deviation more than5%). The result of analysis of elements in the zirconium alloy shall givedeviation less than 5% when using of electric voltage of the x-ray chamberless than 19 kV. The sensitivity of analysis can be reached by step upelectric current of x-ray chamber. (author)

  9. X-ray hot plasma diagnostics

    International Nuclear Information System (INIS)

    Cojocaru, E.

    1984-11-01

    X-ray plasma emission study is powerful diagnostic tool of hot plasmas. In this review article the main techniques of X-ray plasma emission measurement are shortly presented: X-ray spectrometry using absorbent filters, crystal and grating spectrometers, imaging techniques using pinhole cameras, X-ray microscopes and Fresnel zone plate cameras, X-ray plasma emission calorimetry. Advances in these techniques with examples for different hot plasma devices are also presentes. (author)

  10. X-ray diffraction device comprising cooling medium connections provided on the x-ray tube

    NARCIS (Netherlands)

    1996-01-01

    An X-ray diffraction device comprises a water-cooled X-ray tube which exhibits a line focus as well as, after rotation through 90 DEG , a point focus. Contrary to customary X-ray tubes, the cooling water is not supplied via the housing (12) in which the X-ray tube is mounted, but the cooling water

  11. Soft x-ray streak cameras

    International Nuclear Information System (INIS)

    Stradling, G.L.

    1988-01-01

    This paper is a discussion of the development and of the current state of the art in picosecond soft x-ray streak camera technology. Accomplishments from a number of institutions are discussed. X-ray streak cameras vary from standard visible streak camera designs in the use of an x-ray transmitting window and an x-ray sensitive photocathode. The spectral sensitivity range of these instruments includes portions of the near UV and extends from the subkilovolt x- ray region to several tens of kilovolts. Attendant challenges encountered in the design and use of x-ray streak cameras include the accommodation of high-voltage and vacuum requirements, as well as manipulation of a photocathode structure which is often fragile. The x-ray transmitting window is generally too fragile to withstand atmospheric pressure, necessitating active vacuum pumping and a vacuum line of sight to the x-ray signal source. Because of the difficulty of manipulating x-ray beams with conventional optics, as is done with visible light, the size of the photocathode sensing area, access to the front of the tube, the ability to insert the streak tube into a vacuum chamber and the capability to trigger the sweep with very short internal delay times are issues uniquely relevant to x-ray streak camera use. The physics of electron imaging may place more stringent limitations on the temporal and spatial resolution obtainable with x-ray photocathodes than with the visible counterpart. Other issues which are common to the entire streak camera community also concern the x-ray streak camera users and manufacturers

  12. X-ray spectral meter of high voltages for X-ray apparatuses

    International Nuclear Information System (INIS)

    Zubkov, I.P.; Larchikov, Yu.V.

    1993-01-01

    Design of the X-ray spectral meter of high voltages (XRSMHV) for medical X-ray apparatuses permitting to conduct the voltage measurements without connection to current circuits. The XRSMHV consists of two main units: the detector unit based on semiconductor detector and the LP4900B multichannel analyzer (Afora, Finland). The XRSMYV was tested using the pilot plant based on RUM-20 X-ray diagnostic apparatus with high-voltage regulator. It was shown that the developed XRSMHV could be certify in the range of high constant voltages form 40 up to 120 kV with the basic relative error limits ±0.15%. The XRSMHV is used at present as the reference means for calibration of high-voltage medical X-ray equipment

  13. X ray Production. Chapter 5

    Energy Technology Data Exchange (ETDEWEB)

    Nowotny, R. [Medical University of Vienna, Vienna (Austria)

    2014-09-15

    The differential absorption of X rays in tissues and organs, owing to their atomic composition, is the basis for the various imaging methods used in diagnostic radiology. The principles in the production of X rays have remained the same since their discovery. However, much refinement has gone into the design of X ray tubes to achieve the performance required for today’s radiological examinations. In this chapter, an outline of the principles of X ray production and a characterization of the radiation output of X ray tubes will be given. The basic processes producing X rays are dealt with in Section 1.4.

  14. Illumination system for X-ray lithography

    International Nuclear Information System (INIS)

    Buckley, W.D.

    1989-01-01

    An X-ray lithography system is described, comprising: a point source of X-Ray radiation; a wafer plane disposed in spaced relation to the point source of X-Ray radiation; a mask disposed between the point source of X-Ray radiation and the wafer plane whereby X-Ray radiation from the point source of X-ray radiation passes through the mask to the water plane; and X-Ray absorbent means mounted between the point source of X-Ray radiation and the wafer plane, the X-Ray absorbent means being of quadratically absorption from maximum absorption at the center to minimum absorption at the edge so as to have a radial absorption gradient profile to compensate for radial flux variation of the X-Ray radiation

  15. Cosmic Connections:. from Cosmic Rays to Gamma Rays, Cosmic Backgrounds and Magnetic Fields

    Science.gov (United States)

    Kusenko, Alexander

    2013-12-01

    Combined data from gamma-ray telescopes and cosmic-ray detectors have produced some new surprising insights regarding intergalactic and galactic magnetic fields, as well as extragalactic background light. We review some recent advances, including a theory explaining the hard spectra of distant blazars and the measurements of intergalactic magnetic fields based on the spectra of distant sources. Furthermore, we discuss the possible contribution of transient galactic sources, such as past gamma-ray bursts and hypernova explosions in the Milky Way, to the observed ux of ultrahigh-energy cosmicrays nuclei. The need for a holistic treatment of gamma rays, cosmic rays, and magnetic fields serves as a unifying theme for these seemingly unrelated phenomena.

  16. Portable X-ray fluorescence analyzer of high sensitivity using X-ray tube excitation

    International Nuclear Information System (INIS)

    Vatai, E.; Ando, L.

    1982-01-01

    A review of the three main methods of X-ray fluorescence analysis and their problems is given. The attainable accuracy and effectiveness of each method are discussed. The main properties of portable X-ray analyzers required by the industry are described. The results and experiences of R and D activities in ATOMKI (Debrecen, Hungary) for developing portable X-ray analyzers are presented. The only way for increasing the accuracy and decreasing the measuring time is the application of X-ray tube excitation instead of radioactive sources. The new ATOMKI equipment presently under construction and patenting uses X-ray tube excitation; it will increase the accuracy of concentration determination by one order of magnitude. (D.Gy.)

  17. On evolutionary ray-projection dynamics

    NARCIS (Netherlands)

    Joosten, Reinoud A.M.G.; Roorda, Berend

    2011-01-01

    We introduce the ray-projection dynamics in evolutionary game theory by employing a ray projection of the relative fitness (vector) function, i.e., a projection unto the unit simplex along a ray through the origin. Ray-projection dynamics are weakly compatible in the terminology of Friedman

  18. Cosmic ray diffusion: report of the workshop in cosmic ray diffusion theory

    International Nuclear Information System (INIS)

    Birmingham, T.J.; Jones, F.C.

    1975-02-01

    A workshop in cosmic ray diffusion theory was held at Goddard Space Flight Center on May 16-17, 1974. Topics discussed and summarized are: (1) cosmic ray measurements as related to diffusion theory; (2) quasi-linear theory, nonlinear theory, and computer simulation of cosmic ray pitch-angle diffusion; and (3) magnetic field fluctuation measurements as related to diffusion theory. (auth)

  19. Calculation of cosmic ray induced single event upsets: Program CRUP (Cosmic Ray Upset Program)

    Science.gov (United States)

    Shapiro, P.

    1983-09-01

    This report documents PROGRAM CRUP, COSMIC RAY UPSET PROGRAM. The computer program calculates cosmic ray induced single-event error rates in microelectronic circuits exposed to several representative cosmic-ray environments.

  20. Chest X-Ray

    Medline Plus

    Full Text Available ... some concerns about chest x-rays. However, it’s important to consider the likelihood of benefit to your health. While a chest x-ray use a ... posted: How to Obtain and Share ...

  1. A laboratory-based hard x-ray monochromator for high-resolution x-ray emission spectroscopy and x-ray absorption near edge structure measurements

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, G. T., E-mail: seidler@uw.edu; Mortensen, D. R.; Remesnik, A. J.; Pacold, J. I.; Ball, N. A.; Barry, N.; Styczinski, M.; Hoidn, O. R. [Physics Department, University of Washington, Seattle, Washington 98195-1560 (United States)

    2014-11-15

    We report the development of a laboratory-based Rowland-circle monochromator that incorporates a low power x-ray (bremsstrahlung) tube source, a spherically bent crystal analyzer, and an energy-resolving solid-state detector. This relatively inexpensive, introductory level instrument achieves 1-eV energy resolution for photon energies of ∼5 keV to ∼10 keV while also demonstrating a net efficiency previously seen only in laboratory monochromators having much coarser energy resolution. Despite the use of only a compact, air-cooled 10 W x-ray tube, we find count rates for nonresonant x-ray emission spectroscopy comparable to those achieved at monochromatized spectroscopy beamlines at synchrotron light sources. For x-ray absorption near edge structure, the monochromatized flux is small (due to the use of a low-powered x-ray generator) but still useful for routine transmission-mode studies of concentrated samples. These results indicate that upgrading to a standard commercial high-power line-focused x-ray tube or rotating anode x-ray generator would result in monochromatized fluxes of order 10{sup 6}–10{sup 7} photons/s with no loss in energy resolution. This work establishes core technical capabilities for a rejuvenation of laboratory-based hard x-ray spectroscopies that could have special relevance for contemporary research on catalytic or electrical energy storage systems using transition-metal, lanthanide, or noble-metal active species.

  2. Applications of phase-contrast x-ray imaging to medicine using an x-ray interferometer

    Science.gov (United States)

    Momose, Atsushi; Yoneyama, Akio; Takeda, Tohoru; Itai, Yuji; Tu, Jinhong; Hirano, Keiichi

    1999-10-01

    We are investigating possible medical applications of phase- contrast X-ray imaging using an X-ray interferometer. This paper introduces the strategy of the research project and the present status. The main subject is to broaden the observation area to enable in vivo observation. For this purpose, large X-ray interferometers were developed, and 2.5 cm X 1.5 cm interference patterns were generated using synchrotron X-rays. An improvement of the spatial resolution is also included in the project, and an X-ray interferometer designed for high-resolution phase-contrast X-ray imaging was fabricated and tested. In parallel with the instrumental developments, various soft tissues are observed by phase- contrast X-ray CT to find correspondence between the generated contrast and our histological knowledge. The observation done so far suggests that cancerous tissues are differentiated from normal tissues and that blood can produce phase contrast. Furthermore, this project includes exploring materials that modulate phase contrast for selective imaging.

  3. X-ray apparatus

    International Nuclear Information System (INIS)

    Sell, L.J.

    1981-01-01

    A diagnostic x-ray device, readily convertible between conventional radiographic and tomographic operating modes, is described. An improved drive system interconnects and drives the x-ray source and the imaging device through coordinated movements for tomography

  4. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... The x-ray tube is connected to a flexible arm that is extended over the patient while an x-ray film holder or image recording plate is placed beneath the patient. top of page How does the procedure work? X-rays are a form of radiation like ...

  5. Comparative study of radiation dose between digital panoramic X-ray unit and general panoramic X-ray unit

    International Nuclear Information System (INIS)

    Li Qingshan; Duan Tao; Wang Xiaoyun; Zhao Li; Dong Jian; Wei Lei

    2010-01-01

    Objective: To compare the actual dose of patients who receive the same medical practice by either digital panoramic X-ray unit and general panoramic X-ray unit and give evidence for better selection of oral X-ray examination method. Methods: Round sheet lithium fluoride (LiF) thermoluminescent dosimeters (TLD) were used. The experiment was divided into natural background contrast group, general panoramic X-ray children group, general panoramic X-ray adults group, digital panoramic X-ray children group and digital panoramic X-ray adults group. The dosimeter of natural background radiation was placed at the office of the doctor, the dosimeters of general panoramic X-ray children group and general panoramic X-ray adults group were irradiated by different conditions according to the clinical application of panoramic X-ray to children and adults, the dosimeters of digital panoramic X-ray children group and digital panoramic X-ray adults group were irradiated by different conditions according to the clinical application of digital panoramic X-ray to children and adults. The thermoluminescent dosimeter was used to count and calculate the exposure doses in various groups. Results: The dose of children exposed in general panoramic X-ray unit was 1.28 times of that in digital panoramic X-ray unit, there was significant difference (t=6.904, P<0.01). The dose of adults exposed in general panoramic X-ray unit was 1.55 times of that in the digital panoramic X-ray unit, there also was significant difference (t=-11.514. P< 0.01). Conclusion: The digital panoramic X-ray unit can reduce the dose of patients, so the digital panoramic X-ray unit should be used as far as possible. (authors)

  6. X-ray or UV-ray imaging sensor utilizing optically stimulated luminescence phenomenon in Eu-doped KCl phosphors

    International Nuclear Information System (INIS)

    Nanto, Hidehito; Murayama, Kazuhiko; Hirai, Yoshiaki; Taniguchi, Shin-ichi; Makamura, Shouichi; Takeuchi, Nozomu.

    1993-01-01

    An intense OSL with a peak at about 420 [nm] has been observed by stimulating an X-ray or UV-ray irradiated KCl: Eu crystal with F-band light whose wavelength is about 560 [um]. A possible excitation and emission mechanisms for the 420 [um] OSL peak X-ray or UV-ray irradiated sample is proposed. It is found that the OSL intensity is proportional to the X-ray absorbed dose or UV-ray irradiation dose. It is also found that X-ray or UV-ray irradiated KCl; Eu exhibited excellent fading characteristics. These results strongly suggest that the KCl: Eu is one of the most attractive candidates for two-dimensional X-ray or UV-ray imaging sensor utilizing the OSL phenomenon. (J.P.N.)

  7. Phase-contrast X-ray CT

    Energy Technology Data Exchange (ETDEWEB)

    Momose, Atsushi [Hitachi Ltd., Saitama (Japan). Advanced Research Laboratory; Takeda, Tohoru; Itai, Yuji

    1995-12-01

    Phase-contrast X-ray computed tomography (CT) enabling the observation of biological soft tissues without contrast enhancement has been developed. The X-ray phase shift caused by an object is measured and input to a standard CT reconstruction algorithm. A thousand times increase in the image sensitivity to soft tissues is achieved compared with the conventional CT using absorption contrast. This is because the X-ray phase shift cross section of light elements is about a thousand times larger than the absorption cross section. The phase shift is detected using an X-ray interferometer and computer analyses of interference patterns. Experiments were performed using a synchrotron X-ray source. Excellent image sensitivity is demonstrated in the observation of cancerous rabbit liver. The CT images distinguish cancer lesion from normal liver tissue and, moreover, visualize the pathological condition in the lesion. Although the X-ray energy employed and the present observation area size are not suitable for medical applications as they are, phase-contrast X-ray CT is promising for investigating the internal structure of soft tissue which is almost transparent for X-rays. The high sensitivity also provides the advantage of reducing X-ray doses. (author).

  8. Equipment for x- and gamma ray radiography

    International Nuclear Information System (INIS)

    Abd Nasir Ibrahim; Azali Muhammad; Ab Razak Hamzah; Abd Aziz Mohamed; Mohammad Pauzi Ismail

    2004-01-01

    The following topics related to the equipment for x - and gamma ray radiography are discussed in this chapter. The topics are x-ray source for Industrial Radiography: properties of x-ray, generation of x-ray, mechanism of x-ray production, x-ray equipment, power supply, distribution of x-ray intensity along the tube: gamma ray source for Industrial Radiography: properties of gamma rays, gamma ray sources, gamma ray projectors on cameras, source changing. Care of Radiographic Equipments: Merits and Demerits of x and Gamma Rays

  9. Symbiotic Stars in X-rays

    Science.gov (United States)

    Luna, G. J. M.; Sokoloski, J. L.; Mukai, K.; Nelson, T.

    2014-01-01

    Until recently, symbiotic binary systems in which a white dwarf accretes from a red giant were thought to be mainly a soft X-ray population. Here we describe the detection with the X-ray Telescope (XRT) on the Swift satellite of 9 white dwarf symbiotics that were not previously known to be X-ray sources and one that was previously detected as a supersoft X-ray source. The 9 new X-ray detections were the result of a survey of 41 symbiotic stars, and they increase the number of symbiotic stars known to be X-ray sources by approximately 30%. Swift/XRT detected all of the new X-ray sources at energies greater than 2 keV. Their X-ray spectra are consistent with thermal emission and fall naturally into three distinct groups. The first group contains those sources with a single, highly absorbed hard component, which we identify as probably coming from an accretion-disk boundary layer. The second group is composed of those sources with a single, soft X-ray spectral component, which likely arises in a region where low-velocity shocks produce X-ray emission, i.e. a colliding-wind region. The third group consists of those sources with both hard and soft X-ray spectral components. We also find that unlike in the optical, where rapid, stochastic brightness variations from the accretion disk typically are not seen, detectable UV flickering is a common property of symbiotic stars. Supporting our physical interpretation of the two X-ray spectral components, simultaneous Swift UV photometry shows that symbiotic stars with harder X-ray emission tend to have stronger UV flickering, which is usually associated with accretion through a disk. To place these new observations in the context of previous work on X-ray emission from symbiotic stars, we modified and extended the alpha/beta/gamma classification scheme for symbiotic-star X-ray spectra that was introduced by Muerset et al. based upon observations with the ROSAT satellite, to include a new sigma classification for sources with

  10. X-ray Absorption Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Yano, Junko; Yachandra, Vittal K.

    2009-07-09

    This review gives a brief description of the theory and application of X-ray absorption spectroscopy, both X-ray absorption near edge structure (XANES) and extended X-ray absorption fine structure (EXAFS), especially, pertaining to photosynthesis. The advantages and limitations of the methods are discussed. Recent advances in extended EXAFS and polarized EXAFS using oriented membranes and single crystals are explained. Developments in theory in understanding the XANES spectra are described. The application of X-ray absorption spectroscopy to the study of the Mn4Ca cluster in Photosystem II is presented.

  11. Applied gamma-ray spectrometry

    CERN Document Server

    Dams, R; Crouthamel, Carl E

    1970-01-01

    Applied Gamma-Ray Spectrometry covers real life application of the gamma-ray and the devices used in their experimental studies. This book is organized into 9 chapters, and starts with discussions of the various decay processes, the possible interaction mechanisms of gamma radiation with matter, and the intrinsic and extrinsic variables, which affect the observed gamma-ray and X-ray spectra. The subsequent chapters deal with the properties and fabrication of scintillation detectors, semiconductor detectors, and proportional gas counters. These chapters present some of the most widely utilized

  12. High energy cosmic rays

    CERN Document Server

    Stanev, Todor

    2010-01-01

    Offers an accessible text and reference (a cosmic-ray manual) for graduate students entering the field and high-energy astrophysicists will find this an accessible cosmic-ray manual Easy to read for the general astronomer, the first part describes the standard model of cosmic rays based on our understanding of modern particle physics. Presents the acceleration scenario in some detail in supernovae explosions as well as in the passage of cosmic rays through the Galaxy. Compares experimental data in the atmosphere as well as underground are compared with theoretical models

  13. X-ray filtration apparatus

    International Nuclear Information System (INIS)

    Thompson, G.

    1992-01-01

    This invention relates to an X-ray shielding support device. In spite of considerable development in X-ray taking techniques, a need still exists for effective shielding, inter alia, to compensate for variations in the thickness, density and the absorption properties of the object being studied. By appropriate shielding, the X-ray image produced is of sufficient detail, contrast and intensity over its entire area to constitute a useful diagnostic aid. It is also desirable to subject the patient to the smallest possible X-ray dosage. 4 figs

  14. X-ray - skeleton

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003381.htm X-ray - skeleton To use the sharing features on this ... Degenerative bone conditions Osteomyelitis Risks There is low radiation exposure. X-rays machines are set to provide the smallest ...

  15. Extremity x-ray

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/003461.htm Extremity x-ray To use the sharing features on this page, ... in the body Risks There is low-level radiation exposure. X-rays are monitored and regulated to provide the ...

  16. Chest X-Ray

    Medline Plus

    Full Text Available ... X-ray Transcript Welcome to Radiology Info dot org! Hello, I’m Dr. Geoffrey Rubin, a radiologist ... about chest x-rays, visit Radiology Info dot org. Thank you for your time! Spotlight Recently posted: ...

  17. ICF ignition capsule neutron, gamma ray, and high energy x-ray images

    Science.gov (United States)

    Bradley, P. A.; Wilson, D. C.; Swenson, F. J.; Morgan, G. L.

    2003-03-01

    Post-processed total neutron, RIF neutron, gamma-ray, and x-ray images from 2D LASNEX calculations of burning ignition capsules are presented. The capsules have yields ranging from tens of kilojoules (failures) to over 16 MJ (ignition), and their implosion symmetry ranges from prolate (flattest at the hohlraum equator) to oblate (flattest towards the laser entrance hole). The simulated total neutron images emphasize regions of high DT density and temperature; the reaction-in-flight neutrons emphasize regions of high DT density; the gamma rays emphasize regions of high shell density; and the high energy x rays (>10 keV) emphasize regions of high temperature.

  18. Center for X-Ray Optics, 1992

    International Nuclear Information System (INIS)

    1993-08-01

    This report discusses the following topics: Center for X-Ray Optics; Soft X-Ray Imaging wit Zone Plate Lenses; Biological X-Ray microscopy; Extreme Ultraviolet Lithography for Nanoelectronic Pattern Transfer; Multilayer Reflective Optics; EUV/Soft X-ray Reflectometer; Photoemission Microscopy with Reflective Optics; Spectroscopy with Soft X-Rays; Hard X-Ray Microprobe; Coronary Angiography; and Atomic Scattering Factors

  19. The X-ray Telescope for the SWIFT Gamma-Ray Burst Mission

    International Nuclear Information System (INIS)

    Wells, A.; Abbey, A.F.; Beardmore, A.; Mukerjee, K.; Osborne, J.P.; Watson, D.J.; Willingale, R.; Burrows, D. N.; Hill, J. E.; Nousek, J.A.; Miles, B.J.; Mori, K.; Morris, D.C.; Zugger, M.; Chincarini, G.; Campana, S.; Citterio, O.; Moretti, A.; Tagliaferri, G.; Bosworth, J.

    2004-01-01

    The X-ray Telescope (XRT) for the SWIFT mission, built by the international consortium from Pennsylvania State University (United States), University of Leicester (UK) and Osservatorio Astronomico di Brera (Italy), is already installed on the SWIFT spacecraft. The XRT has two key functions on SWIFT; to determine locations of GRBs to better than 5 arc seconds within 100 seconds of initial detection of a burst and to measure spectra and light curves of the X-ray afterglow over around four orders of magnitude of decay in the afterglow intensity. This paper summarises the XRT performance, operating modes and sensitivity for the detection of prompt and extended X-ray afterglows from gamma-ray bursts. The performance characteristics have been determined from data taken during the ground calibration campaign at MPE's Panter facility in September 2002

  20. Application of X-ray CCD camera in X-ray spot diagnosis of rod-pinch diode

    International Nuclear Information System (INIS)

    Song Yan; Zhou Ming; Song Guzhou; Ma Jiming; Duan Baojun; Han Changcai; Yao Zhiming

    2015-01-01

    The pinhole imaging technique is widely used in the measurement of X-ray spot of rod-pinch diode. The X-ray CCD camera, which was composed of film, fiber optic taper and CCD camera, was employed to replace the imaging system based on scintillator, lens and CCD camera in the diagnosis of X-ray spot. The resolution of the X-ray CCD camera was studied. The resolution is restricted by the film and is 5 lp/mm in the test with Pb resolution chart. The frequency is 1.5 lp/mm when the MTF is 0.5 in the test with edge image. The resolution tests indicate that the X-ray CCD camera can meet the requirement of the diagnosis of X-ray spot whose scale is about 1.5 mm when the pinhole imaging magnification is 0.5. At last, the image of X-ray spot was gained and the restoration was implemented in the diagnosis of X-ray spot of rod-pinch diode. (authors)

  1. Simulation study on unfolding methods for diagnostic X-rays and mixed gamma rays

    International Nuclear Information System (INIS)

    Hashimoto, Makoto; Ohtaka, Masahiko; Ara, Kuniaki; Kanno, Ikuo; Imamura, Ryo; Mikami, Kenta; Nomiya, Seiichiro; Onabe, Hideaki

    2009-01-01

    A photon detector operating in current mode that can sense X-ray energy distribution has been reported. This detector consists of a row of several segment detectors. The energy distribution is derived using an unfolding technique. In this paper, comparisons of the unfolding techniques among error reduction, spectrum surveillance, and neural network methods are discussed through simulation studies on the detection of diagnostic X-rays and gamma rays emitted by a mixture of 137 Cs and 60 Co. For diagnostic X-ray measurement, the spectrum surveillance and neural network methods appeared promising, while the error reduction method yielded poor results. However, in the case of measuring mixtures of gamma rays, the error reduction method was both sufficient and effective. (author)

  2. Chest X-Ray

    Medline Plus

    Full Text Available ... by Image/Video Gallery Your Radiologist Explains Chest X-ray Transcript Welcome to Radiology Info dot org! Hello, ... d like to talk with you about chest radiography also known as chest x-rays. Chest x- ...

  3. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II ...

    Indian Academy of Sciences (India)

    Unknown

    Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N RAMAN*, Y PITCHAIKANI RAJA and A KULANDAISAMY. Department of Chemistry, VHNSN College, Virudhunagar 626 001, India e-mail: ra_man@123india.com.

  4. Translations on Narcotics and Dangerous Drugs No. 300.

    Science.gov (United States)

    1977-05-19

    Daraluman here yesterday evening. A six-man party led by the deputy OCPD [officer in charge of police department], acting ASP [assistant super...pans. Kulim OCPD Deputy Supt Raja Lope Bin Razman said police raided an uninhabited wooden house believed to have been used as a laboratory in Jalan

  5. J Jeslin Drusila Nesamalar

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. J Jeslin Drusila Nesamalar. Articles written in Sadhana. Volume 39 Issue 2 April 2014 pp 377-390. Transaction charges allocation using sensitivity factor methodology · S Charles Raja J Jeslin Drusila Nesamalar P Venkatesh · More Details Abstract Fulltext PDF. Deregulation of the electricity ...

  6. Dasgupta, Dr Somnath

    Indian Academy of Sciences (India)

    Ph.D. (Jadavpur), FNA, FNASc, FTWAS. Date of birth: 13 October 1951. Specialization: Metamorphic Petrology, Geochemistry and Precambrian Geology Address: Westwind, Block 4, Flat 3B, 78, Raja SC Mullick Road, Kolkata 700 084, W.B.. Contact: Mobile: 98311 67145. Email: somnathdasg@gmail.com. YouTube; Twitter ...

  7. Mondal, Prof. Naba Kumar

    Indian Academy of Sciences (India)

    Mondal, Prof. Naba Kumar Ph.D. (Bombay) D.Sc. (h.c.), FNA, FNASc, FTWAS. Date of birth: 11 March 1951. Specialization: Experimental Particle Physics, Accelerator-based Particle Physics and Neutrino Physics Address: Raja Ramanna Fellow, Saha Institute of Nuclear Physics, 1/AF, Bidhan Nagar, Kolkata 700 064, W.B.

  8. X-Ray Study of Variable Gamma-Ray Pulsar PSR J2021+4026

    Science.gov (United States)

    Wang, H. H.; Takata, J.; Hu, C.-P.; Lin, L. C. C.; Zhao, J.

    2018-04-01

    PSR J2021+4026 showed a sudden decrease in the gamma-ray emission at the glitch that occurred around 2011 October 16, and a relaxation of the flux to the pre-glitch state at around 2014 December. We report X-ray analysis results of the data observed by XMM-Newton on 2015 December 20 in the post-relaxation state. To examine any change in the X-ray emission, we compare the properties of the pulse profiles and spectra at the low gamma-ray flux state and at the post-relaxation state. The phase-averaged spectra for both states can be well described by a power-law component plus a blackbody component. The former is dominated by unpulsed emission and probably originated from the pulsar wind nebula as reported by Hui et al. The emission property of the blackbody component is consistent with the emission from the polar cap heated by the back-flow bombardment of the high-energy electrons or positrons that were accelerated in the magnetosphere. We found no significant change in the X-ray emission properties between two states. We suggest that the change of the X-ray luminosity is at an order of ∼4%, which is difficult to measure with the current observations. We model the observed X-ray light curve with the heated polar cap emission, and we speculate that the observed large pulsed fraction is owing to asymmetric magnetospheric structure.

  9. Nanoparticle-Assisted Scanning Focusing X-Ray Therapy with Needle Beam X Rays.

    Science.gov (United States)

    Davidson, R Andrew; Guo, Ting

    2016-01-01

    In this work, we show a new therapeutic approach using 40-120 keV X rays to deliver a radiation dose at the isocenter located many centimeters below the skin surface several hundred times greater than at the skin and how this dose enhancement can be augmented with nanomaterials to create several thousand-fold total dose enhancement effect. This novel approach employs a needle X-ray beam directed at the isocenter centimeters deep in the body while continuously scanning the beam to cover a large solid angle without overlapping at the skin. A Monte Carlo method was developed to simulate an X-ray dose delivered to the isocenter filled with X-ray absorbing and catalytic nanoparticles in a water phantom. An experimental apparatus consisting of a moving plastic phantom irradiated with a stationary 1 mm needle X-ray beam was built to test the theoretical predictions. X-ray films were used to characterize the dose profiles of the scanning X-ray apparatus. Through this work, it was determined that the X-ray dose delivered to the isocenter in a treatment voxel (t-voxel) underneath a 5 cm deep high-density polyethylene (HDPE) phantom was 295 ± 48 times greater than the surface dose. This measured value was in good agreement with the theoretical predicted value of 339-fold. Adding X-ray-absorbing nanoparticles, catalytic nanoparticles or both into the t-voxel can further augment the dose enhancement. For example, we predicted that adding 1 weight percentage (wp) of gold into water could increase the effective dose delivered to the target by onefold. Dose enhancement using 1 mm X-ray beam could reach about 1,600-fold in the t-voxel when 7.5 wp of 88 nm diameter silica-covered gold nanoparticles were added, which we showed in a previously published study can create a dose enhancement of 5.5 ± 0.46-fold without scanning focusing enhancement. Based on the experimental data from that study, mixing 0.02 wp 2.5 nm diameter small tetrakis hydroxymethyl phosphonium chloride (THPC

  10. Optical observations of Gamma-Ray Bursts

    International Nuclear Information System (INIS)

    Hjorth, J.; Pian, E.; Fynbo, J.P.U.

    2004-01-01

    We briefly review the status and recent progress in the field of optical observations of gamma-ray burst afterglows. We will focus on the fundamental observational evidence for the relationship between gamma-ray bursts and the final evolutionary phases of massive stars. In particular, we will address (i) gamma-ray burst host galaxies, (ii) optically dark gamma-ray burst afterglows, (iii) the gamma-ray burst-supernova connection, and (iv) the relation between X-ray flashes, gamma-ray bursts, and supernovae

  11. X-ray apparatus

    International Nuclear Information System (INIS)

    Bernstein, S.; Stagg, L.; Lambert, T.W.; Griswa, P.J.

    1976-01-01

    A patient support system for X-ray equipment in arteriographic studies of the heart is described in detail. The support system has been designed to overcome many of the practical problems encountered in using previous types of arteriographic X-ray equipment. The support system is capable of horizontal movement and, by a series of shafts attached to the main support system, the X-ray source and image intensifier or detector may be rotated through the same angle. The system is highly flexible and details are given of several possible operational modes. (U.K.)

  12. X-ray apparatus

    International Nuclear Information System (INIS)

    Grady, J.K.

    1985-01-01

    X-ray apparatus is described which has a shutter between the X-ray source and the patient. The shutter controls the level of radiation to which the patient is exposed instead of merely discontinuing the electric power supplied to the source. When the shutter is opened a radiation sensor senses the level of X-radiation. When a preset quantity of X-radiation has been measured an exposure control closes the shutter. Instead of using the radiation sensor, the integrated power supplied to the anode of the X-ray source may be measured. (author)

  13. The Gamma-ray Sky with Fermi

    Science.gov (United States)

    Thompson, David

    2012-01-01

    Gamma rays reveal extreme, nonthermal conditions in the Universe. The Fermi Gamma-ray Space Telescope has been exploring the gamma-ray sky for more than four years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge gamma-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.

  14. Hard x-ray to low energy gamma ray spectrum of the Crab Nebula

    International Nuclear Information System (INIS)

    Jung, G.V.

    1986-01-01

    The spectrum of the Crab Nebula has been determined in the energy range 10 keV to 5 MeV from the data of the UCSD/MIT Hard-X-ray and Low Energy Gamma Ray Experiment on the first High Energy Astronomy Observatory, HEAO-1. The x-ray to γ-ray portion of the continuous emission from the Crab is indicative of the electron spectrum, its transport through the nebula, and the physical conditions near the shocked interface between the nebular region and the wind which is the physical link between the nebula and the pulsar, NP0532. The power-law dependence of the spectrum found in the lower-energy decade of this observation (10 to 100 keV) is not continued without modification to higher energies. Evidence for this has been accumulating from previous observations in the γ-ray ranges of 1-10 MeV and above 35 MeV. The observations on which this dissertation is based further characterize the spectral change in the 100 keV to 1 MeV region. These observations provide a crucial connection between the x-ray and γ-ray spectrum of the non-pulsed emission of the Crab Nebula. The continuity of this spectrum suggests that the emission mechanism responsible for the non-pulsed γ-rays observed above 35 MeV is of the same origin as the emission at lower energies, i.e. that of synchrotron radiation in the magnetic field of the nebula

  15. 11. European cosmic ray symposium

    International Nuclear Information System (INIS)

    1989-03-01

    The biannual Symposium includes all aspects of cosmic ray research. The scientific programme was organized under three main headings: Cosmic rays in the heliosphere, Cosmic rays in the interstellar and extragalactic space, Properties of high-energy interactions as studied by cosmic rays. Seven invited talks were indexed seprately for the INIS database. (R.P.)

  16. Accelerator-driven X-ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, Dinh Cong [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-11-09

    After an introduction which mentions x-ray tubes and storage rings and gives a brief review of special relativity, the subject is treated under the following topics and subtopics: synchrotron radiation (bending magnet radiation, wiggler radiation, undulator radiation, brightness and brilliance definition, synchrotron radiation facilities), x-ray free-electron lasers (linac-driven X-ray FEL, FEL interactions, self-amplified spontaneous emission (SASE), SASE self-seeding, fourth-generation light source facilities), and other X-ray sources (energy recovery linacs, Inverse Compton scattering, laser wakefield accelerator driven X-ray sources. In summary, accelerator-based light sources cover the entire electromagnetic spectrum. Synchrotron radiation (bending magnet, wiggler and undulator radiation) has unique properties that can be tailored to the users’ needs: bending magnet and wiggler radiation is broadband, undulator radiation has narrow spectral lines. X-ray FELs are the brightest coherent X-ray sources with high photon flux, femtosecond pulses, full transverse coherence, partial temporal coherence (SASE), and narrow spectral lines with seeding techniques. New developments in electron accelerators and radiation production can potentially lead to more compact sources of coherent X-rays.

  17. The early X-ray afterglows of optically bright and dark Gamma-Ray Bursts

    OpenAIRE

    Lin, Yi-Qing

    2006-01-01

    A systematical study on the early X-ray afterglows of both optically bright and dark gamma-ray bursts (B-GRBs and D-GRBs) observed by Swift has been presented. Our sample includes 25 GRBs. Among them 13 are B-GRBs and 12 are D-GRBs. Our results show that the distributions of the X-ray afterglow fluxes ($F_{X}$), the gamma-ray fluxes ($S_{\\gamma}$), and the ratio ($R_{\\gamma, X}$) for both the D-GRBs and B-GRBs are similar. The differences of these distributions for the two kinds of GRBs shoul...

  18. Guides for intraoral x-rays

    International Nuclear Information System (INIS)

    Ogunsunlade, O.A.

    1988-01-01

    An h-shaped exterior guide for use in combination with a SNAP-A-RAY film holder for accurately aligning a beam from an X-ray cone with an X-ray film during the process of taking intraoral periapical dental X-rays of the maxillary and mandibular teeth is described comprising: a first guide arm laterally and detachably connectable through a housing means; a traverse arm extending from the midpoint of the first guide arm and parallel to the X-ray film; and a second guide arm extending perpendicularly from an end of the traverse arm toward a plane of the X-ray film and in parallel relation up to an end point of the first guide arm

  19. Scintillating ribbon x-ray detector

    International Nuclear Information System (INIS)

    Kinchen, B.E.; Rogers, A.

    1995-01-01

    A patent in the early 1970's by Aerojet Corporation in Sacramento, CA put forth the idea of using an array of scintillating fibers for x-ray detection and imaging. In about 1975, Pratt and Whitney Aircraft in East Hartford, CT designed and manufactured an imaging system based on the patent. The device was 1.75 in thick in the direction of the x-ray beam and about 4 in. by 4 in. square. The device was used with a 8 MeV x-ray source to image and measure internal clearances within operating aircraft, gas turbines engines. There are significant advantages of fiber optic detectors in x-ray detection. However, the advantages are often outweighed by the disadvantages. Two of the advantages of scintillating fiber optic x-ray detectors are: (1) high limiting spatial frequency -- between 20 and 25 lp/mm; and (2) excellent x-ray stopping power -- they can be made thick and retain spatial resolution. In traditional fiber optic detectors the x-rays are oriented parallel to the long axis of the fiber. For the scintillating ribbon x-ray sensor, the x-rays are oriented normal to the fiber long axis. This ribbon sensor technique has a number of advantages over the two current radiographic techniques digital x-radiography and x-ray film: The main advantage the ribbon has is size and shape. It can be as thin as 0.05 in., virtually any width or length, and flexible. Once positioned in a given location, 20 to 100 square inches of the object being inspected can be imaged with a single x-ray beam sweep. It is clear that conventional digital cameras do not lend themselves to placement between walls of aircraft structures or similar items requiring x-ray inspections. A prototype scintillating ribbon x-ray sensor has been fabricated and tested by Synergistic Detector Designs. Images were acquired on corrosion test panels of aluminum fabricated by Iowa State University

  20. On the attenuation of x-rays and gamma-rays in dilute solutions

    DEFF Research Database (Denmark)

    Gerward, Leif

    1996-01-01

    The theory of X-ray and gamma-ray attenuation in solutions is developed. The rule of mixture for the calculation of mass and linear attenuation coefficients is elaborated in the general case as well as in the limit of extreme dilution. The validity of the latter approximation is illustrated...... by the attenuation of 17.443 keV X-rays in aqueous solutions of NaCl. Copyright (C) 1996 Elsevier Science Ltd...

  1. Compton Gamma-Ray Observatory

    Science.gov (United States)

    1991-01-01

    This photograph shows the Compton Gamma-Ray Observatory (GRO) being deployed by the Remote Manipulator System (RMS) arm aboard the Space Shuttle Atlantis during the STS-37 mission in April 1991. The GRO reentered Earth atmosphere and ended its successful mission in June 2000. For nearly 9 years, the GRO Burst and Transient Source Experiment (BATSE), designed and built by the Marshall Space Flight Center (MSFC), kept an unblinking watch on the universe to alert scientists to the invisible, mysterious gamma-ray bursts that had puzzled them for decades. By studying gamma-rays from objects like black holes, pulsars, quasars, neutron stars, and other exotic objects, scientists could discover clues to the birth, evolution, and death of stars, galaxies, and the universe. The gamma-ray instrument was one of four major science instruments aboard the Compton. It consisted of eight detectors, or modules, located at each corner of the rectangular satellite to simultaneously scan the entire universe for bursts of gamma-rays ranging in duration from fractions of a second to minutes. In January 1999, the instrument, via the Internet, cued a computer-controlled telescope at Las Alamos National Laboratory in Los Alamos, New Mexico, within 20 seconds of registering a burst. With this capability, the gamma-ray experiment came to serve as a gamma-ray burst alert for the Hubble Space Telescope, the Chandra X-Ray Observatory, and major gound-based observatories around the world. Thirty-seven universities, observatories, and NASA centers in 19 states, and 11 more institutions in Europe and Russia, participated in the BATSE science program.

  2. Effects of X-Ray Dose On Rhizosphere Studies Using X-Ray Computed Tomography

    Science.gov (United States)

    Zappala, Susan; Helliwell, Jonathan R.; Tracy, Saoirse R.; Mairhofer, Stefan; Sturrock, Craig J.; Pridmore, Tony; Bennett, Malcolm; Mooney, Sacha J.

    2013-01-01

    X-ray Computed Tomography (CT) is a non-destructive imaging technique originally designed for diagnostic medicine, which was adopted for rhizosphere and soil science applications in the early 1980s. X-ray CT enables researchers to simultaneously visualise and quantify the heterogeneous soil matrix of mineral grains, organic matter, air-filled pores and water-filled pores. Additionally, X-ray CT allows visualisation of plant roots in situ without the need for traditional invasive methods such as root washing. However, one routinely unreported aspect of X-ray CT is the potential effect of X-ray dose on the soil-borne microorganisms and plants in rhizosphere investigations. Here we aimed to i) highlight the need for more consistent reporting of X-ray CT parameters for dose to sample, ii) to provide an overview of previously reported impacts of X-rays on soil microorganisms and plant roots and iii) present new data investigating the response of plant roots and microbial communities to X-ray exposure. Fewer than 5% of the 126 publications included in the literature review contained sufficient information to calculate dose and only 2.4% of the publications explicitly state an estimate of dose received by each sample. We conducted a study involving rice roots growing in soil, observing no significant difference between the numbers of root tips, root volume and total root length in scanned versus unscanned samples. In parallel, a soil microbe experiment scanning samples over a total of 24 weeks observed no significant difference between the scanned and unscanned microbial biomass values. We conclude from the literature review and our own experiments that X-ray CT does not impact plant growth or soil microbial populations when employing a low level of dose (<30 Gy). However, the call for higher throughput X-ray CT means that doses that biological samples receive are likely to increase and thus should be closely monitored. PMID:23840640

  3. Cosmic-Ray Extremely Distributed Observatory: a global cosmic ray detection framework

    Science.gov (United States)

    Sushchov, O.; Homola, P.; Dhital, N.; Bratek, Ł.; Poznański, P.; Wibig, T.; Zamora-Saa, J.; Almeida Cheminant, K.; Alvarez Castillo, D.; Góra, D.; Jagoda, P.; Jałocha, J.; Jarvis, J. F.; Kasztelan, M.; Kopański, K.; Krupiński, M.; Michałek, M.; Nazari, V.; Smelcerz, K.; Smolek, K.; Stasielak, J.; Sułek, M.

    2017-12-01

    The main objective of the Cosmic-Ray Extremely Distributed Observatory (CREDO) is the detection and analysis of extended cosmic ray phenomena, so-called super-preshowers (SPS), using existing as well as new infrastructure (cosmic-ray observatories, educational detectors, single detectors etc.). The search for ensembles of cosmic ray events initiated by SPS is yet an untouched ground, in contrast to the current state-of-the-art analysis, which is focused on the detection of single cosmic ray events. Theoretical explanation of SPS could be given either within classical (e.g., photon-photon interaction) or exotic (e.g., Super Heavy Dark Matter decay or annihilation) scenarios, thus detection of SPS would provide a better understanding of particle physics, high energy astrophysics and cosmology. The ensembles of cosmic rays can be classified based on the spatial and temporal extent of particles constituting the ensemble. Some classes of SPS are predicted to have huge spatial distribution, a unique signature detectable only with a facility of the global size. Since development and commissioning of a completely new facility with such requirements is economically unwarranted and time-consuming, the global analysis goals are achievable when all types of existing detectors are merged into a worldwide network. The idea to use the instruments in operation is based on a novel trigger algorithm: in parallel to looking for neighbour surface detectors receiving the signal simultaneously, one should also look for spatially isolated stations clustered in a small time window. On the other hand, CREDO strategy is also aimed at an active engagement of a large number of participants, who will contribute to the project by using common electronic devices (e.g., smartphones), capable of detecting cosmic rays. It will help not only in expanding the geographical spread of CREDO, but also in managing a large manpower necessary for a more efficient crowd-sourced pattern recognition scheme to

  4. An X-ray and optical study of the ultracompact X-ray binary A 1246-58

    NARCIS (Netherlands)

    in 't Zand, J.J.M.; Bassa, C.G.; Jonker, P.G.; Keek, L.; Verbunt, F.W.M.; Méndez, M.; Markwardt, C.B.

    2008-01-01

    Results are discussed of an X-ray and optical observation campaign of the low-mass X-ray binary A 1246-58 performed with instruments on Satellite per Astronomia X ("BeppoSAX"), the Rossi X-ray Timing Explorer (RXTE), the X-ray Multi-mirror Mission ("XMM-Newton"), the Swift mission, and the Very

  5. Lunar based gamma ray astronomy

    International Nuclear Information System (INIS)

    Haymes, R.C.

    1985-01-01

    Gamma ray astronomy represents the study of the universe on the basis of the electromagnetic radiation with the highest energy. Gamma ray astronomy provides a crucial tool for the understanding of astronomical phenomena, taking into account nucleosynthesis in supernovae, black holes, active galaxies, quasars, the sources of cosmic rays, neutron stars, and matter-antimatter annihilation. Difficulties concerning the conduction of studies by gamma ray astronomy are related to the necessity to perform such studies far from earth because the atmosphere is a source of gamma rays. Studies involving the use of gamma ray instruments in earth orbit have been conducted, and more gamma ray astronomy observations are planned for the future. Imperfections of studies conducted in low earth orbit could be overcome by estalishing an observatory on the moon which represents a satellite orbiting at 60 earth radii. Details concerning such an observatory are discussed. 5 references

  6. The Gamma-ray Universe through Fermi

    Science.gov (United States)

    Thompson, David J.

    2012-01-01

    Gamma rays, the most powerful form of light, reveal extreme conditions in the Universe. The Fermi Gamma-ray Space Telescope and its smaller cousin AGILE have been exploring the gamma-ray sky for several years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge ga.nuna-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.

  7. Synchrotron x-ray fluorescence and extended x-ray absorption fine structure analysis

    International Nuclear Information System (INIS)

    Chen, J.R.; Gordon, B.M.; Hanson, A.L.; Jones, K.W.; Kraner, H.W.; Chao, E.C.T.; Minkin, J.A.

    1984-01-01

    The advent of dedicated synchrotron radiation sources has led to a significant increase in activity in many areas of science dealing with the interaction of x-rays with matter. Synchrotron radiation provides intense, linearly polarized, naturally collimated, continuously tunable photon beams, which are used to determine not only the elemental composition of a complex, polyatomic, dilute material but also the chemical form of the elements with improved accuracy. Examples of the application of synchrotron radiation include experiments in synchrotron x-ray fluorescence (SXRF) analysis and extended x-ray absorption fine structure (EXAFS) analysis. New synchrotron radiation x-ray microprobes for elemental analysis in the parts per billion range are under construction at several laboratories. 76 references, 24 figures

  8. Filter-fluorescer x-ray spectrometer using solid state detectors for γ-ray background reduction

    International Nuclear Information System (INIS)

    Yokoi, Takashi; Kitagawa, Yoneyoshi; Shiraga, Hiroyuki; Matsunaga, Hirohide; Kato, Yoshiaki; Yamanaka, Chiyoe.

    1986-01-01

    Filter-fluorescer x-ray spectrometer using solid state photo-detectors instead of the photomultiplier tubes in order to reduce the γ-ray background noise is reported. A significant reduction of the γ-ray background noise is expected, because solid state photo-detectors are very small in size compared with the photomultiplier tubes. It has been confirmed that the γ-ray background is reduced in the target irradiation experiments with the Gekko MII glass laser. (author)

  9. Charge collection and absorption-limited x-ray sensitivity of pixellated x-ray detectors

    International Nuclear Information System (INIS)

    Kabir, M. Zahangir; Kasap, S.O.

    2004-01-01

    The charge collection and absorption-limited x-ray sensitivity of a direct conversion pixellated x-ray detector operating in the presence of deep trapping of charge carriers is calculated using the Shockley-Ramo theorem and the weighting potential of the individual pixel. The sensitivity of a pixellated x-ray detector is analyzed in terms of normalized parameters; (a) the normalized x-ray absorption depth (absorption depth/photoconductor thickness), (b) normalized pixel width (pixel size/thickness), and (c) normalized carrier schubwegs (schubweg/thickness). The charge collection and absorption-limited sensitivity of pixellated x-ray detectors mainly depends on the transport properties (mobility and lifetime) of the charges that move towards the pixel electrodes and the extent of dependence increases with decreasing normalized pixel width. The x-ray sensitivity of smaller pixels may be higher or lower than that of larger pixels depending on the rate of electron and hole trapping and the bias polarity. The sensitivity of pixellated detectors can be improved by ensuring that the carrier with the higher mobility-lifetime product is drifted towards the pixel electrodes

  10. Topological X-Rays Revisited

    Science.gov (United States)

    Lynch, Mark

    2012-01-01

    We continue our study of topological X-rays begun in Lynch ["Topological X-rays and MRI's," iJMEST 33(3) (2002), pp. 389-392]. We modify our definition of a topological magnetic resonance imaging and give an affirmative answer to the question posed there: Can we identify a closed set in a box by defining X-rays to probe the interior and without…

  11. Exploring the X-Ray Universe

    Science.gov (United States)

    Seward, Frederick D.; Charles, Philip A.

    1995-11-01

    Exploring the X-Ray Universe describes the view of the stars and galaxies that is obtained through X-ray telescopes. X-rays, which are invisible to human sight, are created in the cores of active galaxies, in cataclysmic stellar explosions, and in streams of gas expelled by the Sun and stars. The window on the heavens used by the X-ray astronomers shows the great drama of cosmic violence on the grandest scale. This account of X-ray astronomy incorporates the latest findings from several observatories operating in space. These include the Einstein Observatory operated by NASA, and the EXOSAT satellite of the European Space Agency. The book covers the entire field, with chapters on stars, supernova remnants, normal and active galaxies, clusters of galaxies, the diffuse X-ray background, and much more. The authors review basic principles, include the necessary historical background, and explain exactly what we know from X-ray observations of the Universe.

  12. X-ray interferometers

    International Nuclear Information System (INIS)

    Franks, A.

    1980-01-01

    An improved type of amplitude-division x-ray interferometer is described. The wavelength at which the interferometer can operate is variable, allowing the instrument to be used to measure x-ray wavelength, and the angle of inclination is variable for sample investigation. (U.K.)

  13. MODELING THE GAMMA-RAY EMISSION IN THE GALACTIC CENTER WITH A FADING COSMIC-RAY ACCELERATOR

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ruo-Yu; Wang, Xiang-Yu; Prosekin, Anton [Max-Planck-Institut für Kernphysik, D-69117 Heidelberg (Germany); Chang, Xiao-Chuan, E-mail: ruoyu@mpi-hd.mpg.de, E-mail: xywang@nju.edu.cn [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China)

    2016-12-20

    Recent HESS observations of the ∼200 pc scale diffuse gamma-ray emission from the central molecular zone (CMZ) suggest the presence of a PeV cosmic-ray accelerator (PeVatron) located in the inner 10 pc region of the Galactic center. Interestingly, the gamma-ray spectrum of the point-like source (HESS J1745-290) in the Galactic center shows a cutoff at ∼10 TeV, implying a cutoff around 100 TeV in the cosmic-ray proton spectrum. Here we propose that the gamma-ray emission from the inner and the outer regions may be explained self-consistently by run-away protons from a single yet fading accelerator. In this model, gamma-rays from the CMZ region are produced by protons injected in the past, while gamma-rays from the inner region are produced by protons injected more recently. We suggest that the blast wave formed in a tidal disruption event (TDE) caused by the supermassive black hole (Sgr A*) could serve as such a fading accelerator. With typical parameters of the TDE blast wave, gamma-ray spectra of both the CMZ region and HESS J1745-290 can be reproduced simultaneously. Meanwhile, we find that the cosmic-ray energy density profile in the CMZ region may also be reproduced in the fading accelerator model when appropriate combinations of the particle injection history and the diffusion coefficient of cosmic rays are adopted.

  14. X-ray lasers

    CERN Document Server

    Elton, Raymond C

    2012-01-01

    The first in its field, this book is both an introduction to x-ray lasers and a how-to guide for specialists. It provides new entrants and others interested in the field with a comprehensive overview and describes useful examples of analysis and experiments as background and guidance for researchers undertaking new laser designs. In one succinct volume, X-Ray Lasers collects the knowledge and experience gained in two decades of x-ray laser development and conveys the exciting challenges and possibilities still to come._Add on for longer version of blurb_M>The reader is first introduced

  15. Cosmic ray modulation

    International Nuclear Information System (INIS)

    Ueno, Hirosachi

    1974-01-01

    It is important to know the physical state of solar plasma region by the observation of intensity variation of cosmic ray which passed through the solar plasma region, because earth magnetosphere is formed by the interaction between geomagnetic field and solar plasma flow. The observation of cosmic ray intensity is useful to know the average condition of the space of 0.1--3 A.U., and gives the structure of the magnetic field in solar wind affecting the earth magnetosphere. The observation of neutron component in cosmic ray has been carried out at Norikura, Tokyo, Fukushima and Morioka. The lower limit of the energy of incident cosmic ray which can be observed at each station is different, and the fine structure of the variation can be known by comparison. The intensity of meson component in cosmic ray has been measured in underground, and the state of solar plasma region 2--3 A.U. from the earth can be known. The underground measurement has been made at Takeyama and Matsumoto, and a new station at Sakashita is proposed. The measurement at Sakashita will be made by proportional counters at the depth of 100m (water equivalent). Arrangement of detectors is shown. (Kato, T.)

  16. Cosmic rays in space

    International Nuclear Information System (INIS)

    Fujitaka, Kazunobu

    2005-01-01

    Cosmos is a mysterious space by which many researchers are fascinated for many years. But, going into space means that we will receive extra exposure due to existence of cosmic rays. Cosmic rays are mainly composed of highly energetic protons. It was born in the last stage of stellar life. Understanding of cosmos will certainly bring right understanding of radiation energy, or energy itself. As no one could see the very early stage of cosmic rays, there is only a speculation. But it is better to speculate something based on certain side evidences, than to give up the whole. Such attitude shall be welcomed in the space researches. Anyway, cosmic rays were born in the last explosion of a star, which is called as Super Nova. After cosmic rays are emitted from the Super Nova, it will reach to the human surroundings. To indicate its intensity, special unit of ''dose rate'' is used. When a man climbs a mountain, cosmic ray intensity surely increases. It doubles as he goes up every 1500m elevation. It was ascertained by our own measurements. Then what happens when the goes up more? At aviation altitude, where airplanes fly, the dose rate will be increased up to 100times the high mountain cases. And what is expected when he goes up further more, up to space orbit altitude? In this case, the dose rate increases up to 10times the airplane cases. Geomagnetism affects the dose rate very much. As primary cosmic ray particles are charged particles, they cannot do well with existence of the magnetic field. In effect, cosmic rays can penetrate into the polar atmosphere along geomagnetic lines of forces which stand almost vertical, but penetration of low energy cosmic rays will be banned when they intend to penetrate crossing the geomagnetic lines of forces in equatorial region. Therefore, exposure due to cosmic rays will become large in polar region, while it remains small in equatorial region. In effect, airplanes which fly over the equator. Only, we have to know that the cosmos

  17. Femtosecond X-ray magnetic circular dichroism absorption spectroscopy at an X-ray free electron laser

    Energy Technology Data Exchange (ETDEWEB)

    Higley, Daniel J., E-mail: dhigley@stanford.edu; Yuan, Edwin [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, California 94025 (United States); Department of Applied Physics, Stanford University, Stanford, California 94305 (United States); Hirsch, Konstantin; Dakovski, Georgi L.; Jal, Emmanuelle; Lutman, Alberto A.; Coslovich, Giacomo; Hart, Philip; Hoffmann, Matthias C.; Mitra, Ankush; Moeller, Stefan; Ohldag, Hendrik; Seaberg, Matthew; Stöhr, Joachim; Nuhn, Heinz-Dieter; Reid, Alex H.; Dürr, Hermann A.; Schlotter, William F. [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, California 94025 (United States); Liu, Tianmin; MacArthur, James P. [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, California 94025 (United States); Department of Physics, Stanford University, Stanford, California 94305 (United States); and others

    2016-03-15

    X-ray magnetic circular dichroism spectroscopy using an X-ray free electron laser is demonstrated with spectra over the Fe L{sub 3,2}-edges. The high brightness of the X-ray free electron laser combined with high accuracy detection of incident and transmitted X-rays enables ultrafast X-ray magnetic circular dichroism studies of unprecedented sensitivity. This new capability is applied to a study of all-optical magnetic switching dynamics of Fe and Gd magnetic sublattices in a GdFeCo thin film above its magnetization compensation temperature.

  18. X-ray generation by femtosecond laser pulses and its application to soft X-ray imaging microscope

    International Nuclear Information System (INIS)

    Ikeda, Kenichi; Kotaki, Hideyuki; Nakajima, Kazuhisa

    2002-01-01

    We have developed laser-produced plasma X-ray sources using femtosecond laser pulses at 10Hz repetition rate in a table-top size in order to investigate basic mechanism of X-ray emission from laser-matter interactions and its application to a X-ray microscope. In a soft X-ray region over 5 nm wavelength, laser-plasma X-ray emission from a solid target achieved an intense flux of photons of the order of 1011 photons/rad per pulse with duration of a few 100 ps, which is intense enough to make a clear imaging in a short time exposure. As an application of laser-produced plasma X-ray source, we have developed a soft X-ray imaging microscope operating in the wavelength range around 14 nm. The microscope consists of a cylindrically ellipsoidal condenser mirror and a Schwarzshird objective mirror with highly-reflective multilayers. We report preliminary results of performance tests of the soft X-ray imaging microscope with a compact laser-produced plasma X-ray source

  19. X-ray imaging system

    International Nuclear Information System (INIS)

    Houston, J.M.

    1980-01-01

    A novel, high-speed apparatus for use in X-ray computerised tomography is described in detail. It consists of a semi-circular array of X-ray sources, collimators and an ion chamber array for detection of the X-rays. The X-ray sources may be pulsed in salvos such that the corresponding detectors in the array are only illuminated by one source. The use of computer controlled salvos speeds up the image processing by at least a factor of two. The ion chamber array is designed to have a constant detection efficiency for varying angles of X-ray incidence. A detailed description of the detector construction and suggested gaseous fillings are given. It is claimed that the present tomographic system allows fast and accurate imaging of internal body organs and is insensitive to the blurring effects which motion of these organs tends to produce. (UK)

  20. The FANTASTIC FOUR proteins influence shoot meristem size in Arabidopsis thaliana

    OpenAIRE

    Wahl, Vanessa; Brand, Luise H; Guo, Ya-Long; Schmid, Markus

    2010-01-01

    Abstract Background Throughout their lives plants produce new organs from groups of pluripotent cells called meristems, located at the tips of the shoot and the root. The size of the shoot meristem is tightly controlled by a feedback loop, which involves the homeodomain transcription factor WUSCHEL (WUS) and the CLAVATA (CLV) proteins. This regulatory circuit is further fine-tuned by morphogenic signals such as hormones and sugars. Results Here we show that a family of four plant-specific pro...

  1. X-ray absorption and X-ray emission spectroscopy theory and applications

    CERN Document Server

    Lamberti, Carlo

    2016-01-01

    During the last two decades, remarkable and often spectacular progress has been made in the methodological and instrumental aspects of x–ray absorption and emission spectroscopy. This progress includes considerable technological improvements in the design and production of detectors especially with the development and expansion of large-scale synchrotron reactors All this has resulted in improved analytical performance and new applications, as well as in the perspective of a dramatic enhancement in the potential of x–ray based analysis techniques for the near future. This comprehensive two-volume treatise features articles that explain the phenomena and describe examples of X–ray absorption and emission applications in several fields, including chemistry, biochemistry, catalysis, amorphous and liquid systems, synchrotron radiation, and surface phenomena. Contributors explain the underlying theory, how to set up X–ray absorption experiments, and how to analyze the details of the resulting spectra. X-R...

  2. On the determination of the mutual exclusion statistics parameter

    Indian Academy of Sciences (India)

    On the determination of the mutual exclusion statistics parameter. SAPTARSHI MANDAL. Department of Theoretical Physics, Indian Association for the Cultivation of Science,. 2A&2B Raja S.C. Mullick Road, Jadavpur, Kolkata 700 032, India. E-mail: mandal.saptarshi1@gmail.com. MS received 7 September 2012; revised ...

  3. Optical Detection of Sodium Salts of Fluoride, Acetate and ...

    Indian Academy of Sciences (India)

    Administrator

    Optical Detection of Sodium Salts of Fluoride, Acetate and Phosphate by a Diacylhydrazine. Ligand via the Formation of a Colour Alkali Metal Complex. Purnandhu Bose, Ranjan Dutta, I. Ravikumar and Pradyut Ghosh. ∗. Department of Inorganic Chemistry, Indian Association for the Cultivation of Science, 2A & 2B Raja ...

  4. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 40; Issue 5. Structural, microstructural and optical properties of Cu 2 ZnSnS 4 thin films prepared by thermal evaporation: effect of substrate temperature and annealing. U CHALAPATHI S UTHANNA V SUNDARA RAJA. Volume 40 Issue 5 September 2017 pp 887-895 ...

  5. Evaluation of androgenic activity of Mucuna pruriens in male rats

    African Journals Online (AJOL)

    ajl yemi

    2011-10-26

    Oct 26, 2011 ... 1Department of Biotechnology, J. J.College of Arts and Science, Pudukottai-622 404, Tamil Nadu, India. 2Department of Zoology, Raja Serfoji ... pruriens seeds in the management of Parkinson's disea- se by virtue of their L-DOPA content .... and to clarify their mechanism of action. ACKNOWLEDGEMENT.

  6. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    An empirical approach to the theory of particle and nuclear phenomena: Review and some new ideas · Raja Ramanna Sudhir R Jain · More Details Abstract Fulltext PDF. Experimental data on masses and lifetimes of unstable particles falls into a pattern, a brief review of some interesting consequences is presented here.

  7. YoichiroNambu: Seer* ofModernPhysics

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 6. Yoichiro Nambu: Seer of Modern Physics. N D Hari Dass. General Article Volume 14 Issue 6 June 2009 pp ... DAE Raja Ramanna Fellow, Indian Institute of Science, Bangalore 560 012, India. Hon. Director, Poornaprajna Institute of Scientific ...

  8. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Cytosine deletion at AP2-box region of HSP70 promoter and its influence on semen quality traits in crossbred bulls · RAJIB DEB BASAVRAJ SAJJANAR UMESH SINGH SUSHIL KUMAR GYANENDRA SINGH SENGAR RANI ALEX A. K. DAS S. TYAGI T. V. RAJA R. R. ALYETHODI RANI SINGH V. BHANUPRAKASH B.

  9. Isolation and identification of two marine-derived Streptomyces from ...

    African Journals Online (AJOL)

    Administrator

    2011-09-26

    Sep 26, 2011 ... evaluated against the test phytopathogenic fungi; the results showed that the FBE of S. ... largest antibiotic-producing actinomycetes (Imada et al.,. 2005; Raja et al., 2010). ... sediments within the neritic zone in the sea area round. Zhuhai city of ..... effects of the ethyl acetate extract of Trichoderma harzianum.

  10. Fulltext PDF

    Indian Academy of Sciences (India)

    and Raja discuss solitons in photonic crystals; and Balakrishnan and Satija discuss solitons in Bose–Einstein condensates. The paper of Das and col- laborators has a different focus, viz. the analysis of inhomogeneous EMHD plasma, and that of Guha et al on the role of the Jacobi multiplier and isochronous systems.

  11. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Critical Opalescence · E S Raja Gopal · More Details Fulltext PDF. pp 46-51 General Article. Bose–Einstein Condensation - Birds of a Feather Flock Together · Rajaram Nityananda · More Details Fulltext PDF. pp 52-61 General Article. Chaotic Dynamics on the Real Line - Periodic Behaviour and the Bifurcation Diagram.

  12. Si(Li) X-ray detector

    International Nuclear Information System (INIS)

    Yuan Xianglin; Li Zhiyong; Hong Xiuse

    1990-08-01

    The fabrication technology of the 10∼80 mm 2 Si(Li) X-ray detectors are described and some problems concerning technology and measurement are discussed. The specifications of the detectors are shown as well. The Si(Li) X-ray detector is a kind of low energy X-ray detectors. Owing to very high energy resolution, fine linearity and high detection efficiency in the range of low energy X-rays, it is widely used in the fields of nuclear physics, medicine, geology and environmental protection, etc,. It is also a kernel component for the scanning electron microscope and X-ray fluorescence analysis systems

  13. X-ray and gamma-ray standards for detector calibration

    International Nuclear Information System (INIS)

    1991-09-01

    The IAEA established a Co-ordinated Research Programme (CRP) on the Measurements and Evaluation of X- and Gamma-Ray Standards for Detector Efficiency Calibration in 1986 with the aim of alleviating the generation of such discrepancies. Within the framework of this CRP, representatives of nine research groups from six Member States and one international organization performed a number of precise measurements and systematic in-depth evaluations of the required decay data. They have also contributed to the development of evaluation methodology and measurement techniques, and stimulated a number of such studies at laboratories not directly involved in the IAEA project. The results of the work of the CRP, which was finished in 1990, are presented in this report. Recommended values of half-lives and photon emission probabilities are given for a carefully selected set of radionuclides that are suitable for detector efficiency calibration (X-rays from 5 to 90 keV and gamma-rays from 30 to about 3000 keV). Detector efficiency calibration for higher gamma-ray energies (up to 14 MeV) is also considered. The evaluation procedures used to obtain the recommended values and their estimated uncertainties are reported, and a summary of the remaining discrepancies is given. Refs and tabs

  14. Review of X-ray Tomography and X-ray Fluorescence Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Shear, Trevor A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-16

    This literature review will focus on both laboratory and synchrotron based X-ray tomography of materials and highlight the inner workings of these instruments. X-ray fluorescence spectroscopy will also be reviewed and applications of the tandem use of these techniques will be explored. The real world application of these techniques during the internship will also be discussed.

  15. PAL-XFEL soft X-ray scientific instruments and X-ray optics: First commissioning results

    Science.gov (United States)

    Park, Sang Han; Kim, Minseok; Min, Changi-Ki; Eom, Intae; Nam, Inhyuk; Lee, Heung-Soo; Kang, Heung-Sik; Kim, Hyeong-Do; Jang, Ho Young; Kim, Seonghan; Hwang, Sun-min; Park, Gi-Soo; Park, Jaehun; Koo, Tae-Yeong; Kwon, Soonnam

    2018-05-01

    We report an overview of soft X-ray scientific instruments and X-ray optics at the free electron laser (FEL) of the Pohang Accelerator Laboratory, with selected first-commissioning results. The FEL exhibited a pulse energy of 200 μJ/pulse, a pulse width of power of 10 500 was achieved. The estimated total time resolution between optical laser and X-ray pulses was <270 fs. A resonant inelastic X-ray scattering spectrometer was set up; its commissioning results are also reported.

  16. RADIO-QUIET AND RADIO-LOUD PULSARS: SIMILAR IN GAMMA-RAYS BUT DIFFERENT IN X-RAYS

    Energy Technology Data Exchange (ETDEWEB)

    Marelli, M.; Mignani, R. P.; Luca, A. De; Salvetti, D. [INAF—Istituto di Astrofisica Spaziale e Fisica Cosmica Milano, via E. Bassini 15, I-20133, Milano (Italy); Parkinson, P. M. Saz [Santa Cruz Institute for Particle Physics, Department of Physics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Hartog, P. R. Den [Stanford University HEPL/KIPAC, 452 Lomita Mall, Stanford, CA 94305-4085 (United States); Wolff, M. T., E-mail: marelli@iasf-milano.inaf.it [Space Science Division, Naval Research Laboratory, Washington, DC 20375-5352 (United States)

    2015-04-01

    We present new Chandra and XMM-Newton observations of a sample of eight radio-quiet (RQ) γ-ray pulsars detected by the Fermi Large Area Telescope. For all eight pulsars we identify the X-ray counterpart, based on the X-ray source localization and the best position obtained from γ-ray pulsar timing. For PSR J2030+4415 we found evidence for a ∼10″-long pulsar wind nebula. Our new results consolidate the work from Marelli et al. and confirm that, on average, the γ-ray-to-X-ray flux ratios (F{sub γ}/F{sub X}) of RQ pulsars are higher than for the radio-loud (RL) ones. Furthermore, while the F{sub γ}/F{sub X} distribution features a single peak for the RQ pulsars, the distribution is more dispersed for the RL ones, possibly showing two peaks. We discuss possible implications of these different distributions based on current models for pulsar X-ray emission.

  17. Light element production by cosmological cosmic rays and the gamma-ray background

    International Nuclear Information System (INIS)

    Montmerle, T.

    1977-01-01

    This paper examines the view that the 1-100 MeV γ-ray background is of cosmological origin, and is produced by high-energy collisions in a burst at high redshifts (approximately 100) between cosmic rays and the ambient gas, as suggested by Stecker (1969). To test this 'cosmological cosmic-ray (CCR) hypothesis', use is made of the fact that, simultaneously, low energy interactions give birth to the light elements D, 3 He, 6 Li, 7 Li and 7 Be. Their resulting abundances are calculated by normalizing the CCR flux to the observed γ-ray background. Since it is possible to find the correct (observed) 7 Li abundance, which is otherwise unexplained as yet, by this process, it is of interest to discuss the various uncertainties involved in the calculations. Among these, the spread of the present γ-ray data, especially between 1 and approximately 10 MeV, is a major uncertainty, and emphasis is put on its influence on the results and, as a consequence, on the validity of the CCR hypothesi

  18. Upsurge of X-ray astronomy 230-

    International Nuclear Information System (INIS)

    Hudec, D.R.

    1978-01-01

    Instruments are described used for X-ray astronomy, namely X-ray detectors and X-ray telescopes. Unlike telescopes, the detectors do not comprise X-ray optics. A survey is given of the results obtained in solar and stellar X-ray astronomy and hypotheses are submitted on the origin of X radiation in the interstellar space. (J.B.)

  19. X-ray survey of the Pleiades: dependence of X-ray luminosity on stellar age

    International Nuclear Information System (INIS)

    Micela, G.; Sciortino, S.; Serio, S.; Vaiana, G.S.; Golub, L.; Harnden, F.R.; Rosner, R.

    1984-01-01

    The study of X-ray emission of stellar clusters, allows to decouple the influence of some individual stellar parameters, as initial conditions, composition and age, on the stellar X-ray function. The authors report preliminary results from an Einstein X-ray survey of the Pleiades. (Auth.)

  20. A study of gamma-ray bursts and a new detector for gamma-ray astronomy

    International Nuclear Information System (INIS)

    Carter, J.N.

    1979-09-01

    Three gamma-ray experiments flown on balloons between August 1975 and August 1976 are described in detail. The successful Transatlantic balloon flight enabled a rate of 3 bursts year -1 with energies > 7 x 10 -7 ergs cm -2 to be established. This result is discussed in the light of other work. The choice of γ-ray detector for optimum sensitivity is presented. In addition various techniques for determining the arrival direction of gamma-ray bursts are compared. A new balloon borne γ-ray burst telescope is proposed. The design, testing and results of the beam calibration of a new drift chamber detector system for high energy (> 50 MeV) γ-rays are presented. A projected angular resolution of 0.8 0 was obtained at 300 MeV. Techniques for the measurement of γ-ray energies are discussed in relation to this instrument. Finally the use of drift chambers in an integrated free flying satellite is illustrated, and the expected performance is presented. (author)

  1. Ultra high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Wdowczyk, J.

    1986-01-01

    The experimental data on ultra high energy γ-rays are reviewed and a comparison of the properties of photon and proton initiated shower is made. The consequences of the existence of the strong ultra high energy γ-ray sources for other observations is analysed and possible mechanisms for the production of ultra high energy γ-rays in the sources are discussed. It is demonstrated that if the γ-rays are produced via cosmic ray interactions the sources have to produce very high fluxes of cosmic ray particles. In fact it is possible that a small number of such sources can supply the whole Galactic cosmic ray flux

  2. Stabilized x-ray generator power supply

    International Nuclear Information System (INIS)

    Saha, Subimal; Purushotham, K.V.; Bose, S.K.

    1986-01-01

    X-ray diffraction and X-ray fluorescence analysis are very much adopted in laboratories to determine the type and structure of the constituent compounds in solid materials, chemical composition of materials, stress developed on metals etc. These experiments need X-ray beam of fixed intensity and wave length. This can only be achieved by X-ray generator having highly stabilized tube voltage and tube current. This paper describes how X-ray tube high voltage and electron beam current are stabilized. This paper also highlights generation of X-rays, diffractometry and X-ray fluorescence analysis and their wide applications. Principle of operation for stabilizing the X-ray tube voltage and current, different protection circuits adopted, special features of the mains H.V. transformer and H.T. tank are described in this report. (author)

  3. Cosmic and solar gamma-ray x-ray and particle measurements from high altitude balloons in Antarctica

    International Nuclear Information System (INIS)

    Lin, R.P.

    1990-01-01

    For measurements of cosmic and solar gamma-rays, hard X-rays, and particles, Antarctica offers the potential for very long, 10--20 day, continuous, twenty-four-hour-a-day observations, with balloon flights circling the South Pole during austral summer. For X-ray/gamma-ray sources at high south latitude the overlying atmosphere is minimized, and for cosmic ray measurements the low geomagnetic cutoff permits entry of low rigidity particles. The first Antarctic flight of a heavy (∼2400 lb.) payload on a large (11.6x10 6 cu. ft.) balloon took place in January, 1988, to search for the gamma-ray lines of 56 Co produced in the new supernova SN 1987A in the Large Magellanic Cloud. The long duration balloon flights presently planned from Antarctica include those for further gamma-ray/hard X-ray studies of SN 1987A and for the NASA Max '91 program for solar flare studies

  4. Gamma-ray sources

    International Nuclear Information System (INIS)

    Hermsen, W.

    1980-01-01

    Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)

  5. Extragalactic Gamma-Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...

  6. Stellar X-ray sources

    International Nuclear Information System (INIS)

    Katz, J.I.; Washington Univ., St. Louis, MO

    1988-01-01

    I Review some of the salient accomplishments of X-rap studies of compact objects. Progress in this field has closely followed the improvement of observational methods, particularly in angular resolution and duration of exposure. Luminous compact X-ray sources are accreting neutron stars or black holes. Accreting neutron stars may have characteristic temporal signatures, but the only way to establish that an X-ray source is a black hole is to measure its mass. A rough phenomenological theory is succesful, but the transport of angular momentum in accretion flows is not onderstood. A number of interesting complications have been observed, including precessing accretion discs, X-ray bursts, and the acceleration of jets in SS433. Many puzzles remain unsolved, including the excitation of disc precession, the nature of the enigmatic A- and gamma-ray source Cyg X-3, the mechanism by which slowly spinning accreting neutron stars lose angular momentum, and the superabundance of X-ray sources in globular clusters. 41 refs.; 5 figs

  7. Topics in Astrophysical X-Ray and Gamma Ray Spectroscopy. Ph.D. Thesis - Maryland Univ.

    Science.gov (United States)

    Bussard, R. W.

    1978-01-01

    A number of topics relating to astrophysical observations that have already been made or are currently planned of spectral features, mostly emission lines, in the X-ray and gamma ray region of the electromagnetic spectrum are investigated. These topics include: the production of characteristic X-ray and gamma ray lines by nonthermal ions, spectral features induced by processes occurring in strong magnetic fields, and the positron annihilation line at 0.5 MeV. The rate of X-ray production at 6.8 keV by the 2p to 1s transition in fast hydrogen- and helium-like iron ions, following both electron capture to excited levels and collisional excitation is calculated. The cross section for electron-ion Coulomb collisions in strong fields is also calculated.

  8. γ ray astronomy with muons

    International Nuclear Information System (INIS)

    Halzen, F.; Stanev, T.; Yodh, G.B.

    1997-01-01

    Although γ ray showers are muon poor, they still produce a number of muons sufficient to make the sources observed by GeV and TeV telescopes observable also in muons. For sources with hard γ ray spectra there is a relative open-quotes enhancementclose quotes of muons from γ ray primaries as compared to that from nucleon primaries. All shower γ rays above the photoproduction threshold contribute to the number of muons N μ , which is thus proportional to the primary γ ray energy. With γ ray energy 50 times higher than the muon energy and a probability of muon production by the γ close-quote s of about 1%, muon detectors can match the detection efficiency of a GeV satellite detector if their effective area is larger by 10 4 . The muons must have enough energy for sufficiently accurate reconstruction of their direction for doing astronomy. These conditions are satisfied by relatively shallow neutrino detectors such as AMANDA and Lake Baikal, and by γ ray detectors such as MILAGRO. TeV muons from γ ray primaries, on the other hand, are rare because they are only produced by higher energy γ rays whose flux is suppressed by the decreasing flux at the source and by absorption on interstellar light. We show that there is a window of opportunity for muon astronomy with the AMANDA, Lake Baikal, and MILAGRO detectors. copyright 1997 The American Physical Society

  9. Center for X-Ray Optics, 1986

    International Nuclear Information System (INIS)

    1987-07-01

    The Center for X-Ray Optics has made substantial progress during the past year on the development of very high resolution x-ray technologies, the generation of coherent radiation at x-ray wavelengths, and, based on these new developments, had embarked on several scientific investigations that would not otherwise have been possible. The investigations covered in this report are topics on x-ray sources, x-ray imaging and applications, soft x-ray spectroscopy, synchrotron radiation, advanced light source and magnet structures for undulators and wigglers

  10. Equipment, components and production of x-ray

    International Nuclear Information System (INIS)

    Idris Besar

    2004-01-01

    The contents of this chapter are follows - Equipment, Components and Production of x-Ray: x-ray system, generator, control panel. x-ray tube, cathode, anode, envelope, housing, collimator, other components, x-ray production, Bremsstrahlung x-ray, characteristic x-ray, heat production

  11. X-Rays, Pregnancy and You

    Science.gov (United States)

    ... Emitting Products and Procedures Medical Imaging Medical X-ray Imaging X-Rays, Pregnancy and You Share Tweet Linkedin Pin it ... the decision with your doctor. What Kind of X-Rays Can Affect the Unborn Child? During most x- ...

  12. Toward Adaptive X-Ray Telescopes

    Science.gov (United States)

    O'Dell, Stephen L.; Atkins, Carolyn; Button, Tim W.; Cotroneo, Vincenzo; Davis, William N.; Doel, Peer; Feldman, Charlotte H.; Freeman, Mark D.; Gubarev, Mikhail V.; Kolodziejczak, Jeffrey J.; hide

    2011-01-01

    Future x-ray observatories will require high-resolution (less than 1 inch) optics with very-large-aperture (greater than 25 square meter) areas. Even with the next generation of heavy-lift launch vehicles, launch-mass constraints and aperture-area requirements will limit the surface areal density of the grazing-incidence mirrors to about 1 kilogram per square meter or less. Achieving sub-arcsecond x-ray imaging with such lightweight mirrors will require excellent mirror surfaces, precise and stable alignment, and exceptional stiffness or deformation compensation. Attaining and maintaining alignment and figure control will likely involve adaptive (in-space adjustable) x-ray optics. In contrast with infrared and visible astronomy, adaptive optics for x-ray astronomy is in its infancy. In the middle of the past decade, two efforts began to advance technologies for adaptive x-ray telescopes: The Generation-X (Gen-X) concept studies in the United States, and the Smart X-ray Optics (SXO) Basic Technology project in the United Kingdom. This paper discusses relevant technological issues and summarizes progress toward adaptive x-ray telescopes.

  13. Higher coherent x-ray laser

    International Nuclear Information System (INIS)

    Hasegawa, Noboru; Nagashima, Keisuke; Kawachi, Tetsuya

    2001-01-01

    X-ray lasers generated by an ultra short pulse laser have advantages such as monochromatic, short pulse duration, small beam divergence, high intensity, and coherence. Spatial coherence is most important for applications, we have investigated the transient collisional excitation (TCE) scheme x-ray laser lasing from Ne-like titanium (31.6 nm), Ne-like silver (13.9 nm) and tin (11.9 nm). However, the spatial coherence was not so good with this scheme. We have been studying to improve the spatial coherence of the x-ray laser and have proposed to use coherent seed light tuned to the x-ray laser wavelength generated from higher harmonics generation (HHG), which is introduced to the x-ray laser medium (Ne-like titanium, Ni-like silver plasmas). We present about the theoretical study of the coupling efficiency HHG light with x-ray laser medium. (author)

  14. X-ray detector

    International Nuclear Information System (INIS)

    Whetten, N.R.; Houston, J.M.

    1977-01-01

    An ionization chamber for use in determining the spatial distribution of x-ray photons in tomography systems comprises a plurality of substantially parallel, planar anodes separated by parallel, planar cathodes and enclosed in a gas of high atomic weight at a pressure from approximately 10 atmospheres to approximately 50 atmospheres. The cathode and anode structures comprise metals which are substantially opaque to x-ray radiation and thereby tend to reduce the resolution limiting effects of x-ray fluoresence in the gas. In another embodiment of the invention the anodes comprise parallel conductive bars disposed between two planar cathodes. Guard rings eliminate surface leakage currents between adjacent electrodes. 8 figures

  15. Collimatorless imaging of gamma rays with help of gamma-ray tracking

    CERN Document Server

    Marel, J V D

    2001-01-01

    In many gamma-ray detector systems that are built for imaging purposes Compton scattered photons are suppressed as much as possible. However, the information from photons that scattered inside a detector system can be used to reconstruct the tracks of the photons with help of gamma-ray tracking. Estimates of the incident directions of the photons can be made and an image can be created. Examples of potential applications for this technique are the use as a gamma-camera in medical imaging (e.g. SPECT) or as a detector for PET. Due to the omission of collimators, much higher detection efficiencies can be achieved, reducing the doses required for an image. A gamma-ray tracking method, called backtracking, has been developed for nuclear spectroscopy. The method tracks gamma-rays originating from a point source in the center of a spherical detector system consisting of position-sensitive germanium detectors. This method can also be used as a tracking technique for imaging of an unknown source distribution. With he...

  16. Jyotiranjan S Ray

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Jyotiranjan S Ray. Articles written in Journal of Earth System Science. Volume 109 Issue 1 March 2000 pp 39-47. Emplacement of Amba Dongar Carbonatite-alkaline Complex at Cretaceous/Tertiary Boundary: Evidence from 40Ar-39Ar Chronology · Jyotiranjan S Ray ...

  17. X-ray luminescent glasses

    International Nuclear Information System (INIS)

    Takahashi, T.; Yamada, O.

    1981-01-01

    X-ray luminescent glasses comprising a divalent cation such as an alkaline earth metal or other divalent cations such as pb, cd, or zn, and certain rare earth metaphosphates are suitable as vitreous, x-ray phosphors or x-ray luminescent glass fibers in an x-ray intensifying screen. The glasses have the composition n(Mo X p2o5)((1-y)tb2o3 X yce2o3 X 3p2o5) wherein N is greater than zero but less than or equal to 16, M is an alkaline earth metal or other divalent cation such as pb, cd, or zn, and Y is greater than or equal to zero but less than one

  18. Duodenal X-ray diagnostics

    International Nuclear Information System (INIS)

    Scheppach, W.

    1982-01-01

    The publication provides an overview of duodenal X-ray diagnostics with the aid of barium meals in 1362 patients. The introducing paragraphs deal with the topographic anatomy of the region and the methodics of X-ray investigation. The chapter entitled ''processes at the duodenum itself'' describes mainly ulcers, diverticula, congenital anomalies, tumors and inflammations. The neighbourhood processes comprise in the first place diseases having their origin at the pancreas and bile ducts. As a conclusion, endoscopic rectograde cholangio-pancreaticography and percutaneous transhepatic cholangiography are pointed out as advanced X-ray investigation methods. In the annex of X-ray images some of the described phenomena are shown in exemplary manner. (orig./MG) [de

  19. Gamma-Ray Astronomy Technology Needs

    Science.gov (United States)

    Gehrels, N.; Cannizzo, J. K.

    2012-01-01

    In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.

  20. Cosmic ray: Studying the origin

    International Nuclear Information System (INIS)

    Szabelski, J.

    1997-01-01

    Investigations of the origin of cosmic rays are presented. Different methods are discussed: studies of cosmic gamma rays of energy from 30 MeV to about 10 15 eV (since photons point to their places of origin), studies of the mass composition of cosmic rays (because it reflects source morphology), and studies of cosmic rays with energy above 1O 19 eV (for these are the highest energies observed in nature). (author)

  1. The X-ray Astronomy Recovery Mission

    Science.gov (United States)

    Tashiro, M.; Kelley, R.

    2017-10-01

    On 25 March 2016, the Japanese 6th X-ray astronomical satellite ASTRO-H (Hitomi), launched on February 17, lost communication after a series of mishap in its attitude control system. In response to the mishap the X-ray astronomy community and JAXA analyzed the direct and root cause of the mishap and investigated possibility of a recovery mission with the international collaborator NASA and ESA. Thanks to great effort of scientists, agencies, and governments, the X-ray Astronomy Recovery Mission (XARM) are proposed. The recovery mission is planned to resume high resolution X-ray spectroscopy with imaging realized by Hitomi under the international collaboration in the shortest time possible, simply by focusing one of the main science goals of Hitomi Resolving astrophysical problems by precise high-resolution X-ray spectroscopy'. XARM will carry a 6 x 6 pixelized X-ray micro-calorimeter on the focal plane of an X-ray mirror assembly, and an aligned X-ray CCD camera covering the same energy band and wider field of view, but no hard X-ray or soft gamma-ray instruments are onboard. In this paper, we introduce the science objectives, mission concept, and schedule of XARM.

  2. Gravitational Waves versus X and Gamma Ray Emission in a Short Gamma-Ray Burst

    OpenAIRE

    Oliveira, F. G.; Rueda, Jorge A.; Ruffini, Remo

    2012-01-01

    The recent progress in the understanding the physical nature of neutron star equilibrium configurations and the first observational evidence of a genuinely short gamma-ray burst, GRB 090227B, allows to give an estimate of the gravitational waves versus the X and Gamma-ray emission in a short gamma-ray burst.

  3. Small scale soft x-ray lasers

    International Nuclear Information System (INIS)

    Skinner, C.H.; DiCicco, D.S.; Kim, D.; Voorhees, D.; Suckewer, S.

    1990-01-01

    The widespread application of soft x-ray laser technology is contingent on the development of small scale soft x-ray lasers that do not require large laser facilities. Progress in the development of soft x-ray lasers pumped by a Nd laser of energy 6-12J is reported below. Application of an existing soft x-ray laser to x-ray microscopy has begun. A soft x-ray laser of output energy 1-3 mJ at 18,2 nm has been used to record high resolution images of biological specimens. The contact images were recorded on photoresist which was later viewed in a scanning electron microscope. The authors present a composite optical x-ray laser microscope design

  4. Resonance γ-ray polarimetry

    International Nuclear Information System (INIS)

    Gonser, U.; Fischer, H.

    1981-01-01

    The topics are: Intensity and polarization of radiation in Moessbauer transitions, hyperfine interactions in 57 Fe, polarized γ-rays, polarimetry, γ-ray rotation polarimeters, Birefringence polarimetry. (WL)

  5. Observing Solvation Dynamics with Simultaneous Femtosecond X-ray Emission Spectroscopy and X-ray Scattering

    DEFF Research Database (Denmark)

    Haldrup, Kristoffer; Gawelda, Wojciech; Abela, Rafael

    2016-01-01

    and structural changes, and local solvent structural changes are desired. We have studied the intra- and intermolecular dynamics of a model chromophore, aqueous [Fe(bpy)3]2+, with complementary X-ray tools in a single experiment exploiting intense XFEL radiation as a probe. We monitored the ultrafast structural...... rearrangement of the solute with X-ray emission spectroscopy, thus establishing time zero for the ensuing X-ray diffuse scattering analysis. The simultaneously recorded X-ray diffuse scattering atterns reveal slower subpicosecond dynamics triggered by the intramolecular structural dynamics of the photoexcited...

  6. X-Ray Exam: Neck (For Parents)

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Neck KidsHealth / For Parents / X-Ray Exam: ... Neck Enlarged Adenoids Croup Sinusitis Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  7. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Hillier, R.

    1984-01-01

    The book reviews the development of gamma ray astronomy over the past twenty five years. A large section of the book is devoted to the problems of background radiation and the design of detectors. Gamma rays from the sun, the galactic disc, the galaxy, and extra galactic sources; are also discussed. (U.K.)

  8. Femtosecond X-ray Absorption Spectroscopy at a Hard X-ray Free Electron Laser

    DEFF Research Database (Denmark)

    Lemke, Henrik T.; Bressler, Christian; Chen, Lin X.

    2013-01-01

    X-ray free electron lasers (XFELs) deliver short (current (SASE based) XFELs, they can be used for measuring high......-quality X-ray absorption data and we report femtosecond time-resolved X-ray absorption near-edge spectroscopy (XANES) measurements of a spin-crossover system, iron(II) tris(2,2'-bipyridine) in water. The data indicate that the low-spin to high-spin transition can be modeled by single-exponential kinetics...

  9. Cryotomography x-ray microscopy state

    Science.gov (United States)

    Le Gros, Mark; Larabell, Carolyn A.

    2010-10-26

    An x-ray microscope stage enables alignment of a sample about a rotation axis to enable three dimensional tomographic imaging of the sample using an x-ray microscope. A heat exchanger assembly provides cooled gas to a sample during x-ray microscopic imaging.

  10. Cosmic-ray-veto detector system

    International Nuclear Information System (INIS)

    Miller, D.W.; Menlove, H.O.

    1992-12-01

    To reduce the cosmic-ray-induced neutron background, we are testing a cosmic-ray veto option with a neutron detector system that uses plastic scintillator slabs mounted on the outside of a 3 He-tube detector. The scintillator slabs eliminate unwanted cosmic-ray events, enabling the detector to assay low-level plutonium samples, for which a low-background coincident signature is critical. This report describes the design and testing of the prototype cosmic-ray-veto detector system

  11. Handbook of X-Ray Data

    CERN Document Server

    Zschornack, Günter

    2007-01-01

    This sourcebook is intended as an X-ray data reference for scientists and engineers working in the field of energy or wavelength dispersive X-ray spectrometry and related fields of basic and applied research, technology, or process and quality controlling. In a concise and informative manner, the most important data connected with the emission of characteristic X-ray lines are tabulated for all elements up to Z = 95 (Americium). This includes X-ray energies, emission rates and widths as well as level characteristics such as binding energies, fluorescence yields, level widths and absorption edges. The tabulated data are characterized and, in most cases, evaluated. Furthermore, all important processes and phenomena connected with the production, emission and detection of characteristic X-rays are discussed. This reference book addresses all researchers and practitioners working with X-ray radiation and fills a gap in the available literature.

  12. Gamma-ray burst polarimeter (GAP)

    International Nuclear Information System (INIS)

    Mihara, Tatehiro; Murakami, Toshio; Yonetoku, Daisuke; Gunji, Shuichi; Kubo, Shin

    2013-01-01

    The gamma-ray burst polarimeter (GAP: GAmma-ray burst Polarimeter), which had been almost handcrafted by scientists, has succeeded in working normally in interplanetary space, and in detecting the polarization of the gamma-ray from a mysterious astronomical object 'gamma-ray burst'. It is the first result of the detectors in the world exclusively aiming at detecting gamma-ray polarization. We mainly describe the hardware of our GAP equipment and show the method of preparing equipment to work in the cosmic space with a tight budget. The mechanical structure, the electronic circuits, the software on the equipment, the data analysis on the earth, and the scientific results gained by the observation just over one year, are presented after explaining the principle of gamma-ray polarization detection. Our design to protect equipment against mechanical shock and cosmic radiation may provide useful information for future preparation of compact satellite. (J.P.N.)

  13. Characterization of Metalloproteins and Biomaterials by X-ray Absorption Spectroscopy and X-ray Diffraction

    DEFF Research Database (Denmark)

    Frankær, Christian Grundahl

    This thesis presents thework on combining complementary X-rays techniques for studying the structures of proteins and other biomaterials, and consists of three different projects: (i) Characterization of protein powders with X-ray powder diffraction (XRPD). (ii) The combination of X-ray...... crystallography and X-ray absorption spectroscopy (XAS) applied to studying different hexameric insulin conformations. (iii) The structures of polymorphs of strontium ranelate and the distribution of strontium in bone tissue. A procedure for fast identification and verification of protein powders using XRPD...... was correction for disordered bulk-solvent, but also correction for background and optimization of unit cell parameters have to be taken into account. A sample holder was designed for collecting powder diffraction data on a standard laboratory X-ray powder diffractometer. The background was reduced by use...

  14. Mn(II), Zn(II) and VO(II) Schiff

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 113; Issue 3. Synthesis and characterisation of Cu(II), Ni(II), Mn(II), Zn(II) and VO(II) Schiff base complexes derived from o-phenylenediamine and acetoacetanilide. N Raman Y Pitchaikani Raja A Kulandaisamy. Inorganic Volume 113 Issue 3 June 2001 pp 183-189 ...

  15. Optical detection of sodium salts of fluoride, acetate and phosphate

    Indian Academy of Sciences (India)

    Optical detection of sodium salts of fluoride, acetate and phosphate by a diacylhydrazine ligand by the formation of a colour alkali metal complex. Purnandhu Bose Ranjan Dutta I ... Department of Inorganic Chemistry, Indian Association for the Cultivation of Science, 2A and 2B Raja S C Mullick Road, Kolkata 700032, India ...

  16. Runtime buffer management to improve the performance in irregular ...

    Indian Academy of Sciences (India)

    S¯adhan¯a Vol. 40, Part 4, June 2015, pp. 1117–1137. c Indian Academy of Sciences. Runtime buffer management to improve the performance in irregular Network-on-Chip architecture. UMAMAHESWARI S1,∗, MEGANATHAN D2 and. RAJA PAUL PERINBAM J3. 1Department of Information Technology, Anna University, ...

  17. Physics design of a 10 MeV, 6 kW travelling wave electron linac

    Indian Academy of Sciences (India)

    We present the physics design of a 10 MeV, 6 kW S-band (2856 MHz) electron linear accelerator (linac), which has been recently built and successfully operated at Raja Ramanna Centre for Advanced Technology, Indore. The accelerating structure is a 2 π / 3 mode constant impedance travelling wave structure, which ...

  18. SMM hard X-ray observations of the soft gamma-ray repeater 1806-20

    Science.gov (United States)

    Kouveliotou, C.; Norris, J. P.; Cline, T. L.; Dennis, B. R.; Desai, U. D.; Orwig, L. E.

    1987-01-01

    Six bursts from the soft gamma-ray repeater (SGR) 1806-20 have been recorded with the SMM Hard X-ray Burst Spectrometer during a highly active phase in 1983. Rise and decay times of less than 5 ns have been detected. Time profiles of these events indicate low-level emission prior to and after the main peaks. The results suggest that SGRs are distinguished from classical gamma-ray bursts by repetition, softer nonvarying spectra, short durations, simple temporal profiles, and a tendency for source locations to correlate with Population I objects. SGR characteristics differ from those of type I X-ray bursts, but they appear to have similarities with the type II bursts from the Rapid Burster.

  19. SMM hard X-ray observations of the soft gamma-ray repeater 1806-20

    International Nuclear Information System (INIS)

    Kouveliotou, C.; Norris, J.P.; Cline, T.L.; Dennis, B.R.; Desai, U.D.; Orwig, L.E.

    1987-01-01

    Six bursts from the soft gamma-ray repeater (SGR) 1806-20 have been recorded with the SMM Hard X-ray Burst Spectrometer during a highly active phase in 1983. Rise and decay times of less than 5 ns have been detected. Time profiles of these events indicate low-level emission prior to and after the main peaks. The results suggest that SGRs are distinguished from classical gamma-ray bursts by repetition, softer nonvarying spectra, short durations, simple temporal profiles, and a tendency for source locations to correlate with Population I objects. SGR characteristics differ from those of type I X-ray bursts, but they appear to have similarities with the type II bursts from the Rapid Burster. 19 references

  20. Observation of superheavy primary cosmic ray nuclei with solid state track detectors and x-ray films

    International Nuclear Information System (INIS)

    Doke, Tadayoshi; Hayashi, Takayoshi; Ito, Kensai; Yanagimachi, Tomoki; Kobayashi, Shigeru.

    1977-01-01

    The measurements of energy spectra and the nuclear charge distribution of superheavy nuclei heavier than iron in primary cosmic ray can provide information on the origin, propagation and life time of the cosmic ray. Since incident particles are in the region of relativistic velocity (the low energy cosmic ray below the cutoff energy is forbidden from entering), the charges of cosmic ray nuclei can be determined without knowing the energy of particles. The balloon-borne solid state track detector and plastic and X-ray films were employed for the detection of superheavy cosmic ray, and the five events were detected with the cellulose nitrate film. The flux of superheavy nuclei is predicted from the present analysis. (Yoshimori, M.)

  1. Solar Coronal Events with Extended Hard X-ray and Gamma-ray Emission

    Science.gov (United States)

    Hudson, H. S.

    2017-12-01

    A characteristic pattern of solar hard X-ray emission, first identified in SOL1969-03-31 by Frost & Dennis (1971) now has been linked to prolonged high-energy gamma-ray emission detected by the Fermi/LAT experiment, for example in SOL2014-09-01. The distinctive features of these events include flat hard X-ray spectra extending well above 100 keV, a characteristic pattern of time development, low-frequency gyrosynchrotron peaks, CME association, and gamma-rays identifiable with pion decay originating in GeV ions. The identification of these events with otherwise known solar structures nevertheless remains elusive, in spite of the wealth of imagery available from AIA. The quandary is that these events have a clear association with CMEs in the high corona, and yet the gamma-ray production implicates the photosphere itself. The vanishingly small loss cone in the nominal acceleration region makes this extremely difficult. I propose direct inward advection of a part of the SEP particle population, as created on closed field structures, as a possible resolution of this puzzle, and note that this requires retracting magnetic structures on long time scales following the flare itself.

  2. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose control methods to minimize stray (scatter) radiation. This ensures that ...

  3. Cone-beam x-ray luminescence computed tomography based on x-ray absorption dosage

    Science.gov (United States)

    Liu, Tianshuai; Rong, Junyan; Gao, Peng; Zhang, Wenli; Liu, Wenlei; Zhang, Yuanke; Lu, Hongbing

    2018-02-01

    With the advances of x-ray excitable nanophosphors, x-ray luminescence computed tomography (XLCT) has become a promising hybrid imaging modality. In particular, a cone-beam XLCT (CB-XLCT) system has demonstrated its potential in in vivo imaging with the advantage of fast imaging speed over other XLCT systems. Currently, the imaging models of most XLCT systems assume that nanophosphors emit light based on the intensity distribution of x-ray within the object, not completely reflecting the nature of the x-ray excitation process. To improve the imaging quality of CB-XLCT, an imaging model that adopts an excitation model of nanophosphors based on x-ray absorption dosage is proposed in this study. To solve the ill-posed inverse problem, a reconstruction algorithm that combines the adaptive Tikhonov regularization method with the imaging model is implemented for CB-XLCT reconstruction. Numerical simulations and phantom experiments indicate that compared with the traditional forward model based on x-ray intensity, the proposed dose-based model could improve the image quality of CB-XLCT significantly in terms of target shape, localization accuracy, and image contrast. In addition, the proposed model behaves better in distinguishing closer targets, demonstrating its advantage in improving spatial resolution.

  4. Trace rare earth analysis by neutron activation and γ-ray/x-ray spectrometry

    International Nuclear Information System (INIS)

    Laul, J.C.; Nielson, K.K.; Wogman, N.A.

    1977-01-01

    A rare earth group separation scheme followed by photon energy analysis using Ge(Li) and intrinsic Ge detectors enhances significantly the detection of individual rare earth elements (REE) at or below the ppb level. Based on the x-ray and selected γ-ray energies, Ge(Li) γ-ray counting is favorable for 140 La, 141 Ce, 142 Pr, 153 Sm, 171 Er, and 177 Lu, whereas intrinsic Ge γ-ray counting is favorable for 143 Ce, 147 Nd, 160 Tb, and 166 Ho, and intrinsic Ge x-ray counting is favorable for 152 Eu and 175 Yb. Gamma-ray counting of 153 Gd and 170 Tm is equally sensitive with Ge(Li) or intrinsic Ge detectors. Precise measurements of the REE were made in the USGS geological samples BCR-1, W-1, AGV-1, G2, GSP-1 and PCC-1, the IAEA Soil-5, and the NBS orchard leaf and bovine liver standards. Their chondritic normalized REE patterns behave as a smooth function of the REE ionic radii. Interestingly, the REE patterns observed in orchard leaf and other plants are identical to the REE pattern in bovine liver. This comparison leads us to suggest that the plant REE patterns are probably not further fractionated by animals such as bovine during their dietary plant uptake

  5. X-ray Studies of Unidentified Galactic TeV Gamma-ray Sources

    Science.gov (United States)

    Pühlhofer, Gerd

    2009-05-01

    Many of the recently discovered Galactic TeV sources remain unidentified to date. A large fraction of the sources is possibly associated with relic pulsar wind nebula (PWN) systems. One key question here is the maximum energy (beyond TeV) attained in the compact PWNe. Hard X-ray emission can trace those particles, but current non-focussing X-ray instruments above 10 keV have difficulties to deconvolve the hard pulsar spectrum from its surrounding nebula. Some of the new TeV sources are also expected to originate from middle-aged and possibly even from old supernova remnants (SNR). But no compelling case for such an identification has been found yet. In established young TeV-emitting SNRs, X-ray imaging above 10 keV could help to disentangle the leptonic from the hadronic emission component in the TeV shells, if secondary electrons produced in hadronic collisions can be effectively detected. As SNRs get older, the high energy electron component is expected to fade away. This may allow to verify the picture through X-ray spectral evolution of the source population. Starting from the lessons we have learned so far from X-ray follow-up observations of unidentified TeV sources, prospects for Simbol-X to resolve open questions in this field will be discussed.

  6. X-ray Studies of Unidentified Galactic TeV Gamma-ray Sources

    International Nuclear Information System (INIS)

    Puehlhofer, Gerd

    2009-01-01

    Many of the recently discovered Galactic TeV sources remain unidentified to date. A large fraction of the sources is possibly associated with relic pulsar wind nebula (PWN) systems. One key question here is the maximum energy (beyond TeV) attained in the compact PWNe. Hard X-ray emission can trace those particles, but current non-focussing X-ray instruments above 10 keV have difficulties to deconvolve the hard pulsar spectrum from its surrounding nebula.Some of the new TeV sources are also expected to originate from middle-aged and possibly even from old supernova remnants (SNR). But no compelling case for such an identification has been found yet. In established young TeV-emitting SNRs, X-ray imaging above 10 keV could help to disentangle the leptonic from the hadronic emission component in the TeV shells, if secondary electrons produced in hadronic collisions can be effectively detected. As SNRs get older, the high energy electron component is expected to fade away. This may allow to verify the picture through X-ray spectral evolution of the source population.Starting from the lessons we have learned so far from X-ray follow-up observations of unidentified TeV sources, prospects for Simbol-X to resolve open questions in this field will be discussed.

  7. X-ray diagnostic in gas discharge

    International Nuclear Information System (INIS)

    Chen Suhe; Wang Dalun; Cui Gaoxian; Wang Mei; Fu Yibei; Zhang Xinwei; Zhang Wushou

    1995-01-01

    X rays were observed when the anomalous phenomenon in the metal loaded with deuterium studied by the gas-discharge method. Therefore the X-ray energy spectra were measured by the absorption method, the specific X-ray approach and the NaI scintillation counter, while X-ray intensity was estimated by using 7 Li thermoluminescent foils. The X-ray average energy measured by the absorption method is 27.6 +- 2.1 keV, which is fitted within the error extent to 26.0 +-2.4 keV monoenergetic X rays measured by the NaI scintillation counter

  8. Flash x-ray cinematography

    International Nuclear Information System (INIS)

    Stein, W.E.

    1976-01-01

    Experiments intended to provide an overview of the potential capabilities and limitations of flash x-ray cinematography as a diagnostic technique for a Fast Reactor Safety Test Facility are described. The results provide estimates of the x-ray pulse intensity required to obtain adequate radiographs of an array of fuel pins in a typical reactor configuration. An estimate of the upper limit on the pulse duration imposed by the reactor background radiation was also determined. X-ray cinematography has been demonstrated at a repetition rate limited only by the recording equipment on hand at the time of these measurements. These preliminary results indicate that flash x-ray cinematography of the motion of fuel in a Fast Reactor Test Facility is technically feasible

  9. Miniature x-ray source

    Science.gov (United States)

    Trebes, James E.; Bell, Perry M.; Robinson, Ronald B.

    2000-01-01

    A miniature x-ray source utilizing a hot filament cathode. The source has a millimeter scale size and is capable of producing broad spectrum x-ray emission over a wide range of x-ray energies. The miniature source consists of a compact vacuum tube assembly containing the hot filament cathode, an anode, a high voltage feedthru for delivering high voltage to the cathode, a getter for maintaining high vacuum, a connector for initial vacuum pump down and crimp-off, and a high voltage connection for attaching a compact high voltage cable to the high voltage feedthru. At least a portion of the vacuum tube wall is fabricated from highly x-ray transparent materials, such as sapphire, diamond, or boron nitride.

  10. Low energy (soft) x rays

    International Nuclear Information System (INIS)

    Hoshi, Masaharu; Antoku, Shigetoshi; Russell, W.J.; Miller, R.C.; Nakamura, Nori; Mizuno, Masayoshi; Nishio, Shoji.

    1987-05-01

    Dosimetry of low-energy (soft) X rays produced by the SOFTEX Model CMBW-2 was performed using Nuclear Associates Type 30 - 330 PTW, Exradin Type A2, and Shonka-Wyckoff ionization chambers with a Keithley Model 602 electrometer. Thermoluminescent (BeO chip) dosimeters were used with a Harshaw Detector 2000-A and Picoammeter-B readout system. Beam quality measurements were made using aluminum absorbers; exposure rates were assessed by the current of the X-ray tube and by exposure times. Dose distributions were established, and the average factors for non-uniformity were calculated. The means of obtaining accurate absorbed and exposed doses using these methods are discussed. Survival of V79 cells was assessed by irradiating them with soft X rays, 200 kVp X rays, and 60 Co gamma rays. The relative biological effectiveness (RBE) values for soft X rays with 0, 0.2, 0.7 mm added thicknesses of aluminum were 1.6, which were compared to 60 Co. The RBE of 200 kVp X rays relative to 60 Co was 1.3. Results of this study are available for reference in future RERF studies of cell survival. (author)

  11. X-ray astronomy

    International Nuclear Information System (INIS)

    Giacconi, R.; Setti, G.

    1980-01-01

    This book contains the lectures, and the most important seminars held at the NATO meeting on X-Ray astronomy in Erice, July 1979. The meeting was an opportune forum to discuss the results of the first 8-months of operation of the X-ray satellite, HEAO-2 (Einstein Observatory) which was launched at the end of 1978. Besides surveying these results, the meeting covered extragalactic astronomy, including the relevant observations obtained in other portions of the electromagnetic spectrum (ultra-violet, optical, infrared and radio). The discussion on galactic X-ray sources essentially covered classical binaries, globular clusters and bursters and its significance to extragalactic sources and to high energy astrophysics was borne in mind. (orig.)

  12. Radionuclide X-ray fluorescence analysis

    International Nuclear Information System (INIS)

    Cechak, T.

    1994-01-01

    The author's achievements in the title field are summarized and discussed. The following topics are dealt with: (i) principles of radionuclide X-ray fluorescence analysis; (ii) mathematical methods in X-ray fluorescence analysis; (iii) Ross differential filters; (iv) application of radionuclide X-ray fluorescence analysis in the coal industry (with emphasis on the determination of the ash content, sulfur content, and arsenic content of coal); and (v) evaluation of the X-ray fluorescence analyzer from the radiological safety point of view. (P.A.)

  13. Cosmic ray: Studying the origin

    Energy Technology Data Exchange (ETDEWEB)

    Szabelski, J. [Cosmic Ray Laboratory, Soltan Institute for Nuclear Studies, Lodz (Poland)

    1997-12-31

    Investigations of the origin of cosmic rays are presented. Different methods are discussed: studies of cosmic gamma rays of energy from 30 MeV to about 10{sup 15} eV (since photons point to their places of origin), studies of the mass composition of cosmic rays (because it reflects source morphology), and studies of cosmic rays with energy above 1O{sup 19} eV (for these are the highest energies observed in nature). (author) 101 refs, 19 figs, 7 tabs

  14. Diffracted X-ray tracking: new system for single molecular detection with X-rays

    CERN Document Server

    Sasaki, Y C; Adachi, S; Suzuki, Y; Yagi, N

    2001-01-01

    We propose a new X-ray methodology for direct observations of the behaviors of single molecular units in real time and real space. This new system, which we call Diffracted X-ray Tracking (DXT), monitors the Brownian motions of a single molecular unit by observations of X-ray diffracted spots from a nanocrystal, tightly bound to the individual single molecular unit in bio-systems. DXT does not determine any translational movements, but only orientational movements.

  15. Diffracted X-ray tracking: new system for single molecular detection with X-rays

    International Nuclear Information System (INIS)

    Sasaki, Y.C.; Okumura, Y.; Adachi, S.; Suzuki, Y.; Yagi, N.

    2001-01-01

    We propose a new X-ray methodology for direct observations of the behaviors of single molecular units in real time and real space. This new system, which we call Diffracted X-ray Tracking (DXT), monitors the Brownian motions of a single molecular unit by observations of X-ray diffracted spots from a nanocrystal, tightly bound to the individual single molecular unit in bio-systems. DXT does not determine any translational movements, but only orientational movements

  16. Soft X-ray radiation damage in EM-CCDs used for Resonant Inelastic X-ray Scattering

    Science.gov (United States)

    Gopinath, D.; Soman, M.; Holland, A.; Keelan, J.; Hall, D.; Holland, K.; Colebrook, D.

    2018-02-01

    Advancement in synchrotron and free electron laser facilities means that X-ray beams with higher intensity than ever before are being created. The high brilliance of the X-ray beam, as well as the ability to use a range of X-ray energies, means that they can be used in a wide range of applications. One such application is Resonant Inelastic X-ray Scattering (RIXS). RIXS uses the intense and tuneable X-ray beams in order to investigate the electronic structure of materials. The photons are focused onto a sample material and the scattered X-ray beam is diffracted off a high resolution grating to disperse the X-ray energies onto a position sensitive detector. Whilst several factors affect the total system energy resolution, the performance of RIXS experiments can be limited by the spatial resolution of the detector used. Electron-Multiplying CCDs (EM-CCDs) at high gain in combination with centroiding of the photon charge cloud across several detector pixels can lead to sub-pixel spatial resolution of 2-3 μm. X-ray radiation can cause damage to CCDs through ionisation damage resulting in increases in dark current and/or a shift in flat band voltage. Understanding the effect of radiation damage on EM-CCDs is important in order to predict lifetime as well as the change in performance over time. Two CCD-97s were taken to PTB at BESSY II and irradiated with large doses of soft X-rays in order to probe the front and back surfaces of the device. The dark current was shown to decay over time with two different exponential components to it. This paper will discuss the use of EM-CCDs for readout of RIXS spectrometers, and limitations on spatial resolution, together with any limitations on instrument use which may arise from X-ray-induced radiation damage.

  17. X-Ray-Driven Gamma Emission

    International Nuclear Information System (INIS)

    Carroll, J. J.; Karamian, S. A.; Rivlin, L. A.; Zadernovsky, A. A.

    2001-01-01

    X-ray-driven gamma emission describes processes that may release nuclear energy in a 'clean' way, as bursts of incoherent or coherent gamma rays without the production of radioactive by-products. Over the past decade, studies in this area, as a part of the larger field of quantum nucleonics, have gained tremendous momentum. Since 1987 it has been established that photons could trigger gamma emission from a long-lived metastable nuclear excited state of one nuclide and it appears likely that triggering in other isotopes will be demonstrated conclusively in the near future. With these experimental results have come new proposals for the creation of collective and avalanche-like incoherent gamma-ray bursts and even for the ultimate light source, a gamma-ray laser. Obviously, many applications would benefit from controlled bursts of gamma radiation, whether coherent or not. This paper reviews the experimental results and concepts for the production of gamma rays, driven by externally produced X-rays

  18. The universe in X-rays

    CERN Document Server

    Hasinger, Günther

    2008-01-01

    In the last 45 years, X-ray astronomy has become an integral part of modern astrophysics and cosmology. There is a wide range of astrophysical objects and phenomena, where X-rays provide crucial diagnostics. In particular they are well suited to study hot plasmas and matter under extreme physical conditions in compact objects. This book summarizes the present status of X-ray astronomy in terms of observational results and their astrophysical interpretation. It is written for students, astrophysicists as well a growing community of physicists interested in the field. An introduction including historical material is followed by chapters on X-ray astronomical instrumentation. The next two parts summarize in 17 chapters the present knowledge on various classes of X-ray sources in the galactic and extragalactic realm. While the X-ray astronomical highlights discussed in this book are mainly based on results from ROSAT, ASCA, RXTE, BeppoSAX, Chandra and XMM-Newton, a final chapter provides an outlook on observation...

  19. X-rays utilization

    International Nuclear Information System (INIS)

    Rebigan, F.

    1979-03-01

    The modality of X-ray utilization in different activities and economy is given. One presents firstly quantities and units used in radiation dosimetry and other fields. One gives the generation of X-rays, their properties as well as the elements of radiation protection. The utilization characteristics of these radiations in different fields are finally given. (author)

  20. Relative probabilities of the uranium isotopes for thorium x-ray emission and fluorescence of uranium x-rays

    International Nuclear Information System (INIS)

    Parker, J.L.

    1991-01-01

    Both thorium x-rays from decaying uranium isotopes and self-fluoresced uranium x-rays are prominent in high-resolution gamma-ray spectra of uranium-bearing materials. Useful application of the information carried by those x-rays has been curtailed because the probabilities of the uranium isotopes for thorium x-ray emission and for uranium x-ray fluorescence have not been known. By analyzing enrichment-meter geometry spectra from uranium oxide standards whose enrichments ranged from 0.7% to 91%, relative values, primarily, have been obtained for the probabilities of both processes. Thorium x-ray emission is very heavily dominated by 235 U. In all ordinarily occurring uranium isotopic distributions, thorium x-rays may be used as a valid 235 U signature. The probability for a thorium K α1 x-ray to be emitted in the decay of a 235 U atom is 0.048 ±0.002. In infinitely thick uranium oxide materials, the relative ratios of effectiveness for self-fluorescence, on a per unit mass basis, are approximately 234 U : 235 U : 236 U : 238 U = 1.13 : 1.00 : 0.52 : 0.028. on a per decay basis, the approximate ratios are 0.00039 : 1.00 : 0.017 : 0.18. These results imply that, contrary to what has often been stated, gamma rays are far more important than alpha particles in the self-fluorescence of uranium. Because of the importance of gamma-ray self-fluorescence, the uranium x-ray yield will be somewhat influenced by the size, shape, and composition of the materials. 4 refs., 1 fig