
Sample records for ray raja clavata

  1. Characterization and isolation of DNA microsatellite primers in Raja clavata L. (thornback ray, Rajidae)

    NARCIS (Netherlands)

    Chevolot, M; Reusch, TBH; Boele-Bos, S; Stam, WT; Olsen, JL

    The thornback ray, Raja clavata, is an elasmobranch (cartilaginous fish). Since the 1950s, its stock has severely declined. In order to investigate the genetic population structure of the species, we developed microsatellite loci. The five loci reported here have eight to 48 alleles per locus and

  2. Reproductive biology of Raja clavata (Elasmobranchii: Rajidae) from Southern Black Sea coast around Turkey (United States)

    Saglam, Hacer; Ak, Orhan


    Specimens of Raja clavata were monthly collected at the coast of Havaalanı (Trabzon/Turkey) from January 2009 to December 2009 at depths between 20 and 40 m. A total of 230 individuals of thornback ray (131 females and 99 males) were collected by bottom trawls during research cruises. Using logistic regression, it was determined that TL at 50% maturity of males was 718 mm TL and of females 746 mm TL. The ovarian fecundity ranged from 27 to 60 yellow follicles in both ovaries. Females carrying egg cases were found in July and October. Variations in the gonadosomatic and hepatosomatic indices indicated a continuous reproductive cycle during the year.

  3. Bioaccumulation of metals and PCBs in Raja clavata. (United States)

    Torres, Paulo; Tristão da Cunha, Regina; Micaelo, Cristina; Rodrigues, Armindo Dos Santos


    The goal of this study was to assess stable isotopes profiles, metals concentration and PCBs in Raja clavata muscle and liver, according to sex and size, and to elucidate its suitability as a Mid-Atlantic biomonitor. The results reflected bioaccumulation and suggested biomagnification processes for As and Hg in muscle tissue. Cd, Cu and Zn were detected in high amounts in liver, Cr, Mn and Rb were relatively stable and low, Pb was not detected and Sr was present in muscle at high levels, decreasing with length. Hg and Se were strongly correlated, suggesting a mitigation role. Both tissues presented low concentrations of PCBs, especially the dioxin-like congeners, although always higher in liver and not correlated with size. None of these contaminants exceed EU legislated limits. However, they need to be monitored given study area's location, volcanic nature and the expected increase of anthropogenic activity related to future prospective mining activities and the establishment of the Transatlantic Trade and Investment Partnership (TTIP) between Europe and the USA. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Modelling the spatial distribution of plaice ( Pleuronectes platessa), sole ( Solea solea) and thornback ray ( Raja clavata) in UK waters for marine management and planning (United States)

    Maxwell, D. L.; Stelzenmüller, V.; Eastwood, P. D.; Rogers, S. I.


    Species distribution maps are needed for ecosystem-based marine management including the development of marine spatial plans. If such maps are based on predictive models then modelling procedures should aim to maximise validation success, and any uncertainty in the predictions needs to be made explicit. We developed a predictive modelling approach to produce robust maps of the distributions of selected marine species at a regional scale. We used 14 years of survey data to map the distributions of plaice, sole and thornback ray in three hydrographic regions comprising parts of the Irish Sea, Celtic Sea and the English Channel with the help of the hybrid technique regression kriging, which combines regression models with geostatistical tools. For each species-region combination we constructed logistic Generalized Linear Models (GLMs) based on presence-absence data using the environmental variables: depth, bottom temperature, bed shear stress and sediment type, as predictors. We selected GLMs using the mean squared error of prediction (MSEP) estimated by cross-validation then conducted a geostatistical analysis of the residuals to incorporate spatial structure in the predictions. In general, we found that species occurrence was positively related to shallow areas, a bed shear stress of between 0 and 1.5 N/m 2, and the presence of sandy sediment. Predicted species occurrence probabilities were in good agreement with survey observations. This modelling framework selects environmental models based on predictive ability and considers the effect of spatial autocorrelation on predictions, together with the simultaneous presentation of observations, associated uncertainties, and predictions. The potential benefit of these distribution maps to marine management and planning is discussed.

  5. Recovery of Proteolytic and Collagenolytic Activities from Viscera By-products of Rayfish (Raja clavata

    Directory of Open Access Journals (Sweden)

    José Antonio Vázquez


    Full Text Available The aim of this work was to study the recovery of proteolytic and collagenolytic activities from rayfish (Raja clavata viscera wastes. Initially, different parts of the gastrointestinal tract by-products (stomach, duodenum section including pancreas, final intestine were evaluated. The extracts from proximal intestine yielded the highest values of both enzymatic activities. Optimal conditions for protease activity quantification were established at pH = 6, T = 40 °C and incubation time ≤20 min. The mathematical equation used to model the joint effect of pH and temperature led to maximum activity at pH = 8.66 and 59.4 °C, respectively. Overcooled acetone was found to be best option for recovery of enzymatic activities in comparison with ethanol, PEG-4000, ammonium sulphate and ultrafiltration system. Finally, a simple and systematic protocol of partial purification and total recovery of proteases and collagenases was defined.

  6. Multiple paternity analysis in the thornback ray Raja clavata L.

    NARCIS (Netherlands)

    Chevolot, Malia; Ellis, Jim R.; Rijnsdorp, Adriaan D.; Stam, Wytze T.; Olsen, Jeanine L.


    Skates (Rajidae) are characterized by slow growth rate, low fecundity, and late maturity and are thus considered to be vulnerable to exploitation. Although understanding mating systems and behavior are important for long-term conservation and fisheries management, this aspect of life history is

  7. Multiple paternity analysis in the Thornback Ray Raja clavata L.

    NARCIS (Netherlands)

    Chevolot, M.; Ellis, J.R.; Rijnsdorp, A.D.; Stam, W.T.; Olsen, J.L.


    Skates (Rajidae) are characterized by slow growth rate, low fecundity, and late maturity and are thus considered to be vulnerable to exploitation. Although understanding mating systems and behavior are important for long-term conservation and fisheries management, this aspect of life history is

  8. E S Raja Gopal

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. E S Raja Gopal. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 4 April 2000 pp 37-45 General Article. Critical Opalescence · E S Raja Gopal · More Details Fulltext PDF. Volume 6 Issue 5 May 2001 pp 16-28 General Article.

  9. RAJA Performance Suite

    Energy Technology Data Exchange (ETDEWEB)


    The RAJA Performance Suite is designed to evaluate performance of the RAJA performance portability library on a wide variety of important high performance computing (HPC) algorithmic lulmels. These kernels assess compiler optimizations and various parallel programming model backends accessible through RAJA, such as OpenMP, CUDA, etc. The Initial version of the suite contains 25 computational kernels, each of which appears in 6 variants: Baseline SequcntiaJ, RAJA SequentiaJ, Baseline OpenMP, RAJA OpenMP, Baseline CUDA, RAJA CUDA. All variants of each kernel perform essentially the same mathematical operations and the loop body code for each kernel is identical across all variants. There are a few kernels, such as those that contain reduction operations, that require CUDA-specific coding for their CUDA variants. ActuaJ computer instructions executed and how they run in parallel differs depending on the parallel programming model backend used and which optimizations are perfonned by the compiler used to build the Perfonnance Suite executable. The Suite will be used primarily by RAJA developers to perform regular assessments of RAJA performance across a range of hardware platforms and compilers as RAJA features are being developed. It will also be used by LLNL hardware and software vendor panners for new defining requirements for future computing platform procurements and acceptance testing. In particular, the RAJA Performance Suite will be used for compiler acceptance testing of the upcoming CORAUSierra machine {initial LLNL delivery expected in late-2017/early 2018) and the CORAL-2 procurement. The Suite will aJso be used to generate concise source code reproducers of compiler and runtime issues we uncover so that we may provide them to relevant vendors to be fixed.

  10. Mohamed Mahroop, Raja M.

    African Journals Online (AJOL)

    Mohamed Mahroop, Raja M. Vol 15, No 38 (2016) - Articles Antibacterial potential of silver nanoparticle synthesized by marine actinomycetes in reference with standard antibiotics against hospital acquired infectious pathogens. Abstract PDF. ISSN: 1684-5315. AJOL African Journals Online. HOW TO USE AJOL.

  11. Rediscovery of Bugulella clavata Hincks 1887 (Ectoprocta)

    Digital Repository Service at National Institute of Oceanography (India)

    Menon, N.R; Nair, N.B.

    The species Bugulella clavata collected from the Krusadai island, Gulf of Mannar is redescribed Description is based on the three fragments of a colony at a depth of 5 m Redescription has helped to important features such as nature and shape...

  12. DNA barcoding unveils skate (Chondrichthyes: Rajidae) species diversity in 'ray' products sold across Ireland and the UK. (United States)

    Griffiths, Andrew Mark; Miller, Dana D; Egan, Aaron; Fox, Jennifer; Greenfield, Adam; Mariani, Stefano


    Skates are widely consumed across the globe, but many large species are subject to considerable concern regarding their conservation and management. Within Europe such issues have recently driven policy changes so that, for the first time, reports of skate landings now have to be made under species-specific names. Total allowable catches have also been established for many groups, which have been set to zero for a number of the most vulnerable species (e.g., Dipturus batis, Raja undulata and Rostoraja alba). Whilst accurate species identification has become an important issue for landings, the sale of skates is still usually made under a blanket term of "skate" or "ray". The matter of identifying species of skate is further complicated by their morphologically conservative nature and the fact that they are commercially valued for their wings. Thus, before sale their bodies are usually discarded (i.e., "winged") and often skinned, making morphological identification impossible. For the first time, DNA barcoding (of the mitochondrial COI gene) was applied to samples of skate wings from retail outlets across the British Isles, providing insight into which species are sold for consumption. A total of 98 wing samples were analysed, revealing that six species were sold; blonde ray (Raja brachyura), spotted ray (Raja montagui), thornback ray (Raja clavata), cuckoo ray (Leucoraja naevus) small-eyed ray (Raja microocellata) and shagreen ray (Leucoraja fullonica). Statistical testing demonstrated that there were significant differences in the species sold in the distinct retail groups which suggests complex drivers behind the patterns of sale in skates. The results also indicate that endangered species are not commonly being passed on to consumers. In addition, the practice of selling skate wings under ambiguous labels is highlighted as it makes it extremely difficult for consumers to exercise a right to avoid species of conservation concern. Interestingly, a single retailer

  13. Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ESR(CLE)-like effector proteins. These proteins have been shown to act as ligand mimics of plant CLE peptides and are required for successful nematode infection; however, the receptors for nematode CLE-like peptides have not been identified. Her...

  14. Synergistic interaction of CLAVATA1, CLAVATA2, and RECEPTOR-LIKE PROTEIN KINASE 2 in cyst nematode parasitism of Arabidopsis (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ENDOSPERM SURROUNDING REGION (ESR) (CLE)-like effector proteins. These proteins act as ligand mimics of plant CLE peptides and are required for successful nematode infection. Previously, we showed that CLV2 and CORYNE (CRN), a heterodimer recept...

  15. Penanganan Abrasi Pantai Desa Sei Raja Kabupaten Sukamara Kalimantan Tengah


    Aziz, Mustofa Kamal; Lesmi, Seruni Adidar; Pranoto, Sumbogo; Parmantoro, Priyo Nugroho


    The problems of the coastal area in Sei Raja Beach were retreat of the coastline, sedimentation in river mouth of Raja River, destruction of existing shore protection structure such as groin and jetty which was caused of wave. The objective of the final project is to model and to design the right shore structures to protect the shore from abrasion in Sei Raja Beach. The area which planned is around 3,1 km include the river mouth of Raja River. The analysis result of waverose shows that domina...

  16. Raja Servus of Larantuka, Flores, Eastern Indonesia Le raja Servus de Larantuka, à Flores, en Indonésie orientale

    Directory of Open Access Journals (Sweden)

    Robert H. Barnes


    Full Text Available The Dutch deposed Raja Lorenzo II of Larantuka, Flores, in 1904 and exiled him to Java. After his son Servus reached maturity, they appointed him Raja. By then the office had largely been reduced to a principally administrative function at the bottom of the colonial bureaucracy, although the Dutch called the rajas in the Dutch East Indies “self-governors”.Servus seems to have been demoralized by an attack on his life which he survived only after six hours of swimming in the sea. Eventually both the Dutch officials and the local Catholic missionaries became dissatisfied with him and he was forced to resign. Later the Dutch were forced to leave and the Indonesian state completed the job of bureaucratizing local administration by abolishing the office of raja.Les Hollandais ont déposé le raja Lorenzo II de Larantuka en 1904 et l’ont exilé à Java. Lorsque son fils Servus a atteint sa maturité, ils l’ont nommé raja. Alors, le poste avait été largement réduit à une fonction surtout administrative au bas de la bureaucratie coloniale, même si les Hollandais appelaient les rajas des Indes orientales Hollandaises « gouverneurs autonomes ». Servus semble avoir perdu le moral après une agression à laquelle il ne survécut qu’après une nage de six heures dans la mer. Au final, il déçut à la fois les fonctionnaires hollandais et les missionnaires catholiques locaux qui l’obligèrent à démissionner. Par la suite, les Hollandais furent contraints au départ et l’état indonésien termina le travail de bureaucratisation de l’administration locale en mettant fin à la fonction de raja.

  17. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata


    Elahi, Robin


    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in w...

  18. Raja asterias population assessment in FAO GFCM GSA17 area

    Directory of Open Access Journals (Sweden)

    C. FERRÀ


    Full Text Available Population structure and distribution of the starry ray, Raja asterias, were described based on data collected during yearly rapido trawl surveys (SoleMon, between 2005 and 2014 in the Northern and Central Adriatic Sea. A total of 306 individuals were caught, sex ratio was 1.04:1 in favor of males and length-weight relationships were obtained for the whole sample. Following the MEDITS scale, maturity was estimated, observing a higher number of immature individuals. Relative abundance significantly increased during the recent period with the highest values recorded at 5-30 m depths. Such increase could be related to the response of R. asterias to climatic change or to the decrease  in fishing pressure in the area. Clear spatial segregation of individuals depending on their life stage was observed, with immature individuals inhabiting the coastal areas and adults more abundant at depths greater than 40 m. The comparison of the result of the present study with MEDITS survey outcomes in terms of  distribution patterns, persistence areas of adults and juveniles and abundances indices, evidences that SoleMon survey seems to be more suitable in defining such features of the stock, likely due to the greater catchability of the rapido trawl in respect to the MEDITS trawl net. However, further investigations are needed to identify factors affecting the increasing abundance of this species, and develop an action plan for spatial management of fishing activities.

  19. Raja klooster Peipsi ääres Raja külas / Olev Suuder

    Index Scriptorium Estoniae

    Suuder, Olev, 1949-


    Peipsi-äärsete vene vanausuliste küladest, kirikutest, Raja kloostrist. Palvela projekteeris 1902. a. W. Schilling, 1912. a. ehitati viie kupliga kirik. Ikoonimaalija Gavriil Jefimovitsh Frolovist (1854-1939), kes avas palvelas ikoonimaalimiskooli ja maalis uue kiriku ikonostaasi. Palvela fassaadide restaureerimisest, kiriku vundamendi ja põranda konserveerimisest, haljastuse kujundamisest. Uuringud: Maret Eimre, Kaja Onton. Arhitektuurne projekt: K. Onton. Teostus: Wunibald. Kirik ja kirikuaed: eritingimused ja haljastusprojekt: Kati Niibo. Teostus: Cobra Grupp. Muinsuskaitseline järelevalve: Olev Suuder. 6 ill

  20. An insecticidal toxin from Nephila clavata spider venom. (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong


    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  1. A new Eastern Central Atlantic skate Raja parva sp. nov. (Rajoidei: Rajidae) belonging to the Raja miraletus species complex. (United States)

    Last, Peter R; Séret, Bernard


    An investigation of combined CO1 and NADH2 data for rajid skates referable to Raja miraletus provided evidence that populations ranging from southern Africa to the North-East Atlantic and Mediterranean Sea, once considered to represent a cline, belong to a species complex consisting of at least four valid species. Raja miraletus appears to be confined to the Mediterranean Sea, and the North-East Atlantic from the Bay of Biscay south to Morocco and Madeira. The southernmost species, referable to the resurrected Raja ocellifera, occurs off southern Africa, off Namibia and from False Bay to Durban (South Africa). Two species occur off tropical West Africa, including Raja parva sp. nov. (Senegal, Liberia and Angola but is probably more widespread within the region), and another unidentified species needing further investigation. Raja cf. miraletus, confirmed from Mauritania and Senegal, appears to be a larger skate with a broader disc, more broadly pointed snout, larger spiracles, and a slightly longer and broader tail. Raja parva sp. nov. differs from nominal members of the complex in having an unusually long procaudal tail (exceeding 22% TL), as well as a combination of other external characters. Past investigators observed morphological and anatomical differences between these forms but these were thought to be due to intraspecific variability. They postulated that an upwelling at Cape Blanco (21°N) may have isolated the Mediterranean form (R. miraletus) from Mauritania-Senegal form (now known to be two species). Similarly, the Benguela Current and upwelling off Cape Frio (18°S) were thought to be responsible for separating the Angolan form (R. parva) and South African form (R. ocellifera).


    Directory of Open Access Journals (Sweden)

    Wachid Eko Purwanto


    Full Text Available Epos Ramayana merupakan epos kuno yang ditulis dalam tujuh kanda terdiri atas 24.000 sloka. Di Jawa epos Ramayana pertama kali muncul secara lengkap dalam bentuk relief di Candi Lara Jonggrang yang dibangun sekitar tahun 782 hingga 872 M. Epos tua yang hidup di masyarakat Jawa ini pastilah mempunyai ajaran. Tokoh Rama sebagai tokoh utama merupakan simbol paling utama dalam epos ini. Berkait dengan simbol ajaran, tokoh Rama dalam epos Ramayana Jawa mempunyai fungsi bagi Raja Jawa dan masyarakat Jawa. Bagi raja simbol tokoh Rama memiliki tiga fungsi utama. Pertama sebagai fungsi spiritual. Kedua adalah fungsi legitimasi kekuasaan. Ketiga adalah fungsi pencitraan. Adapun bagi masyarakat Jawa, simbol tokoh Rama memiliki dua fungsi utama. Pertama adalah fungsi spiritual. Kedua adalah fungsi filosofis.

  3. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata. (United States)

    Elahi, Robin


    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in wet and dry habitat; significantly more colonies were found in dry habitat. Seventeen of 19 nests built on slopes of > 5 degrees inclination were positioned on the downward side of the tree, possibly using the trunk as a shield against runoff during rain showers. Moisture and pH inside nests were significantly different from adjacent soil. These results suggest that water influences the ground nesting habits of P. clavata, thus ecological differences between comparatively wet and dry portions of tropical forests may arise from the relative abundance of this ant species.

  4. To drink or grasp? How bullet ants ( Paraponera clavata) differentiate between sugars and proteins in liquids (United States)

    Jandt, Jennifer; Larson, Hannah K.; Tellez, Peter; McGlynn, Terrence P.


    Flexibility in behavior can increase the likelihood that a forager may respond optimally in a fluctuating environment. Nevertheless, physiological or neuronal constraints may result in suboptimal responses to stimuli. We observed foraging workers of the giant tropical ant (also referred to as the "bullet ant"), Paraponera clavata, as they reacted to liquid solutions with varying concentrations of sugar and protein. We show that when protein/sucrose concentration is high, many bullet ants will often try to grasp at the droplet, rather than gather it by drinking. Because P. clavata actively hunt for prey, fixed action patterns and rapid responses to protein may be adaptively important, regardless of the medium in which it is presented. We conclude that, in P. clavata, food-handling decisions are made in response to the nutrient content of the food rather than the texture of the food. Further, we suggest that colonies that maintain a mixture of individuals with consistent fixed or flexible behavioral responses to food-handling decisions may be better adapted to fluctuating environmental conditions, and we propose future studies that could address this.

  5. Checklist of Macroalgae in Waisai Coast, Raja Ampat

    Directory of Open Access Journals (Sweden)

    Retno Suryandari


    Full Text Available Macroalgae are very abundant organisms in Indonesian coastal zone. They comprise 8.6% of the total marine organisms.The aim of the research was to identify macroalgae in Waisai Coast Raja Ampat. The results showed that 38 macroalgae were found in Waisai Coast Raja Ampat but only 29 species of macroalgae can be identified. Macroalgae found in Waisai Coast Raja Ampat are green algae, red algae and brown algae. Green algae found and identified are Caulerpa macra (Weber-van Bosse Draisma & Prud’homme, Caulerpa racemosa var. macrophysa (Sonder wx Kutzing W.R.Taylor,  Caulerpa sertularoides (S. Gmelin Howe f. brevipes (J. Agardh Svedilus, Caulerpa cupressoides (Vahl C. Agardh, Halimeda discoidea Decaisne, Halimeda Opuntia (Linnaeus J.V. Lamoroux, Halimeda tuna (J. Ellis & Solander J.V. Lamoroux, Halimeda cylindraceae Decaisne, Halimeda macroloba Decaisne, Avrainvillea erecta (Berkeley A. Gepp & E.S. Gepp, Codium geppiorum O.C.Schmidt, Boergesenia forbesii (Hardvey Feldmann, Valonia ventricosa J. Agardh, Dictyosphaeria cavernosa (Forsskål Børgesen, Chaetomorpha spiralisOkamura, Anadyomene wrightii Harvey ex. J. E. Gray, Neomeris annulata Dickie. Red algae species found and successfully identified areAcanthophora spicifera (M. Vahl Børgesen, Laurencia papilosa (C. Agardh Greville, Gracilaria salicornia (C. Agardh E.Y. Dawson, Amphiora fragilissima (Linnaeus J.V. Lamoroux, Hypnea pannosa J. Agardh. Brown algae species  found and identified are Hormophysa cuneiformis (J.F. Gmelin P.C. Silva, Sargassum aquifolium (Turner C. Agardh, Sargassum polycystum C. Agardh, Turbinaria ornata (Turner J. Agardh, Padina australis Hauck, Canistrocarpus cervicornis (Kutzing De Paula & De Clerck Hydroclathrus clatratus (C. Agardh M. Howe. The only species found in Indonesia is Sargassum aquifolium.

  6. Life history and viability of a long-lived marine invertebrate: the octocoral Paramuricea clavata. (United States)

    Linares, Cristina; Doak, Daniel F; Coma, Rafel; Díaz, David; Zabala, Mikel


    The red gorgonian Paramuricea clavata is a long-lived, slow-growing sessile invertebrate of ecological and conservation importance in the northwestern Mediterranean Sea. We develop a series of size-based matrix models for two Paramuricea clavata populations. These models were used to estimate basic life history traits for this species and to evaluate the viability of the red gorgonian populations we studied. As for many other slow-growing species, sensitivity and elasticity analysis demonstrate that gorgonian population growth is far more sensitive to changes in survival rates than to growth, shrinkage, or reproductive rates. The slow growth and low mortality of red gorgonians results in low damping ratios, indicating slow convergence to stable size structures (at least 50 years). The stable distributions predicted by the model did not differ from the observed ones. However, our simulations point out the fragility of this species, showing both populations in decline and high risk of extinction over moderate time horizons. These declines appear to be related to a recent increase in anthropogenic disturbances. Relative to their life span, the values of recruitment elasticity for Paramuricea clavata are lower than those reported for other marine organisms but are similar to those reported for some long-lived plants. These values and the delayed age of sexual maturity, in combination with the longevity of the species, show a clear fecundity/mortality trade-off. Full demographic studies of sessile marine species are quite scarce but can provide insight into population dynamics and life history patterns for these difficult and under-studied species. While our work shows clear results for the red gorgonian, the variability in some of our estimates suggest that future work should include data collection over longer temporal and spatial scales to better understand the long-term effects of natural and anthropogenic disturbances on red gorgonian populations.

  7. Eile avati Harku vallas Raja tööstuskeskuse uus juurdepääsutee

    Index Scriptorium Estoniae


    Kahe Harku valla ettevõtte algatusel ja riigi toel sai Raja tööstuskeskus Tabasalus kaasaegse juurdepääsutee, rahastasid Ettevõtluse Arendamise Sihtasutus ning eraettevõtted Greiner Packaging ja Palmatin

  8. Bilirubin metabolism in the spiny dogfish, Squalus acanthias, and the small skate, Raja erinacea

    NARCIS (Netherlands)

    Jansen, P. L.; Arias, I. M.


    1. The main bilirubin conjugate in bile of spiny dogfish (Squalus Acanthias) and small skate (Raja Erinacea) is bilirubin monoglucuronide. 2. Microsomal preparations from dogfish and small skate liver have similar bilirubin UDPglucuronyltransferase (UDPGT) activity and catalyze the conjugation of

  9. Solid-phase synthesis and biological evaluation of Joro spider toxin-4 from Nephila clavata

    DEFF Research Database (Denmark)

    Barslund, Anne Fuglsang; Poulsen, Mette Homann; Bach, Tinna Brøbech


    Polyamine toxins from orb weaver spiders are attractive pharmacological tools particularly for studies of ionotropic glutamate (iGlu) receptors in the brain. These polyamine toxins are biosynthesized in a combinatorial manner, providing a plethora of related, but structurally complex toxins...... to be exploited in biological studies. Here, we have used solid-phase synthetic methodology for the efficient synthesis of Joro spider toxin-4 (JSTX-4) (1) from Nephila clavata, providing sufficient amounts of the toxin for biological evaluation at iGlu receptor subtypes using electrophysiology. Biological...

  10. Organizational Conflict In Local Management Budget Planning In Raja Ampat Regency

    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT Local government leadership in Raja Ampat based on the writers observation yet effectively perform conflict resolution organizations in the area of financial management. This is evident from the acquisition of predicate disclaimer that occur repeatedly. Disclaimer predicate occurs repeatedly in the area of financial management in Raja Ampat because the local government leadership has not been effective in reducing conflicts that have a negative effect on the performance of individuals and the performance of positions in all SKPDs not implementing more effective management strategies in order to moderate the conflict related to disagreements about the task policy and other organizational issues and less effective in stimulating the learning process SKPDs level with regard to financial management area. Based on the above description organizational conflict studies in the area of financial management in Raja Ampat is important and urgent to do. The importance of this study because of financial management in Raja Ampat still face the task of conflict situations and conflict relations in the budget planning. The purpose of this study is to 1 Describe the forms of organizational conflicts in planning budget in Raja Ampat.2 Describe the sources of conflict in the organization of planning budget in Raja Ampat. 3 Analyze the conflict resolution organizations in planning budget in Raja Ampat. Based on several conclusions can be drawn as follows 1In the budget planning are forms of task conflict and relationship conflict. 2 Sources of conflict in the budget planning is the difference in the organizations goals criteria that do not work worth it and the inequality of treatment between sub-units. 3 Conflict resolution is a budget planning by providing an understanding of the meaning-Term Development Plan and the area and ask for advice and input from the Regent to accommodate the pricing to be more flexible to adjust to market conditions and the

  11. A quantification of predation rates, indirect positive effects on plants, and foraging variation of the giant tropical ant, Paraponera clavata

    Directory of Open Access Journals (Sweden)

    Lee A. Dyer


    Full Text Available While a clear consensus is emerging that predators can play a major role in shaping terrestrial communities, basic natural history observations and simple quantifications of predation rates in complex terrestrial systems are lacking. The potential indirect effect of a large predatory ant, Paraponera clavata Fabricius (Formicidae: Ponerinae, on herbivores was determined on rainforest trees at La Selva Biological Station in Costa Rica and Barro Colorado Island in Panama. Prey and other food brought back to nests by 75 colonies of P. clavata were quantified, taking into account temporal, seasonal, and microhabitat variation for both foraging activity and composition of foraging booty. The dispersion and density of ant colonies and combined density with the mean amounts of prey retrieval were used to calculate rates of predation per hectare in the two forests. In addition, herbivory was measured on trees containing P. clavata and on trees where the ants were not foraging. Colonies at La Selva brought back significantly more nectar plus prey than those at Barro Colorado Island, but foraging patterns were similar in the two forests. At both forests, the ants were more active at night, and there was no significant seasonal or colonial variation in consumption of nectar, composition of foraging booty, and overall activity of the colonies. At La Selva, trees containing P. clavata colonies had the same levels of folivory as nearest neighbor trees without P. clavata but had significantly lower folivory than randomly selected trees. Predation by this ant was high in both forests, despite its omnivorous diet. This insect predator is part of potentially important top-down controls in these wet and moist forests.

  12. Synthesis, X-ray crystal structure, DNA binding and Nuclease activity ...

    Indian Academy of Sciences (India)

    s12039-016-1125-x. Synthesis, X-ray crystal structure, DNA binding and Nuclease activity of lanthanide(III) complexes of 2-benzoylpyridine acetylhydrazone. KARREDDULA RAJA, AKKILI SUSEELAMMA and KATREDDI HUSSAIN REDDY. ∗.

  13. Gaya Komunikasi Pemasaran di Pemerintah: Promotion Mix Destinasi Tujuan Wisata Kabupaten Raja Ampat

    Directory of Open Access Journals (Sweden)

    Mubaddilah Rafa'al


    Full Text Available This study focuses on the description of Promotion marketing mix used by the Department of Culture and Tourism Raja Ampat. This research is interesting because it is a means of marketing communications for the company in order to inform the products to be introduced to tourists, persuade and improve the consumer directly or indirectly about the services they offer. This study aimed to describe the promotion mix used the Department of Culture and Tourism Raja Ampat. In order to know that the Department of Culture and Tourism Raja Ampat has managed to reach the desired rating. The method used in this study using in-depth interview, the quotation in question and answer activities between researchers and resource speakers. With respect to achieving success in the marketing process, the Department of Culture and Tourism Raja Ampat using promotion mix include advertising, sales promotion, public relations, personal selling, direct marketing, and internet marketing.   Keywords: Promotion mix, tourists, Department of Culture and Tourism Raja Ampat

  14. Ammolagena clavata (Jones and Parker, 1860), an agglutinated benthic foraminiferal species - first report from the Recent sediments, Arabian Sea, Indian Ocean region

    Digital Repository Service at National Institute of Oceanography (India)

    Nigam, R.; Mazumder, A.; Saraswat, R.

    The rare presence of the agglutinated foraminiferal species Ammolagena clavata is presented for the first time from the Recent sediments of the Indian Ocean region. This species has previously been reported in Recent sediments from all other oceans...

  15. Raja ja Kallas - mehed Šebrle selja taga / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-


    Üheteistkümnendat korda toimuval Reval Hotels Cupi mitmevõistlusel on pearollis elav legend tšehh Roman Šebrle, kellega Eesti parematest hakkavad rinda pistma Andres Raja ja Madis Kallas. Lisa: Reval Cupi ajaloo paremad tulemused

  16. The biology of the skates raja wallacei and r.pullopunctata (batoidea ...

    African Journals Online (AJOL)

    Aspects of the biology of Raja wallacei and R. pullopunctata were investigated using data collected in 1995 and 1996 from research and commercial trawls on the Agulhas Bank, South Africa. Age and growth parameters were investigated by examination of bands on the vertebral centrum. Estimates of Von Bertalanffy ...

  17. CLAVATA3-like genes are differentially expressed in grape vine (Vitis vinifera) tissues. (United States)

    Tominaga-Wada, Rumi; Nukumizu, Yuka; Wada, Takuji; Sawa, Shinichiro; Tetsumura, Takuya


    The CLAVATA3 (CLV3)/endosperm surrounding region [(ESR) CLE] peptides function as intercellular signaling molecules that regulate various physiological and developmental processes in diverse plant species. We identified five CLV3-like genes from grape vine (Vitis vinifera var. Pinot Noir): VvCLE 6, VvCLE 25-1, VvCLE 25-2, VvCLE 43 and VvCLE TDIF. These CLV3-like genes encode short proteins containing 43-128 amino acids. Except VvCLE TDIF, grape vine CLV3-like proteins possess a consensus amino acid sequence known as the CLE domain. Phylogenic analysis suggests that the VvCLE 6, VvCLE25-1, VvCLE25-2 and VvCLE43 genes have evolved from a single common ancestor to the Arabidopsis CLV3 gene. Expression analyses showed that the five grape CLV3-like genes are expressed in leaves, stems, roots and axillary buds with significant differences in their levels of expression. For example, while all of them were strongly expressed in axillary buds, VvCLE6 and VvCLE43 expression prevailed in roots, and VvCLE25-1, VvCLE25-2 and VvCLE TDIF expression in stems. The differential expression of the five grape CLV3-like peptides suggests that they play different roles in different organs and developmental stages. Copyright © 2013 Elsevier GmbH. All rights reserved.

  18. Relationship between radiocesium contamination and the contents of various elements in the web spider Nephila clavata (Nephilidae: Arachnida)

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato


    The accident at the Fukushima Dai-ichi nuclear power plant seriously contaminated a large area in northeast Japan with a large amount of radioactive material. Consequently, various organisms, including arthropods, in the ecosystem have been contaminated with radiocesium ("1"3"7Cs) through the food chain. We previously showed that the web spider Nephila clavata was contaminated with "1"3"7Cs and that the level of contamination, which varied among spider individuals, was independent of the amount of prey consumed. The present study aimed to clarify the mechanisms that could determine the level of "1"3"7Cs contamination in N. clavata. We first demonstrated the patterns of contents of over 30 elements in N. clavata that were collected at two forest sites (PS and ES) in Fukushima and then focused on the relationships between the contents of the alkali metals Li, Na, K, and Rb and the accumulation of "1"3"7Cs in the spiders; Cs is an alkali metal and is expected to act similarly to Li, Na, K, and Rb. We also focused on the content of the non-alkali element, Cu, which is an essential element for oxygen transport in spiders. We found that Na content correlated positively with "1"3"7Cs accumulation at both sites, which suggested that "1"3"7Cs accumulation in N. clavata was related with the dynamics of Na. The K–, Rb–, and Cu–"1"3"7Cs relationships were site specific; the relationships were significant at site PS, but not significant at site ES. Factors causing the site specific relationships and the probable pathway for "1"3"7Cs transfer from soil to plants and then to higher trophic levels are discussed in terms of the transfer processes of the alkali metals. - Highlights: • Accumulation of "1"3"7Cs and various elements in web spiders was investigated. • "1"3"7Cs accumulation positively correlated with that of K, Rb, Na, and Cu. • Accumulation of alkali metals determined the level of "1"3"7Cs contamination. • K–, Rb–, Cu–"1"3"7Cs relationships were

  19. Recent progress in accelerator activities at Raja Ramanna Centre for Advanced Technology, Indore

    International Nuclear Information System (INIS)

    Gupta, P.D.


    Raja Ramanna Centre for Advanced Technology, Indore is a premier national institute engaged in R and D work in front-line areas of accelerator science, technology, and applications. The Centre has designed, developed, and commissioned two synchrotron radiation sources: Indus-1 and Indus-2, serving as national facilities. The Centre is pursuing various other accelerator activities viz. development of a high energy proton accelerator for a spallation neutron source, electron accelerators for food irradiation and industrial applications and free electron lasers (FEL) in THz and IR spectral region, study of innovative schemes of laser driven electron acceleration, and development of advanced technologies to support these activities such as superconducting RF (SCRF) technology, cryogenics, RF power, magnets, ultra high vacuum and control instrumentation. In this talk, an overview of the progress made in accelerator activities at Raja Ramanna Centre for Advanced Technology in recent years is be presented

  20. The complete mitochondrial genome of the Longnose skate: Raja rhina (Rajiformes, Rajidae). (United States)

    Jeong, Dageum; Lee, Youn-Ho


    The complete sequence of mitochondrial DNA of a longnose skate, Raja rhina was determined for the first time. It is 16,910 bp in length containing 2 rRNA, 22 tRNA and 13 protein coding genes with the same gene order and structure as those of other Rajidae species. The nucleotide of L-strand is composed of 30.1% A, 27.2% C, 28.5% T and 14.2% G, showing a slight A + T bias. The G is the least used base and markedly lower at the third codon position (5.4%). Twelve of the 13 protein coding genes use ATG as their start codon while the COX1 starts with GTG. As for stop codon, only ND4 shows incomplete stop codon TA. This mitogenome is the first report for a species of the genus Raja, and providing a valuable resource of genetic information for understanding the phylogenetic relationship and the evolution of the genus Raja as well as the family, Rajidae.

  1. Occurrence of the Leech, Pontobdella muricata Linnaeus, on Elasmobranch Species in the Northern and Central Adriatic Sea. (United States)

    Bolognini, Luca; Leoni, Simone; Polidori, Piero; Grati, Fabio; Scarcella, Giuseppe; Pellini, Giulio; Domenichetti, Filippo; Ferrà, Carmen; Fabi, Gianna


    This study provides a parasitological analysis of the elasmobranch species caught in the northern and central Adriatic Sea. Sixty-two marine leeches were recorded on 747 individuals of Raja clavata Linnaeus, 1758 (thornback ray), Myliobatis aquila Linnaeus, 1758 (common eagle ray), and Torpedo marmorata Risso, 1810 (marbled torpedo ray) caught in 56 hauls over a 5 yr period. All leeches were identified as Pontobdella muricata, which is a typical ectoparasite of benthic elasmobranchs. The prevalence of infection ranged from 7.11% on R. clavata to 12.00% on M. aquila. The intensity of infection, the preferential sites of attachment to the host, and the periodicity of infection were evaluated.

  2. Nephila clavata L Koch, the Joro Spider of East Asia, newly recorded from North America (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    E. Richard Hoebeke


    Full Text Available Nephila clavata L Koch, known as the Joro spider and native to East Asia (Japan, China, Korea, and Taiwan, is newly reported from North America. Specimens from several locations in northeast Georgia were collected from around residential properties in Barrow, Jackson, and Madison counties in late October and early November 2014. These are the first confirmed records of the species in the New World. Our collections, along with confirmed images provided by private citizens, suggest that the Joro spider is established in northeast Georgia. Genomic sequence data for the COI gene obtained from two specimens conforms to published sequences for N. clavata, providing additional confirmation of species identity. Known collection records are listed and mapped using geocoding. Our observations are summarized along with published background information on biology in Asia and we hypothesize on the invasion history and mode of introduction into North America. Recognition features are given and photographic images of the male and female are provided to aid in their differentiation from the one native species of the genus (Nephila clavipes in North America.

  3. In planta processing and glycosylation of a nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-like effector and its interaction with a host CLAVATA2-like receptor to promote parasitism. (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S; Mitchum, Melissa G; Wang, Xiaohong


    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. © 2015 American Society of Plant Biologists. All Rights Reserved.

  4. In Planta Processing and Glycosylation of a Nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-Like Effector and Its Interaction with a Host CLAVATA2-Like Receptor to Promote Parasitism1[OPEN (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S.; Mitchum, Melissa G.


    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. PMID:25416475

  5. Application of Cold Storage for Raja Sere Banana (Musa acuminata colla) (United States)

    Crismas, S. R. S.; Purwanto, Y. A.; Sutrisno


    Raja Sere is one of the indigenous banana cultivars in Indonesia. This cultivar has a yellow color when ripen, small size and sweet taste. Traditionally, the growers market this banana cultivar to the market without any treatment to delay the ripening process. Banana fruits are commonly being harvested at the condition of hard green mature. At this condition of hard green mature, banana fruits can be stored for a long-term period. The objective of this study was to examine the effect of cold storage on the quality of raja sere banana that stored at 13°C. Banana fruits cultivar Raja Sere were harvested from local farmer field at the condition of hard green mature (about 14 weeks age after the flower bloom). Fifteen bunches of banana were stored in cold storage with a temperature of 13°C for 0, 3, 6, 9, and 12 days, respectively. For the control, room temperature storage (28°C) was used. At a storage period, samples of banana fruits ripened in the ripening chamber by injecting 100 ppm of ethylene gas at 25°C for 24 hours. The quality parameters namely respiration rate, hardness, total soluble solids (TSS), change in color, and weight loss were measured. For those banana fruits stored at room temperature, the shelf-life of banana was only reached up to 6 days. For those banana fruits stored in cold storage, the condition of banana fruits was reached up to 12 days. After cold storage and ripening, the third day measurement was the optimal time for bananas to be consumed which indicated by the yellow color (lightness value = 68.51, a* = 4.74 and value b* = 62.63), TSS 24.30 °Brix and hardness 0.48 kgf, weight loss about 7.53-16.45% and CO2 respiration rate of 100.37 mLCO2 /

  6. Preliminary observations on the effects of selenate on the development of the embryonic skate, Raja eglanteria (United States)

    Conrad, G. W.; Luer, C. A.; Paulsen, A. Q.; Funderburgh, J. L.; Spooner, B. S. (Principal Investigator)


    Morphogenesis of the clearnose skate, Raja eglanteria, was not significantly inhibited as a result of 7 days of exposure to 1-2 mM selenate in the sea water during Days 59-69 of embryonic development (hatching would normally have occurred at 82 +/- 4 days of incubation). Although corneal transparency appeared normal in the eye, preliminary measurements of the thickness of Bowman's layer of the cornea suggested that it was significantly thinner in the corneas of embryos exposed to 1-2 mM selenate. Selenate is an ion reported to inhibit sulfation of glycosaminoglycans in connective tissue.

  7. Transient shifts in bacterial communities associated with the temperate gorgonian Paramuricea clavata in the Northwestern Mediterranean Sea.

    Directory of Open Access Journals (Sweden)

    Marie La Rivière

    Full Text Available BACKGROUND: Bacterial communities that are associated with tropical reef-forming corals are being increasingly recognized for their role in host physiology and health. However, little is known about the microbial diversity of the communities associated with temperate gorgonian corals, even though these communities are key structural components of the ecosystem. In the Northwestern Mediterranean Sea, gorgonians undergo recurrent mass mortalities, but the potential relationship between these events and the structure of the associated bacterial communities remains unexplored. Because microbial assemblages may contribute to the overall health and disease resistance of their host, a detailed baseline of the associated bacterial diversity is required to better understand the functioning of the gorgonian holobiont. METHODOLOGY/PRINCIPAL FINDINGS: The bacterial diversity associated with the gorgonian Paramuricea clavata was determined using denaturing gradient gel electrophoresis, terminal-restriction fragment length polymorphism and the construction of clone libraries of the bacterial 16S ribosomal DNA. Three study sites were monitored for 4 years to assess the variability of communities associated with healthy colonies. Bacterial assemblages were highly dominated by one Hahellaceae-related ribotype and exhibited low diversity. While this pattern was mostly conserved through space and time, in summer 2007, a deep shift in microbiota structure toward increased bacterial diversity and the transient disappearance of Hahellaceae was observed. CONCLUSION/SIGNIFICANCE: This is the first spatiotemporal study to investigate the bacterial diversity associated with a temperate shallow gorgonian. Our data revealed an established relationship between P. clavata and a specific bacterial group within the Oceanospirillales. These results suggest a potential symbiotic role of Hahellaceae in the host-microbe association, as recently suggested for tropical corals

  8. Cryptic marine biota of the Raja Ampat island group : Preliminary results of the Raja Ampat Expedition , Ekspedisi Widya Nusantara (E-Win) of the Indonesian Institute of Sciences (LIPI)

    NARCIS (Netherlands)

    Hoeksema, B.W.; Meij, van der S.E.T.


    The Raja Ampat expedition in 2007 was organized by the National Museum of Natural History Naturalis in Leiden in cooperation with the Research Centre for Oceanography (RCO-LIPI, Jakarta) as part of Ekspedisi Widya Nusantara (E-Win expedition) of the Indonesian Institute of Sciences (LIPI). The

  9. Complete mitochondrial genome of the mottled skate: Raja pulchra (Rajiformes, Rajidae). (United States)

    Jeong, Dageum; Kim, Sung; Kim, Choong-Gon; Myoung, Jung-Goo; Lee, Youn-Ho


    The complete sequence of mitochondrial DNA of a mottled skate, Raja pulchra was sequenced as being circular molecules of 16,907 bp including 2 rRNA, 22 tRNA, 13 protein-coding genes (PCGs), and an AT-rich control region. The organization of the PCGs is the same as those found in other Rajidae species. The nucleotide of L-strand is composed of 29.8% A, 28.0% C, 27.9% T, and 14.3% G with a bias toward A + T slightly. Twelve of 13 PCGs are initiated by the ATG codon while COX1 starts with GTG. Only ND4 harbors the incomplete termination codon, TA. All tRNA genes have a typical clover-leaf structure of mitochondrial tRNA with the exception of [Formula: see text] which has a reduced DHU arm. This mitogenome will provide essential information for better phylogenetic resolution and precision of the family Rajidae and the genus Raja as well as for establishment of a fish stock recovery plan of the species.

  10. Molecular Identification and Genetic Diversity of Acropora hyacinthus from Boo and Deer Island, Raja Ampat, West Papua (United States)

    Wijayanti, DP; Indrayanti, E.; Nuryadi, H.; Dewi, RA; Sabdono, A.


    Indonesia lies at the centre of biodiversity for corals. However, the reefs suffered from extensive human exploitation. Marine Protected Areas is thought to be best solution to protect coral reefs ecosystem. Understanding genetic diversity is crucial for effective management of the MPAs, however genetic diversity is rarely been corporate in designing an MPA. Moreover, many MPAs are uneffectively manage due to poor designated and demarcated.Raja Ampat which is located in western tip of West Papua, was designated as a park to mitigatethreatsand protect the valuable marine resources.Scleractinian corals in the genus Acropora are among the most dominant distributed in Raja Ampat waters, including the species of Acroporahyacinthus. The research aimed to analyze genetic diversity and to describe the kinship relationship of Acroporahyacinthus between 2 populations: Boo Island and Deer Island, Raja Ampat. Genetic marker Cytochrome Oxidase I (CO I) of the mitochondrial genome DNA (mtDNA) was used to analyze genetic diversity. Reconstruction of phylogenetic tree and genetic diversity were made by usingsoftware MEGA 5.05 (Moleculer Evolutionary Genetics Analysis). The results of this research indicatecorals A. hyacinthus from Boo Island and Deer Island Raja Ampat are in the low category of genetic diversity and overall had a close genetic relationship of kinship. This is likely due to the small size of the population and few numbers of samples that may not represent the population.

  11. Drinking Water Quality of Water Vending Machines in Parit Raja, Batu Pahat, Johor (United States)

    Hashim, N. H.; Yusop, H. M.


    An increased in demand from the consumer due to their perceptions on tap water quality is identified as one of the major factor on why they are mentally prepared to pay for the price of the better quality drinking water. The thought that filtered water quality including that are commercially available in the market such as mineral and bottled drinking water and from the drinking water vending machine makes they highly confident on the level of hygiene, safety and the mineral content of this type of drinking water. This study was investigated the vended water quality from the drinking water vending machine in eight locations in Parit Raja are in terms of pH, total dissolve solids (TDS), turbidity, mineral content (chromium, arsenic, cadmium, lead and nickel), total organic carbon (TOC), pH, total colony-forming units (CFU) and total coliform. All experiments were conducted in one month duration in triplicate samples for each sampling event. The results indicated the TDS and all heavy metals in eight vended water machines in Parit Raja area were found to be below the Food Act 1983, Regulation 360C (Standard for Packaged Drinking Water and Vended water, 2012) and Malaysian Drinking Water Quality, Ministry of Health 1983. No coliform was presence in any of the vended water samples. pH was found to be slightly excess the limit provided while turbidity was found to be 45 to 95 times more higher than 0.1 NTU as required by the Malaysian Food Act Regulation. The data obtained in this study would suggest the important of routine maintenance and inspection of vended water provider in order to maintain a good quality, hygienic and safety level of vended water.

  12. Kecernaan Pakan Berbentuk Pelet Mengandung Kulit Pisang Raja Fermentasi Dengan Mikroorganisme Lokal Dibandingkan Dengan Trichoderma harzianum Pada Kelinci Rex Jantan Lepas Sapih


    Ginting, Julius Syah Putra


    Utilization of Raja banana peel can be maximized by fermentation method. The objective of research was to determine the effect of utilization fermented raja banana peel in rations of weaning males rex rabbit. The research had been conducted in the Laboratory of Animal Biology Livestock Studies Program, Agriculture faculty of North Sumatera University from Agustust 2013 until November 2013. This research was used 21 Rex rabbit, mutual average body weights 732±66,74 g. The design was used compl...

  13. Structural and functional diversity of CLAVATA3/ESR (CLE)-like genes from the potato cyst nematode Globodera rostochiensis. (United States)

    Lu, Shun-Wen; Chen, Shiyan; Wang, Jianying; Yu, Hang; Chronis, Demosthenis; Mitchum, Melissa G; Wang, Xiaohong


    Plant CLAVATA3/ESR-related (CLE) peptides have diverse roles in plant growth and development. Here, we report the isolation and functional characterization of five new CLE genes from the potato cyst nematode Globodera rostochiensis. Unlike typical plant CLE peptides that contain a single CLE motif, four of the five Gr-CLE genes encode CLE proteins with multiple CLE motifs. These Gr-CLE genes were found to be specifically expressed within the dorsal esophageal gland cell of nematode parasitic stages, suggesting a role for their encoded proteins in plant parasitism. Overexpression phenotypes of Gr-CLE genes in Arabidopsis mimicked those of plant CLE genes, and Gr-CLE proteins could rescue the Arabidopsis clv3-2 mutant phenotype when expressed within meristems. A short root phenotype was observed when synthetic GrCLE peptides were exogenously applied to roots of Arabidopsis or potato similar to the overexpression of Gr-CLE genes in Arabidopsis and potato hairy roots. These results reveal that G. rostochiensis CLE proteins with either single or multiple CLE motifs function similarly to plant CLE proteins and that CLE signaling components are conserved in both Arabidopsis and potato roots. Furthermore, our results provide evidence to suggest that the evolution of multiple CLE motifs may be an important mechanism for generating functional diversity in nematode CLE proteins to facilitate parasitism.


    Directory of Open Access Journals (Sweden)

    Baharinawati W. Hastanti


    Full Text Available This study was aim to know the social, economic and cultural communities on the island of Gag, a nickel mining sites in the Marine Wildlife of the Raja Ampat Islands. In last years the region enter into a conflict between the central government (Ministry of Forestry and the local government supported by the community. The conflict occurred because of a lack of public understanding of conservation of natural resources and the presence of nickel mining was expected to improve the welfare of local communities. Lack of public understanding of conservation is influenced by socio-economic conditions and local culture is partly because of geographical isolation, low levels of education and the difficulty of economic development. These factors led to the economic motivation of nickel mining in the region hope was forwarded to the exclusion of ecological impacts would arise from the nickel mining project.Keywords: Social, economic, cultural, community, conservation area, Raja Ampat

  15. X-ray absorption spectroscopy of U (VI) sorbed onto alumina

    International Nuclear Information System (INIS)

    Kumar, Sumit; Jain, Aishwarya; Tomar, B.S.; Manchanda, V.K.; Poswal, A.K.; Jha, S.N.; Sabharwal, S.C.


    Sorption of U (VI) by alumina varying pH has been studied by X-ray absorption Spectroscopy. The experiments were carried out using the EXAFS beamline (BL-8) of INDUS-2 at Raja Ramanna Centre for Advanced Technology, Indore. The absorption intensity was found to increase with the increasing pH of the suspension. (author)

  16. Nitric oxide production by nurse shark (Ginglymostoma cirratum) and clearnose skate (Raja eglanteria) peripheral blood leucocytes. (United States)

    Walsh, Cathy J; Toranto, Jason D; Gilliland, C Taylor; Noyes, David R; Bodine, Ashby B; Luer, Carl A


    Reactive nitrogen intermediates, such as nitric oxide (NO), are important immunomodulators in vertebrate immune systems, but have yet to be identified as mediators of host defence in any member of class Chondrichthyes, the cartilaginous fishes. In the present study, production of NO by nurse shark (Ginglymostoma cirratum) peripheral blood leucocytes (PBL) stimulated with bacterial cell wall lipopolysaccharide (LPS) was investigated. PBL were cultured for 24 to 96 h following stimulation with LPS at concentrations ranging from 0 to 25 microg ml(-1), in both serum-supplemented and serum-free culture conditions. Production of NO was measured indirectly using the Griess reaction, with maximal NO production occurring after 72 h using 10% FBS and 10 microg LPS ml(-1). Application of these culture conditions to PBL from another cartilaginous fish (clearnose skate, Raja eglanteria) resulted in a similar NO response. Addition of a specific inhibitor of inducible nitric oxide synthase (iNOS), L-N(6)-(1-iminoethyl)lysine (L-NIL), resulted in a significant decrease in the production of NO by PBL from both species.

  17. Religion and Culture Encounters in Misool Raja Ampat: Marine Ritual Practice of Sasi Laut (United States)

    Suardi Wekke, Ismail; Aghsari, Diah; Evizariza, Evizariza; Junaidi, Junaidi; Harun, Nurlaila


    The acculturation of religion and culture in such a way are gradually accepted without causing the loss of the native culture in one community will influence the social process. When religion and culture arise and merged into one, it can be clear to be found in their rituals. This ethnography study on qualitative in nature was conducted to see how the existence, practices, and acculturation between local culture and Islam in, Sasi marine rituals in Misool Raja Ampat in West Papua Indonesia. Data collection was done through observation, in-depth interview including library research on community manuscript and local government database. Using snowball sampling technique, this study is able to gain solid information from native people in Misoo that willing to take part as the informants. The informants in this study were found as influences native people in Misool community e.g; the head of Fafanlap village, community figures, female figures and youth figures. This study considers Misool community which still strongly maintains their cultures including sasi laut as a sign to start and stop harvesting the specific sea resources to maintain the sustainability of nature. The acculturation between the culture of Islam runs smoothly in changing the native mindset to eliminate the things that can cause syirik but did not eliminate the characteristics and the main part of the ritual of sasi laut.

  18. The percentage of coral reef cover in Saonek Kecil Island, Raja Ampat, West Papua (United States)

    Wiguna, D. A.; Masithah, E. D.; Manan, A.


    Raja Ampat archipelago is located in the heart of the world’s coral triangle which is the center of the richest tropical marine biodiversity in the world. The Saonek Kecil Island has a location close to the Waisai Harbour (±2 km of sea routes). The Island that has no inhabitants and has a location close to harbour activities potentially damage coral reefs. This research was conducted by Line Intercept Transect (LIT) method that calculate the length of each colony form of growth (life form) of coral reefs on the line transect which stretched along the 50 metres parallel to the coastline at each station to obtain the percentage cover data, diversity index, uniformity index, and dominance index. The results of research precentage cover of coral reeef in the waters of Small Saonek Island reach 68.80% – 79.30% by category according to the decision of the Minister of State for the Environment number 4 of 2001 about the damage the reefs criteria included in the category of good – very good. As for the value of diversity index (H’) of 0.487 – 0.675 (medium-high), uniformity index (J) 0.437 – 0.606 (medium-high), and dominance index (C) 0.338 – 0.502 (medium-high).


    Directory of Open Access Journals (Sweden)

    Dawam Multazami


    Full Text Available Abstrak:In general, theories about the arrival of Islam in this country came in the 7th century BC, by various methods and strategies of endeavors. The preacher came and tried to blend with the occupants by using native language and their customs, and then mate with the natives. Finally, they made small community to maintain friendship with the potentate. Palace or castle has an important role as part of forming the Islamic nation tradition. The close Relationship between parsons and potentate drawn in the role of co-operation through educational institutions outside the palace and in palace, the parsons are instructed to write scientific papers and served as state law, palace policies lifting parsons in strategic positions as mufti or qodhi, palace become a place to discuss intellectual matters and so forth. The relationship between palace and the forming of Islamic nation tradition depicted into some areas in this country such: the scientific tradition of Islam in Aceh Darussalam. Its began from meunasah (madrasah in which students learned the Arabic alphabet, read al-Qur'an, prayer procedures, morality, monotheism study, fiqh study, tasawwuf study, the Islamic roles in building a mosque then used as a place of higher education. Collective leadership between sultan and Wali Songo in Demak Bintoro, Sultan Banjar attend to Islamic development through education build by Shaikh Arshad, and the establishment of Shari'ah court Keywords: Raja Alim, Kesultanan Aceh, Musawaratan Wali dan Daeng Ta Kaliya.

  20. Cell and molecular biology of marine elasmobranchs: Squalus acanthias and Raja erinacea. (United States)

    Mattingly, Carolyn; Parton, Angela; Dowell, Lori; Rafferty, Jason; Barnes, David


    Elasmobranchs are among the most primitive existing species exhibiting fundamental vertebrate characteristics, such as neural crest, jaws, teeth, and an adaptive immune system. They are also among the earliest-evolved vertebrates with a closed, pressurized circulatory system and related signaling molecules. Although many species are used experimentally, the spiny dogfish shark (Squalus acanthias) and little skate (Raja erinacea) have particular advantages and are the most commonly used elasmobranch biomedical models. These animals display powerful molecular systems for dealing with salt and water homeostasis, cell volume regulation, and environmental and internal osmotic sensing. They have become important unique models in studies of transport-related diseases such as cystic fibrosis and anion or xenobiotic transport. Much of this work has relied on physiological experiments combined with molecular approaches and the advantages of comparative genomic analyses to identify conserved regions representing functional protein domains. Recent work has seen the development of cell cultures and the beginning of expressed sequence tags (EST) and genomic libraries. Other areas in which elasmobranches have played critical roles include immunology and neurobiology. It also appears that sharks have tissue regenerative capability beyond what is commonly seen in mammals. For example, sharks and skates possess a region of renal regeneration, with new tubules being formed continually through adulthood. As comparative functional genomics comes of age, these comparative vertebrate models may play an increasing role in the larger picture of human biomedical research. There is plenty of ocean to share.

  1. Uji Aktivitas Senyawa Antioksidan dari Ekstrak Metanol Kulit Pisang Raja (Musa paradisiaca Sapientum

    Directory of Open Access Journals (Sweden)

    Elfira Rosa Pane


    Full Text Available AbstrakTelah dilakukan penelitian uji aktivitas senyawa antioksidan dari ekstrak metanol kulit pisang raja (Musa paradisiaca Sapientum. Ekstraksi dilakukan dengan cara maserasi menggunakan pelarut metanol. Ekstraksi bertingkat dilakukan terhadap ekstrak metanol dengan n-heksan dan etil asetat. Dari uji fitokimia terhadap fraksi metanol menunjukkan positif flavonoid. Pengujian aktifitas antioksidan dilakukan dengan reaksi oksidasi asam linoleat dengan metoda feritiosianat (FTC 0,05%. Sebagai standar antioksidan digunakan Butil hidroksianisol (BHA. Hasil penelitian ini menunjukkan ekstrak metanol, fraksi n-heksan dan etil asetat memiliki aktifitas antioksidan yang tidak jauh berbeda dengan BHA. Sedangkan fraksi etil asetat memiliki aktifitas antioksidan yang lebih tinggi daripada BHA.Kata kunci : antioksidan, feritiosianat, Musa paradisiaca SapientumAbstractA research has been done to evaluate the antioxidant activity of metanol extract Musa paradisiaca Sapientum peel’s. Maseration technique was used to get the extract using metanol as solvent. The metanol extract of the peel was re-extracted by solvents into n-hexan and ethyl acetate fractions. Phytochemical screening of metanol extract showed positive flavonoid. The antioxidant activities were tested by using ferric thiocyanate method 0,05% (FTC on linoleic acid and buthyl hydroxyanisole (BHA as antioxidant standard. Metanol extract, n-hexan and ethyl acetate fraction exhibited antioxidative activity that was not significantly different from BHA, on the other hand, the ethyl acetate fraction exhibited significant antioxidative activity, which is better than BHA.Keywords : antioxidant, ferric thiocyanate, Musa paradisiaca Sapientum

  2. PENGEMBANGAN ENERGI TERBARUKAN MELALUI EVALUASI PROGRAM KONVERSI MINYAK TANAH KE LPG DI PULAU GILI RAJA-SUMENEP (Developing Renewable Energy Through An Evaluation for A Program of Kerosene Conversion to LPG in Gili Raja Island - Sumenep

    Directory of Open Access Journals (Sweden)

    Nian Riawati


    Full Text Available ABSTRAK Penelitian ini mengevaluasi program konversi minyak tanah ke Liquefied Petroleum Gas (LPG pada kelompok sasaran di pulau Gili Raja kabupaten Sumenep Jawa Timur. Kajian sebelumnya terhadap program ini masih bersifat formatif dengan fokus efisiensi dan efektivitas implementasi. Dengan menggunakan metode Minimum Evaluation Procedure (MEP penelitian ini mempertanyakan implementasi program secara runtut, mulai output, outcome sampai impact. Melalui pendekatan kualitatif penelitian ini dapat mendeskripsikan konteks dan setting secara alamiah. Hasil penelitian menunjukkan adanya pungutan dalam proses distribusi paket program, rendahnya akses atau penggunaan paket program serta tidak adanya dampak program. Selain itu, ditemukan adanya potensi lokal berupa kotoran ternak yang dapat dikembangkan menjadi sumber daya energi terbarukan. Berdasarkan hal itu, disarankan sebuah program dapat dikembangkan secara asimetris sesuai dengan kondisi lokasi dan kelompok sasaran, terjadinya komunikasi intensif antara pelaksana program dengan kelompok sasaran serta stakeholders lainnya. Berdasarkan potensi kelompok sasaran di pulau Gili Raja, hendaknya dikembangkan kebijakan energi alternatif biogas untuk memenuhi kebutuhan energi masyarakat serta mendukung pencapaian tujuan kebijakan energi nasional.   ABSTRACT The purpose of this research is to evaluate the conversion programfrom kerosene to Liquefied Petroleum Gas (LPG on a target group in Gili Raja island of SumenepMunicipal, East Java. Previous study on this program was quite formative one and focusing on the efficiency and the effectiveness of the program implementation. In addition, by applying Minimum Evaluation Procedure’s (MEP method, this research questioned the implementation of the program consecutively from the output, the outcome as well as the impact. Furthermore, through a qualitative approach, this research will be able to describe context and setting naturally. Result of the research shows

  3. Two novel antioxidant nonapeptides from protein hydrolysate of skate (Raja porosa) muscle. (United States)

    Hu, Fa-Yuan; Chi, Chang-Feng; Wang, Bin; Deng, Shang-Gui


    In the current study, the preparation conditions of neutrase hydrolysate (SMH) from skate (Raja porosa) muscle protein were optimized using orthogonal L9(3)4 tests, and R values indicated that pH was the most important factor affecting HO· scavenging activity of SMH. Under the optimum conditions of pH 7.0, enzymolysis temperature 60 °C, enzyme/substrate ratio (E/S) 2%, and enzymolysis time 5 h, EC50 of SMH on HO· was 2.14 ± 0.17 mg/mL. Using ultrafiltration, gel filtration chromatography, and RP-HPLC, two novel antioxidant nonapeptides (SP-A and SP-B) were isolated from SMH and their amino acid sequences were found to be APPTAYAQS (SP-A) and NWDMEKIWD (SP-B) with calculated molecular masses of 904.98 Da and 1236.38 Da, respectively. Both showed strong antioxidant activities. SP-A and SP-B exhibited good scavenging activities on HO· (EC50 0.390 and 0.176 mg/mL), DPPH· (EC50 0.614 and 0.289 mg/mL), and O2-· (EC50 0.215 and 0.132 mg/mL) in a dose-dependent manner. SP-B was also effective against lipid peroxidation in the model system. The aromatic (2Trp), acidic (2Asp and Glu), and basic (Lys) amino acid residues within the sequences of SP-B might account for its pronounced antioxidant activity. The results of this study suggested that protein hydrolysate and peptides from skate muscle might be effective as food additives for retarding lipid peroxidation occurring in foodstuffs.

  4. Two Novel Antioxidant Nonapeptides from Protein Hydrolysate of Skate (Raja porosa Muscle

    Directory of Open Access Journals (Sweden)

    Fa-Yuan Hu


    Full Text Available In the current study, the preparation conditions of neutrase hydrolysate (SMH from skate (Raja porosa muscle protein were optimized using orthogonal L9(34 tests, and R values indicated that pH was the most important factor affecting HO· scavenging activity of SMH. Under the optimum conditions of pH 7.0, enzymolysis temperature 60 °C, enzyme/substrate ratio (E/S 2%, and enzymolysis time 5 h, EC50 of SMH on HO· was 2.14 ± 0.17 mg/mL. Using ultrafiltration, gel filtration chromatography, and RP-HPLC, two novel antioxidant nonapeptides (SP-A and SP-B were isolated from SMH and their amino acid sequences were found to be APPTAYAQS (SP-A and NWDMEKIWD (SP-B with calculated molecular masses of 904.98 Da and 1236.38 Da, respectively. Both showed strong antioxidant activities. SP-A and SP-B exhibited good scavenging activities on HO· (EC50 0.390 and 0.176 mg/mL, DPPH· (EC50 0.614 and 0.289 mg/mL, and O2−· (EC50 0.215 and 0.132 mg/mL in a dose-dependent manner. SP-B was also effective against lipid peroxidation in the model system. The aromatic (2Trp, acidic (2Asp and Glu, and basic (Lys amino acid residues within the sequences of SP-B might account for its pronounced antioxidant activity. The results of this study suggested that protein hydrolysate and peptides from skate muscle might be effective as food additives for retarding lipid peroxidation occurring in foodstuffs.

  5. Makna Tindakan Pragmatik Bedhaya Tejaningsih pada Jumenengan K.G.P.H Tejawulan Sebagai Raja Paku Buwana XIII di Surakarta

    Directory of Open Access Journals (Sweden)

    Maryono -


    Abstrak   Kehadiran Bedhaya Tejaningsih pada ritual jumenengan K.G.P.H Tejawulan rupanya tidak sekadar bentuk hiburan, namun mengandung makna simbolis. Pada Penelitian pragmatik Bedhaya Tejaningsih, peneliti menggunakan pendekatan linguistik pragmatik. Bentuk penelitiannya bersifat kualitatif interpretatif dengan dasar rujukan teori-teori pragmatik dan seni pertunjukan. Metode pengumpulan datanya dengan cara: studi pustaka, observasi dan wawancara. Hasil kajian menunjukkan bahwa makna kehadiran tari Bedhaya Tejaningsih pada ritual jumenengan K.G.P.H Tejawulan merupakan bentuk hiburan, keteladanan dan kredibilitas. Sebagai bentuk hiburan kehadiran tari Bedhaya Tejaningsih pada penobatan raja secara keseluruhan sajiannya memberikan santapan estetis bagi penonton. Makna keteladanan yang ditemukan adalah bentuk permintaan terhadap masyarakat untuk meneladani figur pemimpin yang baik dan bijak yang selalu mengutamakan cinta kasih dalam mengayomi masyarakat, menciptakan ketentraman dan kedamaian. Makna kredibilitas adalah permohonan K.G.P.H Tejawulan terhadap masyarakat untuk memberi dukungan dan pengakuan atas penobatannya sebagai raja supaya memiliki legitimasi berdasar adat budaya Karaton Kasunanan Surakarta.   Kata kunci: tari Bedhaya Tejaningsih, makna tindakan pragmatik, dan jumenengan.


    Directory of Open Access Journals (Sweden)

    Ellya Roza


    Full Text Available Kingdom of Riau in the 19th century recognized by many historians as the center of culture and intellectual development. While at the same time, the kingdom of Riau no longer holds hegemony and succeeding in politics, economy and trade, but they have a tradition of excellence in the form of writing that many writers with works of quality that is not only in the field of literature and language alone but also in the fields of religion, history, socio-political, legal, and cultural. Although the tools for writing like paper and ink difficulty encountered in those days, and must be imported from European countries, but the author and the author's Riau while still concentrating on the activities making up the reef. For instance, Raja Ali Haji (1808-1873 is the third descendant of Raja Haji Fi Sabilillah most productive in writing activities. One of his works, entitled The Book of Knowledge of Language, Slang Dictionary Pahang Malay Johor Riau linga which was completed in 1858 is a Malay Dictionary Malay First Nature books can even be regarded as Malay Einsiklopedi containing approximately 2000 sentences basic and advanced script written as Bustanul Katibin which intends to foster Malay language became the language of the standard on its own. The manuscript of the book, now the mistress Foundation Indrasakti in Penyengat. In connection with that paper will review the history of the manuscript and are contained in the text.

  7. CLE-CLAVATA1 peptide-receptor signaling module regulates the expansion of plant root systems in a nitrogen-dependent manner. (United States)

    Araya, Takao; Miyamoto, Mayu; Wibowo, Juliarni; Suzuki, Akinori; Kojima, Soichi; Tsuchiya, Yumiko N; Sawa, Shinichiro; Fukuda, Hiroo; von Wirén, Nicolaus; Takahashi, Hideki


    Morphological plasticity of root systems is critically important for plant survival because it allows plants to optimize their capacity to take up water and nutrients from the soil environment. Here we show that a signaling module composed of nitrogen (N)-responsive CLE (CLAVATA3/ESR-related) peptides and the CLAVATA1 (CLV1) leucine-rich repeat receptor-like kinase is expressed in the root vasculature in Arabidopsis thaliana and plays a crucial role in regulating the expansion of the root system under N-deficient conditions. CLE1, -3, -4, and -7 were induced by N deficiency in roots, predominantly expressed in root pericycle cells, and their overexpression repressed the growth of lateral root primordia and their emergence from the primary root. In contrast, clv1 mutants showed progressive outgrowth of lateral root primordia into lateral roots under N-deficient conditions. The clv1 phenotype was reverted by introducing a CLV1 promoter-driven CLV1:GFP construct producing CLV1:GFP fusion proteins in phloem companion cells of roots. The overaccumulation of CLE2, -3, -4, and -7 in clv1 mutants suggested the amplitude of the CLE peptide signals being feedback-regulated by CLV1. When CLE3 was overexpressed under its own promoter in wild-type plants, the length of lateral roots was negatively correlated with increasing CLE3 mRNA levels; however, this inhibitory action of CLE3 was abrogated in the clv1 mutant background. Our findings identify the N-responsive CLE-CLV1 signaling module as an essential mechanism restrictively controlling the expansion of the lateral root system in N-deficient environments.

  8. The dynamic of urban and protected areas at Balai Raja Wildlife Reserve, Riau, Indonesia: a social ecology approach (United States)

    Suwondo; Darmadi; Yunus, M.


    The development process has resulted in deforestation. A comprehensive study is needed to obtain an objective solution by integrating the ecological dimension and human dimension. This study was conducted within Balai Raja Wildlife Reserve (BRWR), Bengkalis Regency, Riau Province, Indonesia. We used the social-ecological systems (SES) approach based on local characteristics, categorized into ecological status, social status and actors. Each factoris ranked using Multi-Dimensional Scaling (MDS).BRWR sustainability levels are in moderate condition. The ecological dimension is in a less sustainable state, with leverage: (1) forest conversion; (2) local ecological knowledge; (3) high conservation value. The social dimension is in a less sustainable state, with leverage: (1) community empowerment; (2) social conflict; (3) participation in landscape management. Dimensions actors are on a fairly sustainable status, with leverage: (1) institutional interaction; (2) stakeholder’s commitment; (3) law enforcement. We recommend strengthening community empowerment, local ecological knowledge, interaction, and stakeholder commitment

  9. Distribución, mortalidad y asociación con plantas, de nidos de Paraponera clavata (Hymenoptera: Formicidae en la isla de Barro Colorado, Panamá

    Directory of Open Access Journals (Sweden)

    Rolando Pérez


    Full Text Available Se estudió la distribución, mortalidad, reclutamiento y asociación con plantas, de 308 nidos de la hormiga neotropical Paraponera clavata en una parcela de cincuenta hectáreas de bosque viejo en la isla de Barro Colorado entre septiembre de 1993 y febrero de 1995. Los nidos estaban distribuidos uniformemente a través de toda la parcela, y se asociaban de manera significativa con el tipo de hábitat, existían más nidos de los esperados en las planicies altas y en la sección de bosque más joven de la parcela. La densidad promedio era de 6.2 nidos por hectárea. Los nidos con un mayor número de vecinos entre 0 y 20 m de distancia, tenían una mayor probabilidad de morir, si se comparaban con aquéllos que se encontraban separados por distancias mayores. La mortalidad era entre 13.36 y 69.64% dependiendo del intervalo de censo, y el reclutamiento fue del 22.63 y 31.72%. Los nidos se encontraron en las bases de 84 especies de plantas, en 34 familias con cuatro categorías de forma de vida: 76 especies eran árboles, 5 especies eran arbustos, 2 especies eran palmas y 1 era liana. Ocho especies de plantas se asociaban positivamente con los nidos de la hormiga. Plantas medianas entre 8 y 63.9 cm de DAP eran las más utilizadas. Arboles y arbustos pequeños presentan muy poca asociación con los nidos. La hormiga no se asocia con árboles que tienen nectarios extraflorales. El 53% de los nidos tenían a Phrynus gervaisii (Amblypygi: Phrynidae habitando en el interior. Estos nidos presentaron menores tasas de mortalidad en comparación con el resto.We studied the distribution, mortality and association with plants, of 308 nests of the neotropical ant Paraponera clavata, in a permanent 50 hectare plot in old-growth forest on Barro Colorado island between September 1993 and February 1995. Ant nests were uniformly dispersed throughout the plot, and significantly associated with the high plateau and patch of young forest in the plot. The average

  10. Incorporating Local Wisdom Sasi into Marine Zoning to Increase the Resilience of a Marine Protected Area Network in Raja Ampat, Indonesia. (United States)

    Purwanto, P., Jr.; Mangubhai, S.; Muhajir, M.; Hidayat, N. I.; Rumetna, L.; Awaludinnoer, A.; Thebu, K.


    The Raja Ampat government and local communities established 6 Marine Protected Areas (MPAs) in 2007 to protect the unique marine biodiversity and ensure sustainable fisheries in West Papua, Indonesia. Increasing human populations resulting in overfishing and the use of destructive fishing practices are the main threats and challenges the region faces. Biophysical, socioeconomic and climate change criteria and factors were developed for zoning the Raja Ampat MPA network. Resilience principles such as replication, habitat representation, protection of critical habitat and connectivity were applied to the final zoning design. Reef resilience data using global monitoring protocols were collected to provide insights into the resilience of different reefs to further guide zoning. Resilience rankings showed that fishing pressure on reef fish communities especially on piscivores, herbivores and excavators was the main factor lowering resilience in MPAs. In addition data were collected on `sasi' areas throughout the MPAs. Sasi is a type of traditional resource management practice used by local communities to open and close areas to fishing single or multiple fisheries species. Once the fishery recovers local communities then harvest the species for food or sale. Raja Ampat MPAs network managed as multi-objective zoning system. The current zoning system explicitly recognizes community sasi within Traditional Use Zones, which often are adjacent or close to No-Take Zones. The explicit inclusion of sasi areas within zoning plans for the MPAs will likely lead to good compliance by local communities, and the increase fish biomass. Improving the management of fisheries through the incorporation of traditional fisheries management will therefore increase the overall resilience of coral reefs in the Raja Ampat MPA network.

  11. Evolution of hematopoiesis: Three members of the PU.1 transcription factor family in a cartilaginous fish, Raja eglanteria (United States)

    Anderson, M. K.; Sun, X.; Miracle, A. L.; Litman, G. W.; Rothenberg, E. V.


    T lymphocytes and B lymphocytes are present in jawed vertebrates, including cartilaginous fishes, but not in jawless vertebrates or invertebrates. The origins of these lineages may be understood in terms of evolutionary changes in the structure and regulation of transcription factors that control lymphocyte development, such as PU.1. The identification and characterization of three members of the PU.1 family of transcription factors in a cartilaginous fish, Raja eglanteria, are described here. Two of these genes are orthologs of mammalian PU.1 and Spi-C, respectively, whereas the third gene, Spi-D, is a different family member. In addition, a PU.1-like gene has been identified in a jawless vertebrate, Petromyzon marinus (sea lamprey). Both DNA-binding and transactivation domains are highly conserved between mammalian and skate PU.1, in marked contrast to lamprey Spi, in which similarity is evident only in the DNA-binding domain. Phylogenetic analysis of sequence data suggests that the appearance of Spi-C may predate the divergence of the jawed and jawless vertebrates and that Spi-D arose before the divergence of the cartilaginous fish from the lineage leading to the mammals. The tissue-specific expression patterns of skate PU.1 and Spi-C suggest that these genes share regulatory as well as structural properties with their mammalian orthologs.

  12. Anticancer Activity of a Hexapeptide from Skate (Raja porosa Cartilage Protein Hydrolysate in HeLa Cells

    Directory of Open Access Journals (Sweden)

    Xin Pan


    Full Text Available In this study, the hexapeptide Phe-Ile-Met-Gly-Pro-Tyr (FIMGPY, which has a molecular weight of 726.9 Da, was separated from skate (Raja porosa cartilage protein hydrolysate using ultrafiltration and chromatographic methods, and its anticancer activity was evaluated in HeLa cells. Methylthiazolyldiphenyl-tetrazolium bromide (MTT assay indicated that FIMGPY exhibited high, dose-dependent anti-proliferation activities in HeLa cells with an IC50 of 4.81 mg/mL. Acridine orange/ethidium bromide (AO/EB fluorescence staining and flow cytometry methods confirmed that FIMGPY could inhibit HeLa cell proliferation by inducing apoptosis. Western blot assay revealed that the Bax/Bcl-2 ratio and relative intensity of caspase-3 in HeLa cells treated with 7-mg/mL FIMGPY were 2.63 and 1.83, respectively, significantly higher than those of the blank control (p < 0.01. Thus, FIMGPY could induce apoptosis by upregulating the Bax/Bcl-2 ratio and caspase-3 activation. Using a DNA ladder method further confirmed that the anti-proliferation activity of FIMGPY was attributable to its role in inducing apoptosis. These results suggest that FIMGPY from skate cartilage protein hydrolysate may have applications as functional foods and nutraceuticals for the treatment and prevention of cancer.

  13. Effects of basic fibroblast growth factor and insulin-like growth factor on cultured cartilage cells from skate Raja porasa (United States)

    Fan, Tingjun; Jin, Lingyun; Wang, Xiaofeng


    Effects of basic fibroblast growth factor (bFGF) and insulin-like growth factor II (IGF-II) on cartilage cells from proboscis of skate, Raja porasa Günther, were investigated in this study. The cartilage cells were cultured in 20% FBS-supplemented MEM medium at 24°C. Twelve hours after culture initiation, the cartilage cells were treated with bFGF and IGF-II at different concentration combinations. It was found that 20 ng/ml of bFGF or 80 ng/ml of IGF-II was enough to have obvious stimulating effect on the growth and division of skate cartilage cells. Test of bFGF and IGF-II together, revealed that 20 ng/ml of bFGF and 80 ng/ml of IGF-II together had the best stimulating effect on the growth and division of skate cartilage cells. The cartilage cells cultured could form a monolayer at day 7.

  14. Rapid Development of Microsatellite Markers with 454 Pyrosequencing in a Vulnerable Fish, the Mottled Skate, Raja pulchra (United States)

    Kang, Jung-Ha; Park, Jung-Youn; Jo, Hyun-Su


    The mottled skate, Raja pulchra, is an economically valuable fish. However, due to a severe population decline, it is listed as a vulnerable species by the International Union for Conservation of Nature. To analyze its genetic structure and diversity, microsatellite markers were developed using 454 pyrosequencing. A total of 17,033 reads containing dinucleotide microsatellite repeat units (mean, 487 base pairs) were identified from 453,549 reads. Among 32 loci containing more than nine repeat units, 20 primer sets (62%) produced strong PCR products, of which 14 were polymorphic. In an analysis of 60 individuals from two R. pulchra populations, the number of alleles per locus ranged from 1–10, and the mean allelic richness was 4.7. No linkage disequilibrium was found between any pair of loci, indicating that the markers were independent. The Hardy–Weinberg equilibrium test showed significant deviation in two of the 28 single-loci after sequential Bonferroni’s correction. Using 11 primer sets, cross-species amplification was demonstrated in nine related species from four families within two classes. Among the 11 loci amplified from three other Rajidae family species; three loci were polymorphic. A monomorphic locus was amplified in all three Rajidae family species and the Dasyatidae family. Two Rajidae polymorphic loci amplified monomorphic target DNAs in four species belonging to the Carcharhiniformes class, and another was polymorphic in two Carcharhiniformes species. PMID:22837688

  15. Common skate (Raja kenojei) secretes pentraxin into the cutaneous secretion: The first skin mucus lectin in cartilaginous fish. (United States)

    Tsutsui, Shigeyuki; Yamaguchi, Motoki; Hirasawa, Ai; Nakamura, Osamu; Watanabe, Tasuku


    A lactose-specific lectin with a molecular mass of about 25 kDa was purified from the skin mucus of a cartilaginous fish-the common skate (Raja kenojei). The complementary DNA sequence of the lectin was 1540 bp long and contained a reading frame encoding 226 amino acids, which showed approximately 38% identity to pentraxins of mammals and teleosts. Gene expression was observed in the skin, gill, stomach and intestine in the healthy skate. We also identified an isotype gene from the liver whose deduced amino-acid sequence shared 69.0% identity with the skin type gene. The antiserum detected protein in the skin, where the lectin is localized in the epidermal cells, and in the blood plasma. The lectin genes are multicopied in the common skate genome. Although pentraxins are acute phase proteins, mRNAs of both the isotypes were not upregulated after the in vivo challenge with formalin-killed Escherichia coli, which suggests that they are constantly present in the skin mucus and blood plasma to protect against pathogenic invasion. This lectin is the fifth type of lectin found in the cutaneous secretions of fish, demonstrating that skin mucus lectins have evolved with marked molecular diversity in fish.

  16. cDNA cloning and characterization of Type I procollagen alpha1 chain in the skate Raja kenojei. (United States)

    Hwang, Jae-Ho; Yokoyama, Yoshihiro; Mizuta, Shoshi; Yoshinaka, Reiji


    A full-length cDNA of the Type I procollagen alpha1 [pro-alpha1(I)] chain (4388 bp), coding for 1463 amino acid residues in the total length, was determined by RACE PCR using a cDNA library constructed from 4-week embryo of the skate Raja kenojei. The helical region of the skate pro-alpha1(I) chain consisted of 1014 amino acid residues - the same as other fibrillar collagen alpha chains from higher vertebrates. Comparison on denaturation temperatures of Type I collagens from the skate, rainbow trout (Oncorhynchus mykiss) and rat (Rattus norvegicus) revealed that the number of Gly-Pro-Pro and Gly-Gly in the alpha1(I) chains could be directly related to the thermal stability of the helix. The expression property of the skate pro-alpha1(I) chain mRNA and phylogenetic analysis with other vertebrate pro-alpha1(I) chains suggested that skate pro-alpha1(I) chain could be a precursor form of the skate Type I collagen alpha1 chain. The present study is the first evidence for the primary structure of full-length pro-alpha1(I) chain in an elasmobranch.

  17. Anticancer Activity of a Hexapeptide from Skate (Raja porosa) Cartilage Protein Hydrolysate in HeLa Cells. (United States)

    Pan, Xin; Zhao, Yu-Qin; Hu, Fa-Yuan; Chi, Chang-Feng; Wang, Bin


    In this study, the hexapeptide Phe-Ile-Met-Gly-Pro-Tyr (FIMGPY), which has a molecular weight of 726.9 Da, was separated from skate (Raja porosa) cartilage protein hydrolysate using ultrafiltration and chromatographic methods, and its anticancer activity was evaluated in HeLa cells. Methylthiazolyldiphenyl-tetrazolium bromide (MTT) assay indicated that FIMGPY exhibited high, dose-dependent anti-proliferation activities in HeLa cells with an IC50 of 4.81 mg/mL. Acridine orange/ethidium bromide (AO/EB) fluorescence staining and flow cytometry methods confirmed that FIMGPY could inhibit HeLa cell proliferation by inducing apoptosis. Western blot assay revealed that the Bax/Bcl-2 ratio and relative intensity of caspase-3 in HeLa cells treated with 7-mg/mL FIMGPY were 2.63 and 1.83, respectively, significantly higher than those of the blank control (p skate cartilage protein hydrolysate may have applications as functional foods and nutraceuticals for the treatment and prevention of cancer.

  18. Japanese Occupation Government Policy in Indonesia on Culture and Literature: A Case Study of Asia Raja Newspaper (1942-1945

    Directory of Open Access Journals (Sweden)

    Maman S Mahayana


    Full Text Available There are three views are shown in the movement of Indonesia in responding to the arrival of Japan to Indonesia. First, they welcome and support the arrival of Japan considering the success of Japan drove the Dutch. Second, they have not determined the attitude of supporting or opposing. In this case, they still want to see how Japan would run his administration in Indonesia. Third, they oppose the presence of Japan, although not yet dared to take the fight. Those who oppose the Japanese arrivals in Indonesia consists of two groups, namely (1 of the aristocratic, ambtenaar, and government employees, and (2 the movement of the fighters who put the government of Japan as an imperialist occupation. How is the real politics of the Japanese occupation government in carrying out its colonial administration in the colonies? With the underlying research on the Asia Raja newspapers (April 29, 1942 to September 7, 1945, this paper tries to reveal the political government of Japan in the socio-cultural and literature. How is the newspapers used the Japanese occupation government to gain public support for Indonesia in the face of Greater East Asia war?

  19. Rapid development of microsatellite markers with 454 pyrosequencing in a vulnerable fish, the mottled skate, Raja pulchra. (United States)

    Kang, Jung-Ha; Park, Jung-Youn; Jo, Hyun-Su


    The mottled skate, Raja pulchra, is an economically valuable fish. However, due to a severe population decline, it is listed as a vulnerable species by the International Union for Conservation of Nature. To analyze its genetic structure and diversity, microsatellite markers were developed using 454 pyrosequencing. A total of 17,033 reads containing dinucleotide microsatellite repeat units (mean, 487 base pairs) were identified from 453,549 reads. Among 32 loci containing more than nine repeat units, 20 primer sets (62%) produced strong PCR products, of which 14 were polymorphic. In an analysis of 60 individuals from two R. pulchra populations, the number of alleles per locus ranged from 1-10, and the mean allelic richness was 4.7. No linkage disequilibrium was found between any pair of loci, indicating that the markers were independent. The Hardy-Weinberg equilibrium test showed significant deviation in two of the 28 single-loci after sequential Bonferroni's correction. Using 11 primer sets, cross-species amplification was demonstrated in nine related species from four families within two classes. Among the 11 loci amplified from three other Rajidae family species; three loci were polymorphic. A monomorphic locus was amplified in all three Rajidae family species and the Dasyatidae family. Two Rajidae polymorphic loci amplified monomorphic target DNAs in four species belonging to the Carcharhiniformes class, and another was polymorphic in two Carcharhiniformes species.

  20. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident. (United States)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato


    We measured the concentrations of radiocesium ((134)Cs and (137)Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g(-1) dry for (134)Cs and 3.955 ± 1.756 Bq g(-1) dry for (137)Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of (134)Cs and (137)Cs were 0.825 ± 0.247 Bq g(-1) dry and 1.470 ± 0.454 Bq g(-1) dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of (134)Cs and (137)Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  1. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato


    We measured the concentrations of radiocesium ( 134 Cs and 137 Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g −1 dry for 134 Cs and 3.955 ± 1.756 Bq g −1 dry for 137 Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of 134 Cs and 137 Cs were 0.825 ± 0.247 Bq g −1 dry and 1.470 ± 0.454 Bq g −1 dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of 134 Cs and 137 Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. -- Highlights: • We investigated radiocesium contamination of large web spiders in Fukushima. • Spiders collected at three different sites in Fukushima were contaminated. • Radiocesium concentrations of spiders tended to increase with the air radiation dose rates. • Radiocesium concentrations of spiders did not affect by the amount of prey

  2. New tentacled leech Ceratobdella quadricornuta n. g., n. sp. (Hirudinida: Piscicolidae) parasitic on the starry skate Raja georgiana Norman from the Scotia Sea, Antarctica. (United States)

    Utevsky, Andrei; Gordeev, Ilya


    A new fish leech Ceratobdella quadricornuta n. g., n. sp. (Hirudinida: Piscicolidae), a parasite of the Antarctic skate Raja georgiana Norman (Rajiformes: Rajidae) collected between the Falkland Islands and South Georgia Island in the Scotia Sea, is described and compared with related genera. Ceratobdella quadricornuta is characterised by an uncommon appearance of its anterior sucker bearing four well-developed tentacles and a unique combination of features of the reproductive and digestive systems: crop and intestine equally developed, posterior crop caeca separated; accessory glands, conductive tissue and external copulatory area lacking; common part of ejaculatory ducts (common atrium) voluminous and muscular, male copulatory bursa short, small ovisacs opening into female copulatory bursa (vagina).

  3. Mechanism of mercurial inhibition of sodium-coupled alanine uptake in liver plasma membrane vesicles from Raja erinacea

    International Nuclear Information System (INIS)

    Sellinger, M.; Ballatori, N.; Boyer, J.L.


    In mammalian hepatocytes the L-alanine carrier contains a sulfhydryl group that is essential for its activity and is inhibited by mercurials. In hepatocytes of the evolutionarily primitive little skate (Raja erinacea), HgCl2 inhibits Na(+)-dependent alanine uptake and Na+/K(+)-ATPase and increase K+ permeability. To distinguish between direct effects of HgCl2 on the Na(+)-alanine cotransporter and indirect effects on membrane permeability, [3H]alanine transport was studied in plasma membrane vesicles. [3H]Alanine uptake was stimulated by an out-to-in Na+ but not K+ gradient and was saturable confirming the presence of Na(+)-alanine cotransport in liver plasma membranes from this species. Preincubation of the vesicles with HgCl2 for 5 min reduced initial rates of Na(+)-dependent but not Na(+)-independent alanine uptake in a dose-dependent manner (10-200 microM). In the presence of equal concentrations of NaCl or KCl inside and outside of the vesicles, 75 microM HgCl2 directly inhibited sodium-dependent alanine-[3H]alanine exchange, demonstrating that HgCl2 directly affected the alanine cotransporter. Inhibition of Na(+)-dependent alanine uptake by 30 microM HgCl2 was reversed by dithiothreitol (1 mM). HgCl2 (10-30 microM) also increased initial rates of 22Na uptake (at 5 sec), whereas 22Na uptake rates were decreased at HgCl2 concentrations greater than 50 microM. Higher concentrations of HgCl2 (100-200 microM) produced nonspecific effects on vesicle integrity. These studies indicate that HgCl2 inhibits Na(+)-dependent alanine uptake in skate hepatocytes by three different concentration-dependent mechanisms: direct interaction with the transporters, dissipation of the driving force (Na+ gradient), and loss of membrane integrity

  4. Age, growth and length-weight relationship of the rough skate, Raja radula (Linnaeus, 1758 (Chondrichthyans: Rajidae, from the Gulf of Gabes (Tunisia, Central Mediterranean

    Directory of Open Access Journals (Sweden)

    Hasna Kadri


    Full Text Available Objective: To investigate the length distribution, sex ratio, length-weight relationship, age and growth of Raja radula in the Gulf of Gabes. Methods: The age and growth characteristic of the rough skate (Raja radula inhabiting in the Gulf of Gabes (Central Mediterranean Sea was determined. A total of 1 250 specimens were sampled. According to the marginal increment band its growth was annual. Results: The growth parameters were derived by using the von-Bertalanffy method and were separately evaluated as follows: TL∞=97.2 cm, K= 0.15 y -1 , to= 0.35, and W∞= 5.28 kg, and TL∞= 76.4 cm, K = 0.22 y -1 , to= 0.16, and W∞= 3.77 kg, for females and males respetively. The maximum age was 12 years for females and 10 years for males. Conclusions: Results from this research will provide a starting point to develop a management plan for the rough skate in the Gulf of Gabes. Further investigations are necessary to quantify the impact of the existing regulations on the population dynamics and recruitment patterns of this species in the region.

  5. Diel feeding chronology of the skate raja Agassizii (Müller & Henle (Pisces, Elasmobranchii on the continental shelf off Ubatuba, Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Lucy Satiko Hashimoto Soares


    Full Text Available The diet and diel feeding pattern of the skate Raja agassizii were investigated through analysis of stomach contents. A total of 280 stomachs were collected by a series of hauls during a daily cycle in three periods, 8-10 January 1987, 22-24 July and 2-4 December 1988, from the inner continental shelf of the coastal ecosystem of Ubatuba, São Paulo State, Brazil (25º35'S; 45º00'W. According to the results of the stomach fullness and of the number of fresh prey, it is suggested that this species presents continuity in the feeding activity during a day. The stomach contents were mainly composed of crustaceans. Nematodes, polychaetes and fishes also occurred. No changes were observed in dietary composition between day and night.

  6. Kajian Penundaan Kematangan Pisang Raja (Musa paradisiaca Var. Sapientum L. Melalui Penggunaan Media Penyerap Etilen Kalium Permanganat

    Directory of Open Access Journals (Sweden)

    Sholihati Sholihati


    Full Text Available Abstrak. Indonesia adalah salah satu penghasil pisang terbesar di asia. Masa hidup pisang relatif pendek. Sehingga tidak dapat menjangkau jarak jauh dalam pemasaran. Tujuan penelitian ini adalah untuk mempelajari efek penyerap etilen kalium permanganat untuk menunda proses pematangan, untuk mengetahui efektivitas etilen kalium permanganat untuk menyerap etilen dan untuk mengembangkan model penentuan konsentrasi etilen selama penyimpanan sebelum proses pematangan. Hasil penelitian ini menunjukkan bahwa konsentrasi etilen setara dengan 0,16 ml/g.jam pada perlakuan 10 g , diikuti oleh perlakuan penyerap etilen 20 g dengan nilai setara dengan 0,06 ml/g.jam, penyerap 30 g sama dengan 0,03 ml / g.hour dan penyerap 40 g sama dengan 0,02 ml / g.hour pada suhu kamar 25 – 28 oC. Pada suhu dari 13, efektivitas penyerap etilen sama dengan 0,11 ml / g.hour pada perlakuan konsentrasi penyerap 10 g, diikuti oleh penyerap 20 g sama dengan 0,05 ml / g.hour . Penyerap 30 g sama dengan 0,03 ml / g.hour dan penyerap 40 g sama dengan 0,02 ml / g.hour. Fase klimakterik pada pisang dengan suhu 13 oC adalah di hari ke-11 , dengan produksi CO2 sama dengan 47,12 ml/kg dan produksi etilen sama dengan 1.82 ppm pada suhu ruang. Pada penggunaan etilen permanganat potasium diperoleh umur penyimpanan yang lebih panjang pada pisang, yaitu 20 hari pada suhu ruang dan 45 hari pada suhu 13 oC.   Study of Lengthen Shelf Life of Pisang Raja (Musa paradisiaca Var. Sapientum L. by Using Absorber Ethylene  Potassium Permanganate Substance Abstract. Indonesia is one of the biggest bananas producers in Asia. Banana is categorized as perishable  commodity,  therefore it cannot market is limited by distribution time.  Reach a long distance in marketing. This aim of this research is to study the effect of ethylene potassium permanganate to delay  the ripening of the fruit process, to know the effectiveness of ethylene potassium permanganate to absorb the ethylene and to develop

  7. Ontogenetic dietary shift and feeding strategy of Raja undulata Lacepède, 1802 (Chondrichthyes: Rajidae on the Portuguese continental shelf

    Directory of Open Access Journals (Sweden)

    Teresa Moura


    Full Text Available Under the scope of an ecosystem approach to fisheries, the understanding of trophic interactions is important for the assessment and consequently the proposal of suitable management measures. Raja undulata, like other rajids, is an important demersal predator in the Portuguese coastal community for which the biological and ecological information is still scarce. The ontogenetic dietary shift was investigated. Major length groups were defined through cluster analysis of the mean abundance of prey items. Prey diversity and feeding strategy were evaluated by length group. Multivariate analysis of variance was performed to test the influence of the factors sex, season and maturity on the diet of this species. It was concluded that R. undulata has a dietary ontogenetic shift within the definition of three major length groups (MLGs: 200-550 mm; 550-750 mm and 750-1000 mm. Diet varied from small and semi-pelagic to large and benthic prey. The feeding strategy of the species also changed from a generalised to a specialised diet. The decapod Polybius henslowi was the main prey item, especially for larger predators. Differences were found between sexes, maturity stages and seasons in each MLG.

  8. Polygalacturonase production by AR2 pectinolytic bacteria through submerged fermentation of raja nangka banana peel (Musa paradisiaca var. formatypica) with variation of carbon source and pectin (United States)

    Utami, R.; Widowati, E.; Ivenaria, A.; Mahajoeno, E.


    Polygalacturonase (EC catalyzes the hydrolysis of α-1,4-glycosidic bonds on galacturonic acid. Polygalacturonase can be produced from AR2 pectinolytic bacteria isolated from orange peel and vegetable waste. Commonly cost production of enzymes were high. However, with the advancement of technology, enzymes can now be manufactured at a low cost. Production of enzymes in low cost media with agro-industrial waste is interesting. Raja nangka banana peel is agro-industrial waste that is uneconomic. Therefore, this material can be used as a pectin source in polygalacturonase production. Polygalacturonase was produced by AR2 pectinolytic bacteria with the addition of various carbon sources (1% glucose, 1% galactose, 1% lactose) and variation of pectin concentrations (5%; 7.5%; 10%). This study used submerged fermentation with a cultivation temperature of 55°C and an agitation speed of 144 rpm for a 48-h incubation time. The results showed that variation of carbon sources and pectin concentrations affected the production of polygalacturonase. After 48 h fermentation, the results showed that the number of cells of samples ranged from 8.3 to 9.445 log cells/mL; the used pectin of samples ranged from 87.170-93.745%; and the polygalacturonase activity of samples ranged from 0.030 to 0.151 U/mL. The highest polygalacturonase activity was obtained by production of polygalacturonase on 1% glucose and 10% pectin medium.

  9. Local Strongmen At The Village Level: The Conflict Of The Demolition Of The First Raja Brawijaya ‘Petilasan’ At Sudimoro Village, Jombang

    Directory of Open Access Journals (Sweden)

    Mirojul Huda


    Full Text Available Having been enacted since 2014, the Act No. 6/2014 has given a spirit and a huge authority to the villages in developing their potential resources. Unfortunately, those special authorities have not been fcollowed by the leadership’s capacity of the village’s head. This paper attempts to analyze the rise of local actors so-called local strongmen at the village level. This study uses Sidel (1999 perspective on how to seek local strongmen in local area at Sudimoro Village, Megaluh District in Jombang Regency. In case, the head of Sudimoro village produces a despotic action by unloading and dredging the historical land where there was a petilasan from King of Majapahit, well-known as Raja Brawijaya 1. Then, this action eventually triggered a conflict in the middle of its society and has been solved after the hall of cultural heritage of the government of Jombang Regency has intervened. This paper concluded that the high of authority and power would potentially rise the new local strongmen at the village level. Therefore, the existence of the principle of recognition and subsidiarity owned by the village is only used by a few local elites for their interests without any accountability and accessibility for the society.

  10. DNA barcoding unveils skate (Chondrichthyes: Rajidae) species diversity in ‘ray’ products sold across Ireland and the UK (United States)

    Egan, Aaron; Fox, Jennifer; Greenfield, Adam; Mariani, Stefano


    Skates are widely consumed across the globe, but many large species are subject to considerable concern regarding their conservation and management. Within Europe such issues have recently driven policy changes so that, for the first time, reports of skate landings now have to be made under species-specific names. Total allowable catches have also been established for many groups, which have been set to zero for a number of the most vulnerable species (e.g., Dipturus batis, Raja undulata and Rostoraja alba). Whilst accurate species identification has become an important issue for landings, the sale of skates is still usually made under a blanket term of “skate” or “ray”. The matter of identifying species of skate is further complicated by their morphologically conservative nature and the fact that they are commercially valued for their wings. Thus, before sale their bodies are usually discarded (i.e., “winged”) and often skinned, making morphological identification impossible. For the first time, DNA barcoding (of the mitochondrial COI gene) was applied to samples of skate wings from retail outlets across the British Isles, providing insight into which species are sold for consumption. A total of 98 wing samples were analysed, revealing that six species were sold; blonde ray (Raja brachyura), spotted ray (Raja montagui), thornback ray (Raja clavata), cuckoo ray (Leucoraja naevus) small-eyed ray (Raja microocellata) and shagreen ray (Leucoraja fullonica). Statistical testing demonstrated that there were significant differences in the species sold in the distinct retail groups which suggests complex drivers behind the patterns of sale in skates. The results also indicate that endangered species are not commonly being passed on to consumers. In addition, the practice of selling skate wings under ambiguous labels is highlighted as it makes it extremely difficult for consumers to exercise a right to avoid species of conservation concern. Interestingly, a

  11. DNA barcoding unveils skate (Chondrichthyes: Rajidae species diversity in ‘ray’ products sold across Ireland and the UK

    Directory of Open Access Journals (Sweden)

    Andrew Mark Griffiths


    Full Text Available Skates are widely consumed across the globe, but many large species are subject to considerable concern regarding their conservation and management. Within Europe such issues have recently driven policy changes so that, for the first time, reports of skate landings now have to be made under species-specific names. Total allowable catches have also been established for many groups, which have been set to zero for a number of the most vulnerable species (e.g., Dipturus batis, Raja undulata and Rostoraja alba. Whilst accurate species identification has become an important issue for landings, the sale of skates is still usually made under a blanket term of “skate” or “ray”. The matter of identifying species of skate is further complicated by their morphologically conservative nature and the fact that they are commercially valued for their wings. Thus, before sale their bodies are usually discarded (i.e., “winged” and often skinned, making morphological identification impossible. For the first time, DNA barcoding (of the mitochondrial COI gene was applied to samples of skate wings from retail outlets across the British Isles, providing insight into which species are sold for consumption. A total of 98 wing samples were analysed, revealing that six species were sold; blonde ray (Raja brachyura, spotted ray (Raja montagui, thornback ray (Raja clavata, cuckoo ray (Leucoraja naevus small-eyed ray (Raja microocellata and shagreen ray (Leucoraja fullonica. Statistical testing demonstrated that there were significant differences in the species sold in the distinct retail groups which suggests complex drivers behind the patterns of sale in skates. The results also indicate that endangered species are not commonly being passed on to consumers. In addition, the practice of selling skate wings under ambiguous labels is highlighted as it makes it extremely difficult for consumers to exercise a right to avoid species of conservation concern

  12. Raja Roomann 80 / Maimu Raudsepp

    Index Scriptorium Estoniae

    Raudsepp, Maimu


    16. septembril 2001 tähistas oma sünnipäeva pedagoogikamagister, Cincinnati Kultuuriühingu asutaja ja ajaloouurija, raamatu "Urban Growth and the Development of an urban Sewer System. City of Cincinnati, 1800-1915" autor

  13. Measurement of X-ray mass attenuation coefficient of nickel around the K-edge using synchrotron radiation based X-ray absorption study

    International Nuclear Information System (INIS)

    Roy, Bunty Rani; Rajput, Parasmani; Jha, S.N.; Nageswara Rao, A.S.


    The work presents the X-ray absorption fine structure (XAFS) technique for measuring the X-ray mass attenuation coefficient of nickel metal foil in the X-ray energy range of 8271.2–8849.4 eV using scanning XAFS beam line (BL-09) at Indus-2 synchrotron radiation source facility, Raja Ramanna Centre for Advanced Technology (RRCAT) at Indore, India. The result represents the X-ray mass attenuation coefficient data for 0.02 mm thick Ni metal foil in the XAFS region of Ni K-edge. However, the results are compared to theoretical values using X-COM. There is a maximum deviation which is found exactly near the K-edge jump and decreases as we move away from the absorption edge. Oscillatory structure appears just above the observed absorption edge i.e., 8348.7 eV and is confined to around 250 eV above the edge. - Highlights: • Mass attenuation coefficient measurements of nickel using synchrotron radiation. • The measurements were taken exactly near the Ni K-edge at an energy step of 1 eV. • A maximum deviation is found near the K-edge

  14. Effect of temperature and pH on polygalacturonase production by pectinolytic bacteria Bacillus licheniformis strain GD2a in submerged medium from Raja Nangka (Musa paradisiaca var. formatypica) banana peel waste (United States)

    Widowati, E.; Utami, R.; Mahadjoeno, E.; Saputro, G. P.


    The aim of this research were to determine the effect of temperature (45°C, 55°C, 65°C) and pH (5.0; 6.0; 7.0) on the increase of total cell count and polygalacturonase enzyme activity produced from raja nangka banana (Musa paradisiaca var. formatypica) peel waste by pectinolytic bacterial Bacillus licheniformis strain GD2a. This research applied two sample repetition and one analysis repetition. The result showed temperature and pH affect total cell count. The total cell count on 45°C and pH 7 recorded the highest number at 9.469 log cell/ml. Temperature and pH also affected pectin concentration at the end of fermentation. The lowest pectin concentration recorded at 45°C and pH 7 was 0.425 %. The highest enzyme activity recorded at 65°C and pH 7 was 0.204 U/ml. The highest enzyme protein concentration was recorded at 65°C and resulted as 0.310 mg/ml on pH 6. The highest specific activity was 19.527 U/mg at 65°C and pH 7. By this result, could be concluded that optimum condition process on polygalacturonase production was at 65°C and pH 7 because it gave highest enzyme activity result (0,204 U/ml).

  15. Characterization of the functional and anatomical differences in the atrial and ventricular myocardium from three species of elasmobranch fishes: smooth dogfish (Mustelus canis), sandbar shark (Carcharhinus plumbeus), and clearnose skate (Raja eglanteria). (United States)

    Larsen, Julie; Bushnell, Peter; Steffensen, John; Pedersen, Morten; Qvortrup, Klaus; Brill, Richard


    We assessed the functional properties in atrial and ventricular myocardium (using isolated cardiac strips) of smooth dogfish (Mustelus canis), clearnose skate (Raja eglanteria), and sandbar shark (Carcharhinus plumbeus) by blocking Ca 2+ release from the sarcoplasmic reticulum (SR) with ryanodine and thapsigargin and measuring the resultant changes in contraction-relaxation parameters and the force-frequency relationship at 20 °C and 30 °C. We also examined ultrastructural differences with electron microscopy. In tissues from smooth dogfish, net force (per cross-sectional area) and measures of the speeds of contraction and relaxation were all higher in atrial than ventricular myocardium at both temperatures. Atrial-ventricular differences were evident in the other two species primarily in measures of the rates of contraction and relaxation. Ryanodine-thapsigargin treatment reduced net force and its maximum positive first derivative (i.e., contractility), and increased time to 50 % relaxation in atrial tissue from smooth dogfish at 30 °C. It also increased times to peak force and half relaxation in clearnose skate atrial and ventricular tissue at both temperatures, but only in atrial tissue from sandbar shark at 30 °C; indicating that SR involvement in excitation-contraction (EC) coupling is species- and temperature-specific in elasmobranch fishes, as it is in teleost fishes. Atrial and ventricular myocardium from all three species displayed a negative force-frequency relationship, but there was no evidence that SR involvement in EC coupling was influenced by heart rate. SR was evident in electron micrographs, generally located in proximity to mitochondria and intercalated discs, and to a lesser extent between the myofibrils; with mitochondria being more numerous in ventricular than atrial myocardium in all three species.

  16. Rapid Development of Microsatellite Markers with 454 Pyrosequencing in a Vulnerable Fish, the Mottled Skate, Raja pulchra

    Directory of Open Access Journals (Sweden)

    Jung-Ha Kang


    Full Text Available The mottled skate, Raja pulchra, is an economically valuable fish. However, due to a severe population decline, it is listed as a vulnerable species by the International Union for Conservation of Nature. To analyze its genetic structure and diversity, microsatellite markers were developed using 454 pyrosequencing. A total of 17,033 reads containing dinucleotide microsatellite repeat units (mean, 487 base pairs were identified from 453,549 reads. Among 32 loci containing more than nine repeat units, 20 primer sets (62% produced strong PCR products, of which 14 were polymorphic. In an analysis of 60 individuals from two R. pulchra populations, the number of alleles per locus ranged from 1–10, and the mean allelic richness was 4.7. No linkage disequilibrium was found between any pair of loci, indicating that the markers were independent. The Hardy–Weinberg equilibrium test showed significant deviation in two of the 28 single-loci after sequential Bonferroni’s correction. Using 11 primer sets, cross-species amplification was demonstrated in nine related species from four families within two classes. Among the 11 loci amplified from three other Rajidae family species; three loci were polymorphic. A monomorphic locus was amplified in all three Rajidae family species and the Dasyatidae family. Two Rajidae polymorphic loci amplified monomorphic target DNAs in four species belonging to the Carcharhiniformes class, and another was polymorphic in two Carcharhiniformes species.

  17. Cosmic rays

    International Nuclear Information System (INIS)

    Tkachev, I.I.


    In this talk I will review results of cosmic ray observations at the highest energies. This year the new results on energy spectra, composition and the study of arrival directions of cosmic ray primaries came from the Telescope Array collaboration. I present these results in comparison with measurements done by other recent experiments and discuss their implications for the search of cosmic ray sources. Some related results in gamma-ray astronomy and selected recent advances in theory are also covered. (author)

  18. Gastro-intestinal handling of water and solutes in three species of elasmobranch fish, the white-spotted bamboo shark, Chiloscyllium plagiosum, little skate, Leucoraja erinacea and the clear nose skate Raja eglanteria. (United States)

    Anderson, W Gary; Dasiewicz, Patricia J; Liban, Suadi; Ryan, Calen; Taylor, Josi R; Grosell, Martin; Weihrauch, Dirk


    The present study reports aspects of GI tract physiology in the white-spotted bamboo shark, Chiloscyllium plagiosum, little skate, Leucoraja erinacea and the clear nose skate, Raja eglanteria. Plasma and stomach fluid osmolality and solute values were comparable between species, and stomach pH was low in all species (2.2 to 3.4) suggesting these elasmobranchs may maintain a consistently low stomach pH. Intestinal osmolality, pH and ion values were comparable between species, however, some differences in ion values were observed. In particular Ca(2+) (19.67+/-3.65mM) and Mg(2+) (43.99+/-5.11mM) were high in L. erinacea and Mg(2+) was high (130.0+/-39.8mM) in C. palgiosum which may be an indication of drinking. Furthermore, intestinal fluid HCO(3)(-) values were low (8.19+/-2.42 and 8.63+/-1.48mM) in both skates but very high in C. plagiosum (73.3+/-16.3mM) suggesting ingested seawater may be processed by species-specific mechanisms. Urea values from the intestine to the colon dropped precipitously in all species, with the greatest decrease seen in C. plagiosum (426.0+/-8.1 to 0mM). This led to the examination of the molecular expression of both a urea transporter and a Rhesus like ammonia transporter in the intestine, rectal gland and kidney in L. erinacea. Both these transporters were expressed in all tissues; however, expression levels of the Rhesus like ammonia transporter were orders of magnitude higher than the urea transporter in the same tissue. Intestinal flux rates of solutes in L. erinacea were, for the most part, in an inward direction with the notable exception of urea. Colon flux rates of solutes in L. erinacea were all in an outward direction, although absolute rates were considerably lower than the intestine, suggestive of a much tighter epithelia. Results are discussed in the context of the potential role of the GI tract in salt and water, and nitrogen, homeostasis in elasmobranchs.

  19. Design of x-ray diagnostic beam line for a synchrotron radiation source and measurement results

    Energy Technology Data Exchange (ETDEWEB)

    Garg, Akash Deep, E-mail:; Karnewar, A.K.; Ojha, A.; Shrivastava, B.B.; Holikatti, A.C.; Puntambekar, T.A.; Navathe, C.P.


    Indus-2 is a 2.5 GeV synchrotron radiation source (SRS) operational at the Raja Ramanna Centre for Advanced Technology (RRCAT) in India. We have designed, developed and commissioned x-ray diagnostic beam line (X-DBL) at the Indus-2. It is based on pinhole array imaging (8–18 keV). We have derived new equations for online measurements of source position and emission angle with pinhole array optics. Measured values are compared with the measurements at an independent x-ray beam position monitor (staggered pair blade monitor) installed in the X-DBL. The measured values are close to the theoretical expected values within ±12 µm (or ±1.5 μrad) for sufficiently wide range of the beam movements. So, beside the beam size and the beam emittance, online information for the vertical position and angle is also used in the orbit steering. In this paper, the various design considerations of the X-DBL and online measurement results are presented.

  20. X-ray fluorescence in Member States (India): Micro-beam X-ray fluorescence spectroscopy using Indus-2 synchrotron radiation facility: beamline BL-16

    Energy Technology Data Exchange (ETDEWEB)

    Tiwari, M. K.; Lodha, G. S.; Deb, S.K., E-mail: [Indus Synchrotrons Utilization Division, Raja Ramanna Centre for Advanced Technology, Indore-452013 (MP) (India)


    Indus-1 and Indus-2, are India’s national synchrotron radiation facilities located at Raja Ramanna Centre for Advanced Technology (RRCAT), Indore. Indus-1 is a 450 MeV electron storage ring which provides synchrotron radiation in the VUV soft x-ray range with a critical wavelength of 61 Å whereas Indus-2 is a 2.5 GeV, 300 mA synchrotron radiation machine with a critical wavelength of 2 Å for its bending magnet source. The Indus-2 is at present operating at 2.5 GeV, 100 mA in round-theclock operation mode. Both synchrotron sources exist in the same premises of RRCAT, Indore and have very good air/rail connectivities with major cities of India. The RRCAT centre also fosters research and development activities in the fields of particle accelerators, Lasers and related advanced technologies like cryogenics, ultra high vacuum, superconducting cavities, RF power, magnet and their application in different fields of science, thus the centre provides a unique platform covering a wide range of experiments for the synchrotron users in the Indian subcontinent.

  1. Cosmic rays

    International Nuclear Information System (INIS)

    Dorfi, E.A.; Drury, L.O.C.; Voelk, H.J.; Webb, G.M.; Beck, R.; Biermann, P.; Heavens, A.; McKenzie, J.F.; Michel, F.C.


    The theory of diffusive shock acceleration was further developed with particular emphasis on the effects of time-dependence and wave-dissipation. Acceleration by pulsars and the production of gamma-ray bursts was also considered. (orig.)

  2. Canal rays

    International Nuclear Information System (INIS)

    Goldstein, Eugen


    For more than fifty years the German physicist Eugen Goldstein was engaged in an obscure fringe field of physics, on which he has impressed like no other: Electrical gas discharges. Goldstein describes in this book his discovery of canal rays, which has given important impulses for modern atomic physics. For his research Goldstein received the Prix Hebert of the Parisienne Academie des sciences, the Hughes medal, and was repeatedly proposed for the Nobel prize. In Germany for the Jewish scientist the acknowledgement remained far-reachingly refused until after the war.

  3. Skull x-ray (United States)

    X-ray - head; X-ray - skull; Skull radiography; Head x-ray ... There is low radiation exposure. X-rays are monitored and regulated to provide the minimum amount of radiation exposure needed to produce the image. Most ...

  4. Neck x-ray (United States)

    X-ray - neck; Cervical spine x-ray; Lateral neck x-ray ... There is low radiation exposure. X-rays are monitored so that the lowest amount of radiation is used to produce the image. Pregnant women and ...

  5. Ray converter

    International Nuclear Information System (INIS)

    Reiss, K.H.


    In a radiographic system a converter is used for changing image forming intensity distribution in a bundle of penetrating rays into a flow of electrically charged particles by electrodes located in a gas space and partly latticed (grids) which lie at potentials stepped from cathode to anode. The invention is particularly characterized by the provision of at least two grids extending between and parallel to the cathode and the anode. The electrical field which lies between two electrodes lies at least between the grids located closest to the cathode being to the extent of between 1 and 10 percent, in the average preferably 3 percent below the electrical break down field in the gas in a homogeneous electrical field

  6. X-Ray (United States)

    ... enema. What you can expect During the X-ray X-rays are performed at doctors' offices, dentists' offices, ... as those using a contrast medium. Your child's X-ray Restraints or other techniques may be used to ...

  7. Abdominal x-ray (United States)

    Abdominal film; X-ray - abdomen; Flat plate; KUB x-ray ... There is low radiation exposure. X-rays are monitored and regulated to provide the minimum amount of radiation exposure needed to produce the image. Most ...

  8. Chest X-Ray

    Medline Plus

    Full Text Available ... talk with you about chest radiography also known as chest x-rays. Chest x-rays are the ... treatment for a variety of lung conditions such as pneumonia, emphysema and cancer. A chest x-ray ...

  9. X-ray astronomy

    International Nuclear Information System (INIS)

    Giacconi, R.; Gursky, H.


    This text contains ten chapters and three appendices. Following an introduction, chapters two through five deal with observational techniques, mechanisms for the production of x rays in a cosmic setting, the x-ray sky and solar x-ray emission. Chapters six through ten include compact x-ray sources, supernova remnants, the interstellar medium, extragalactic x-ray sources and the cosmic x-ray background. Interactions of x rays with matter, units and conversion factors and a catalog of x-ray sources comprise the three appendices. (U.S.)

  10. Chest X-Ray

    Medline Plus

    Full Text Available ... about chest radiography also known as chest x-rays. Chest x-rays are the most commonly performed x-ray exams and use a very small dose of ... of the inside of the chest. A chest x-ray is used to evaluate the lungs, heart and ...

  11. X-ray sky

    International Nuclear Information System (INIS)

    Gruen, M.; Koubsky, P.


    The history is described of the discoveries of X-ray sources in the sky. The individual X-ray detectors are described in more detail, i.e., gas counters, scintillation detectors, semiconductor detectors, and the principles of X-ray spectrometry and of radiation collimation aimed at increased resolution are discussed. Currently, over 200 celestial X-ray sources are known. Some were identified as nebulae, in some pulsations were found or the source was identified as a binary star. X-ray bursts of novae were also observed. The X-ray radiation is briefly mentioned of spherical star clusters and of extragalactic X-ray sources. (Oy)

  12. Gamma ray generator (United States)

    Firestone, Richard B; Reijonen, Jani


    An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.

  13. Chest X-Ray

    Medline Plus

    Full Text Available ... some concerns about chest x-rays. However, it’s important to consider the likelihood of benefit to your health. While a chest x-ray use a ... posted: How to Obtain and Share ...

  14. ALICE Cosmic Ray Detector

    CERN Multimedia

    Fernandez Tellez, A; Martinez Hernandez, M; Rodriguez Cahuantzi, M


    The ALICE underground cavern provides an ideal place for the detection of high energy atmospheric muons coming from cosmic ray showers. ACORDE detects cosmic ray showers by triggering the arrival of muons to the top of the ALICE magnet.

  15. Chest X-Ray

    Medline Plus

    Full Text Available ... X-ray Transcript Welcome to Radiology Info dot org! Hello, I’m Dr. Geoffrey Rubin, a radiologist ... about chest x-rays, visit Radiology Info dot org. Thank you for your time! Spotlight Recently posted: ...

  16. X-ray apparatus

    International Nuclear Information System (INIS)

    Sell, L.J.


    A diagnostic x-ray device, readily convertible between conventional radiographic and tomographic operating modes, is described. An improved drive system interconnects and drives the x-ray source and the imaging device through coordinated movements for tomography

  17. X-ray - skeleton (United States)

    ... this page: // X-ray - skeleton To use the sharing features on this ... Degenerative bone conditions Osteomyelitis Risks There is low radiation exposure. X-rays machines are set to provide the smallest ...

  18. Rekordhind Man Ray eest

    Index Scriptorium Estoniae


    Ameerika sürrealistliku fotograafi Man Ray 1926. a. Pariisis pildistatud foto 'Must ja valge, Pariis (positiiv ja negatiiv)', mis kujutab Ray armukese Kiki de Montparnasse'i portreed, maksis New Yorgi fotooksjonil 7, 3 miljonit Eesti krooni

  19. Chest X-Ray

    Medline Plus

    Full Text Available ... I’d like to talk with you about chest radiography also known as chest x-rays. Chest x-rays are the most ... far outweighs any risk. For more information about chest x-rays, visit Radiology Info dot org. Thank you for your time! ...

  20. Chest X-Ray

    Medline Plus

    Full Text Available ... by Image/Video Gallery Your Radiologist Explains Chest X-ray Transcript Welcome to Radiology Info dot org! Hello, ... you about chest radiography also known as chest x-rays. Chest x-rays are the most commonly performed ...

  1. Flash X-ray

    International Nuclear Information System (INIS)

    Sato, Eiichi


    Generation of quasi-monochromatic X-ray by production of weakly ionized line plasma (flash X-ray), high-speed imaging by the X-ray and high-contrast imaging by the characteristic X-ray absorption are described. The equipment for the X-ray is consisted from the high-voltage power supply and condenser, turbo molecular pump, and plasma X-ray tube. The tube has a long linear anticathode to produce the line plasma and flash X-ray at 20 kA current at maximum. X-ray spectrum is measured by the imaging plate equipped in the computed radiography system after diffracted by a LiF single crystal bender. Cu anticathode generates sharp peaks of K X-ray series. The tissue images are presented for vertebra, rabbit ear and heart, and dog heart by X-ray fluoroscopy with Ce anticathode. Generation of K-orbit characteristic X-ray with extremely low bremsstrahung is to be attempted for medical use. (N.I.)

  2. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... ray examination. X-rays usually have no side effects in the typical diagnostic range for this exam. ... x-rays. A Word About Minimizing Radiation Exposure Special care is taken during x-ray examinations to ...

  3. X-ray astronomy

    International Nuclear Information System (INIS)

    Culhane, J.L.; Sanford, P.W.


    X-ray astronomy has been established as a powerful means of observing matter in its most extreme form. The energy liberated by sources discovered in our Galaxy has confirmed that collapsed stars of great density, and with intense gravitational fields, can be studied by making observations in the X-ray part of the electromagnetic spectrum. The astronomical objects which emit detectable X-rays include our own Sun and extend to quasars at the edge of the Universe. This book describes the history, techniques and results obtained in the first twenty-five years of exploration. Space rockets and satellites are essential for carrying the instruments above the Earth's atmosphere where it becomes possible to view the X-rays from stars and nebulae. The subject is covered in chapters, entitled: the birth of X-ray astronomy; the nature of X-radiation; X-rays from the Sun; solar-flare X-rays; X-rays from beyond the solar system; supernovae and their remnants; X-rays from binary stars; white dwarfs and neutron stars; black holes; X-rays from galaxies and quasars; clusters of galaxies; the observatories of the future. (author)

  4. X-ray holography

    International Nuclear Information System (INIS)

    Faigel, G.; Tegze, M.; Belakhovsky, M.; Marchesini, S.; Bortel, G.


    In the last decade holographic methods using hard X-rays were developed. They are able to resolve atomic distances, and can give the 3D arrangement of atoms around a selected element. Therefore, hard X-ray holography has potential applications in chemistry, biology and physics. In this article we give a general description of these methods and discuss the developments in the experimental technique. The capabilities of hard X-ray holography are demonstrated by examples

  5. Providing x-rays

    International Nuclear Information System (INIS)

    Mallozzi, P.J.; Epstein, H.M.


    This invention provides an apparatus for providing x-rays to an object that may be in an ordinary environment such as air at approximately atmospheric pressure. The apparatus comprises: means (typically a laser beam) for directing energy onto a target to produce x-rays of a selected spectrum and intensity at the target; a fluid-tight enclosure around the target; means for maintaining the pressure in the first enclosure substantially below atmospheric pressure; a fluid-tight second enclosure adjoining the first enclosure, the common wall portion having an opening large enough to permit x-rays to pass through but small enough to allow the pressure reducing means to evacuate gas from the first enclosure at least as fast as it enters through the opening; the second enclosure filled with a gas that is highly transparent to x-rays; the wall of the second enclosure to which the x-rays travel having a portion that is highly transparent to x-rays (usually a beryllium or plastic foil), so that the object to which the x-rays are to be provided may be located outside the second enclosure and adjacent thereto and thus receive the x-rays substantially unimpeded by air or other intervening matter. The apparatus is particularly suited to obtaining EXAFS (extended x-ray fine structure spectroscopy) data on a material

  6. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Fichtel, C.E.


    The first certain detection of celestial high energy gamma rays came from a satellite experiment flown on the third Orbiting Solar Observatory (OSO-111). A Gamma ray spark chamber telescope with substantively greater sensitivity and angular resolution (a few degrees) flown on the second Small Astronomy Satellite (SAS-II) has now provided a better picture of the gamma ray sky, and particularly the galactic plane and pulsars. This paper will summarize the present picture of gamma ray astronomy as it has developed at this conference from measurements made with experiments carried out on balloons, those remaining on the ground, and ones flown on satellites. (orig.) [de

  7. High energy cosmic rays

    CERN Document Server

    Stanev, Todor


    Offers an accessible text and reference (a cosmic-ray manual) for graduate students entering the field and high-energy astrophysicists will find this an accessible cosmic-ray manual Easy to read for the general astronomer, the first part describes the standard model of cosmic rays based on our understanding of modern particle physics. Presents the acceleration scenario in some detail in supernovae explosions as well as in the passage of cosmic rays through the Galaxy. Compares experimental data in the atmosphere as well as underground are compared with theoretical models

  8. Peranan Raja La Maddaremmeng Dalam Penyebaran Islam Di Bone

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin


    Full Text Available King Bone to Lamaddaremmeng XIII has a very large role and has the effect of early-early development of Islam in southern Sulawesi. He Maddaremeng is committed to enforce Sharia Law. His efforts were Eliminating slavery, Addition parewa Sara, to revamp the governance structure by adding positions previously unknown structure that positions parewa sara, eradication of idols, eliminating the arbitrary actions on others, Equal rights. Other efforts are trying to eliminate the differences in the degree of the community.

  9. Unsur Estetika Islam pada Seni Hias Istana Raja Bugis


    Yunus, Pangeran Paita; Soedarsono, Soedarsono; Gustami, SP


    Continuity in the development of art, especially Hindu art Indonesia reached a new tradition at the time of the power of the king who converted to Islam, in which the development of Islamic art in Indonesia based on the palace of the king. In this cultural arts center arts fostered and developed based on a long artistic tradition with new values ​​that Islam breath. Symbolic and aesthetic elements in the building of Islam in Indonesia, is a reflection of culture in a region of breath. Big or ...

  10. X-ray interferometers

    International Nuclear Information System (INIS)

    Franks, A.


    An improved type of amplitude-division x-ray interferometer is described. The wavelength at which the interferometer can operate is variable, allowing the instrument to be used to measure x-ray wavelength, and the angle of inclination is variable for sample investigation. (U.K.)

  11. Jyotiranjan S Ray

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Jyotiranjan S Ray. Articles written in Journal of Earth System Science. Volume 109 Issue 1 March 2000 pp 39-47. Emplacement of Amba Dongar Carbonatite-alkaline Complex at Cretaceous/Tertiary Boundary: Evidence from 40Ar-39Ar Chronology · Jyotiranjan S Ray ...

  12. Gamma-ray sources

    International Nuclear Information System (INIS)

    Hermsen, W.


    Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)

  13. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Hillier, R.


    The book reviews the development of gamma ray astronomy over the past twenty five years. A large section of the book is devoted to the problems of background radiation and the design of detectors. Gamma rays from the sun, the galactic disc, the galaxy, and extra galactic sources; are also discussed. (U.K.)

  14. Extremity x-ray (United States)

    ... page: // Extremity x-ray To use the sharing features on this page, ... in the body Risks There is low-level radiation exposure. X-rays are monitored and regulated to provide the ...

  15. Gamma-ray astrophysics

    International Nuclear Information System (INIS)

    Fichtel, C.E.


    The most striking feature of the celestial sphere when viewed in the frequency range of γ-rays is the emission from the galactic plane, which is particularly intense in the galactic longitudinal region from 300 0 to 50 0 . The longitudinal and latitudinal distributions are generally correlated with galactic structural features and when studied in detail suggest a non-uniform distribution of cosmic rays in the galaxy. Several point γ-ray sources have now been observed, including four radio pulsars. This last result is particularly striking since only one radio pulsar has been seen at either optical or X-ray frequencies. Nuclear γ-ray lines have been seen from the Sun during a large solar flare and future satellite experiments are planned to search for γ-ray lines from supernovae and their remnants. A general apparently diffuse flux of γ-rays has also been seen whose energy spectrum has interesting implications; however, in view of the possible contribution of point sources and the observation of galactic features such as Gould's belt, its interpretation must await γ-ray experiments with finer spatial and energy resolution, as well as greater sensitivity. (Auth.)

  16. Interactive Stable Ray Tracing

    DEFF Research Database (Denmark)

    Dal Corso, Alessandro; Salvi, Marco; Kolb, Craig


    Interactive ray tracing applications running on commodity hardware can suffer from objectionable temporal artifacts due to a low sample count. We introduce stable ray tracing, a technique that improves temporal stability without the over-blurring and ghosting artifacts typical of temporal post-pr...

  17. X-rays utilization

    International Nuclear Information System (INIS)

    Rebigan, F.


    The modality of X-ray utilization in different activities and economy is given. One presents firstly quantities and units used in radiation dosimetry and other fields. One gives the generation of X-rays, their properties as well as the elements of radiation protection. The utilization characteristics of these radiations in different fields are finally given. (author)

  18. Primary cosmic ray flux

    Energy Technology Data Exchange (ETDEWEB)

    Stanev, Todor


    We discuss the primary cosmic ray flux from the point of view of particle interactions and production of atmospheric neutrinos. The overall normalization of the cosmic ray flux and its time variations and site dependence are major ingredients of the atmospheric neutrino predictions and the basis for the derivation of the neutrino oscillation parameters.

  19. Chest X-Ray

    Medline Plus

    Full Text Available ... by Image/Video Gallery Your Radiologist Explains Chest X-ray Transcript Welcome to Radiology Info dot org! Hello, ... d like to talk with you about chest radiography also known as chest x-rays. Chest x- ...

  20. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small ... X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive medical ...

  1. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small dose ... limitations of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is ...

  2. X-ray examination apparatus

    NARCIS (Netherlands)


    The invention relates to an X-ray apparatus which includes an adjustable X-ray filter. In order to adjust an intensity profile of the X-ray beam, an X-ray absorbing liquid is transported to filter elements of the X-ray filter. Such transport is susceptible to gravitational forces which lead to an

  3. X-Ray Exam: Pelvis (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Pelvis KidsHealth / For Parents / X-Ray Exam: ... Ray Exam: Hip Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  4. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very ... of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive ...

  5. Basics of Gamma Ray Detection

    Energy Technology Data Exchange (ETDEWEB)

    Stinnett, Jacob [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Venkataraman, Ram [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)


    The objective of this training is to explain the origin of x-rays and gamma rays, gamma ray interactions with matter, detectors and electronics used in gamma ray-spectrometry, and features of a gamma-ray spectrum for nuclear material that is safeguarded.

  6. Bone X-Ray (Radiography) (United States)

    ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small ... of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive ...

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone Bone x-ray uses a very small ... of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray (radiograph) is a noninvasive ...

  8. Abdomen X-Ray (Radiography) (United States)

    ... News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Abdomen Abdominal x-ray uses a very small ... of an abdominal x-ray? What is abdominal x-ray? An x-ray (radiograph) is a noninvasive medical ...

  9. Biogeochemical studies of technetium in marine and estuarine ecosystems. Progress report, 1 July 1979-30 June 1980

    International Nuclear Information System (INIS)

    Beasley, T.M.


    Progress is reported in research dealing with the biogeochemical behavior of technetium in marine and estuarine ecosystems. Studies were planned to elaborate the biokinetic behavior of Tc as TcO 4 - in selected marine and estuarine organisms and to determine the affinity of TcO 4 - for different marine sediments under oxygenated conditions. It is concluded that concentration factors for TcO 4 - in bivalve molluscs (oysters and mussels) do not exceed 2 when calculated for whole animals and when uptake is directly from water. Direct uptake from water by limpets (archeogastropod) are very much lower than have been reported for red abalone (archeogastropod). Whole body concentration factors for TcO 4 - in the plaice, Pleuronectes platessa, where uptake is directly from labeled seawater, do not exceed 10 at equilibrium. Both the lobster, Homarus gammaris and the polychaete, Nereis diversicolor appear to concentrate Tc efficiently from water labelled intially with TcO 4 - . Both plaice and rays (Raja clavata) fed /sup 95m/Tc labeled Nereis show an initial rapid loss of the isotope for approximately five days. Thereafter, loss is much reduced. Shrimp (Palaemon elegans), Cragnon sp.) and Crab (Cancer pagurus) show concentration factors similar to plaice (C.F. is less than 10). Isopods, however, have concentration factors of only 3 following four weeks exposure to labeled seawater. Uptake of TcO 4 - by phytoplankton is extremely low, which precludes experiments in which TcO 4 - labeled phytoplankton can be fed to either bivalve molluscs or microzooplankton. Sediment distribution coefficients for TcO 4 - are essentially zero and are independent of sediment type in well oxygenated seawater. Experiments to date have shown that it is not possible to make generalizations concerning the bioavailability of TcO 4 - to marine organisms

  10. X-ray crystallography (United States)


    X-rays diffracted from a well-ordered protein crystal create sharp patterns of scattered light on film. A computer can use these patterns to generate a model of a protein molecule. To analyze the selected crystal, an X-ray crystallographer shines X-rays through the crystal. Unlike a single dental X-ray, which produces a shadow image of a tooth, these X-rays have to be taken many times from different angles to produce a pattern from the scattered light, a map of the intensity of the X-rays after they diffract through the crystal. The X-rays bounce off the electron clouds that form the outer structure of each atom. A flawed crystal will yield a blurry pattern; a well-ordered protein crystal yields a series of sharp diffraction patterns. From these patterns, researchers build an electron density map. With powerful computers and a lot of calculations, scientists can use the electron density patterns to determine the structure of the protein and make a computer-generated model of the structure. The models let researchers improve their understanding of how the protein functions. They also allow scientists to look for receptor sites and active areas that control a protein's function and role in the progress of diseases. From there, pharmaceutical researchers can design molecules that fit the active site, much like a key and lock, so that the protein is locked without affecting the rest of the body. This is called structure-based drug design.

  11. X-ray lasers

    CERN Document Server

    Elton, Raymond C


    The first in its field, this book is both an introduction to x-ray lasers and a how-to guide for specialists. It provides new entrants and others interested in the field with a comprehensive overview and describes useful examples of analysis and experiments as background and guidance for researchers undertaking new laser designs. In one succinct volume, X-Ray Lasers collects the knowledge and experience gained in two decades of x-ray laser development and conveys the exciting challenges and possibilities still to come._Add on for longer version of blurb_M>The reader is first introduced

  12. X-ray apparatus

    International Nuclear Information System (INIS)

    Bernstein, S.; Stagg, L.; Lambert, T.W.; Griswa, P.J.


    A patient support system for X-ray equipment in arteriographic studies of the heart is described in detail. The support system has been designed to overcome many of the practical problems encountered in using previous types of arteriographic X-ray equipment. The support system is capable of horizontal movement and, by a series of shafts attached to the main support system, the X-ray source and image intensifier or detector may be rotated through the same angle. The system is highly flexible and details are given of several possible operational modes. (U.K.)

  13. X-ray detector

    International Nuclear Information System (INIS)

    Whetten, N.R.; Houston, J.M.


    An ionization chamber for use in determining the spatial distribution of x-ray photons in tomography systems comprises a plurality of substantially parallel, planar anodes separated by parallel, planar cathodes and enclosed in a gas of high atomic weight at a pressure from approximately 10 atmospheres to approximately 50 atmospheres. The cathode and anode structures comprise metals which are substantially opaque to x-ray radiation and thereby tend to reduce the resolution limiting effects of x-ray fluoresence in the gas. In another embodiment of the invention the anodes comprise parallel conductive bars disposed between two planar cathodes. Guard rings eliminate surface leakage currents between adjacent electrodes. 8 figures

  14. X-ray apparatus

    International Nuclear Information System (INIS)

    Grady, J.K.


    X-ray apparatus is described which has a shutter between the X-ray source and the patient. The shutter controls the level of radiation to which the patient is exposed instead of merely discontinuing the electric power supplied to the source. When the shutter is opened a radiation sensor senses the level of X-radiation. When a preset quantity of X-radiation has been measured an exposure control closes the shutter. Instead of using the radiation sensor, the integrated power supplied to the anode of the X-ray source may be measured. (author)

  15. Computer ray tracing speeds. (United States)

    Robb, P; Pawlowski, B


    The results of measuring the ray trace speed and compilation speed of thirty-nine computers in fifty-seven configurations, ranging from personal computers to super computers, are described. A correlation of ray trace speed has been made with the LINPACK benchmark which allows the ray trace speed to be estimated using LINPACK performance data. The results indicate that the latest generation of workstations, using CPUs based on RISC (Reduced Instruction Set Computer) technology, are as fast or faster than mainframe computers in compute-bound situations.

  16. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... of knee x-rays. A portable x-ray machine is a compact apparatus that can be taken ... of the body being examined, an x-ray machine produces a small burst of radiation that passes ...

  17. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... that might interfere with the x-ray images. Women should always inform their physician and x-ray ... Safety page for more information about radiation dose. Women should always inform their physician or x-ray ...

  18. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... drawer under the table holds the x-ray film or image recording plate . Sometimes the x-ray ... extended over the patient while an x-ray film holder or image recording plate is placed beneath ...

  19. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... are the limitations of Bone X-ray (Radiography)? What is Bone X-ray (Radiography)? An x-ray ( ... leg (shin), ankle or foot. top of page What are some common uses of the procedure? A ...

  20. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose ...

  1. Chest X-Ray

    Medline Plus

    Full Text Available ... Disorders Video: The Basketball Game: An MRI Story Radiology and You Sponsored by Image/Video Gallery Your Radiologist Explains Chest X-ray Transcript Welcome to Radiology Info dot org! Hello, I’m Dr. Geoffrey ...

  2. Chest X-Ray

    Medline Plus

    Full Text Available ... also be useful to help diagnose and monitor treatment for a variety of lung conditions such as pneumonia, emphysema and cancer. A chest x-ray requires no special preparation. ...

  3. X-ray tubes

    International Nuclear Information System (INIS)

    Young, R.W.


    A form of x-ray tube is described which provides satisfactory focussing of the electron beam when the beam extends for several feet from gun to target. Such a tube can be used for computerised tomographic scanning. (UK)

  4. Chest X-Ray

    Medline Plus

    Full Text Available ... breath, persistent cough, fever, chest pain or injury. It may also be useful to help diagnose and ... have some concerns about chest x-rays. However, it’s important to consider the likelihood of benefit to ...

  5. Chest X-Ray

    Medline Plus

    Full Text Available ... An MRI Story Radiology and You Sponsored by Image/Video Gallery Your Radiologist Explains Chest X-ray ... posted: How to Obtain and Share Your Medical Images Movement Disorders Video: The Basketball Game: An MRI ...

  6. Chest X-Ray

    Medline Plus

    Full Text Available ... accurate diagnosis far outweighs any risk. For more information about chest x-rays, visit Radiology Info dot ... Inc. (RSNA). To help ensure current and accurate information, we do not permit copying but encourage linking ...

  7. Chest X-Ray

    Medline Plus

    Full Text Available ... Site Index A-Z Spotlight Recently posted: Pancreatic Cancer The Limitations of Online Dose Calculators Video: The ... of lung conditions such as pneumonia, emphysema and cancer. A chest x-ray requires no special preparation. ...

  8. Chest X-Ray

    Medline Plus

    Full Text Available ... exams and use a very small dose of ionizing radiation to produce pictures of the inside of the ... chest x-ray use a tiny dose of ionizing radiation, the benefit of an accurate diagnosis far outweighs ...

  9. Chest X-Ray

    Medline Plus

    Full Text Available ... However, it’s important to consider the likelihood of benefit to your health. While a chest x-ray use a tiny dose of ionizing radiation, the benefit of an accurate diagnosis far outweighs any risk. ...

  10. Cosmic ray acceleration mechanisms

    International Nuclear Information System (INIS)

    Cesarsky, C.J.


    We present a brief summary of some of the most popular theories of cosmic ray acceleration: Fermi acceleration, its application to acceleration by shocks in a scattering medium, and impulsive acceleration by relativistic shocks

  11. Chest X-Ray

    Medline Plus

    Full Text Available ... June is Men's Health Month Recently posted: Pancreatic Cancer The Limitations of Online Dose Calculators Video: The ... of lung conditions such as pneumonia, emphysema and cancer. A chest x-ray requires no special preparation. ...

  12. X-ray sources

    International Nuclear Information System (INIS)

    Masswig, I.


    The tkb market survey comparatively evaluates the X-ray sources and replacement tubes for stationary equipment currently available on the German market. It lists the equipment parameters of 235 commercially available X-ray sources and their replacement tubes and gives the criteria for purchase decisions. The survey has been completed with December 1985, and offers good information concerning medical and technical aspects as well as those of safety and maintenance. (orig.) [de

  13. Cosmic rays in space

    International Nuclear Information System (INIS)

    Fujitaka, Kazunobu


    Cosmos is a mysterious space by which many researchers are fascinated for many years. But, going into space means that we will receive extra exposure due to existence of cosmic rays. Cosmic rays are mainly composed of highly energetic protons. It was born in the last stage of stellar life. Understanding of cosmos will certainly bring right understanding of radiation energy, or energy itself. As no one could see the very early stage of cosmic rays, there is only a speculation. But it is better to speculate something based on certain side evidences, than to give up the whole. Such attitude shall be welcomed in the space researches. Anyway, cosmic rays were born in the last explosion of a star, which is called as Super Nova. After cosmic rays are emitted from the Super Nova, it will reach to the human surroundings. To indicate its intensity, special unit of ''dose rate'' is used. When a man climbs a mountain, cosmic ray intensity surely increases. It doubles as he goes up every 1500m elevation. It was ascertained by our own measurements. Then what happens when the goes up more? At aviation altitude, where airplanes fly, the dose rate will be increased up to 100times the high mountain cases. And what is expected when he goes up further more, up to space orbit altitude? In this case, the dose rate increases up to 10times the airplane cases. Geomagnetism affects the dose rate very much. As primary cosmic ray particles are charged particles, they cannot do well with existence of the magnetic field. In effect, cosmic rays can penetrate into the polar atmosphere along geomagnetic lines of forces which stand almost vertical, but penetration of low energy cosmic rays will be banned when they intend to penetrate crossing the geomagnetic lines of forces in equatorial region. Therefore, exposure due to cosmic rays will become large in polar region, while it remains small in equatorial region. In effect, airplanes which fly over the equator. Only, we have to know that the cosmos

  14. X-Ray Absorption with Transmission X-Ray Microscopes

    NARCIS (Netherlands)

    de Groot, F.M.F.


    In this section we focus on the use of transmission X-ray microscopy (TXM) to measure the XAS spectra. In the last decade a range of soft X-ray and hard X-ray TXM microscopes have been developed, allowing the measurement of XAS spectra with 10–100 nm resolution. In the hard X-ray range the TXM

  15. Anisotropic ray trace (United States)

    Lam, Wai Sze Tiffany

    Optical components made of anisotropic materials, such as crystal polarizers and crystal waveplates, are widely used in many complex optical system, such as display systems, microlithography, biomedical imaging and many other optical systems, and induce more complex aberrations than optical components made of isotropic materials. The goal of this dissertation is to accurately simulate the performance of optical systems with anisotropic materials using polarization ray trace. This work extends the polarization ray tracing calculus to incorporate ray tracing through anisotropic materials, including uniaxial, biaxial and optically active materials. The 3D polarization ray tracing calculus is an invaluable tool for analyzing polarization properties of an optical system. The 3x3 polarization ray tracing P matrix developed for anisotropic ray trace assists tracking the 3D polarization transformations along a ray path with series of surfaces in an optical system. To better represent the anisotropic light-matter interactions, the definition of the P matrix is generalized to incorporate not only the polarization change at a refraction/reflection interface, but also the induced optical phase accumulation as light propagates through the anisotropic medium. This enables realistic modeling of crystalline polarization elements, such as crystal waveplates and crystal polarizers. The wavefront and polarization aberrations of these anisotropic components are more complex than those of isotropic optical components and can be evaluated from the resultant P matrix for each eigen-wavefront as well as for the overall image. One incident ray refracting or reflecting into an anisotropic medium produces two eigenpolarizations or eigenmodes propagating in different directions. The associated ray parameters of these modes necessary for the anisotropic ray trace are described in Chapter 2. The algorithms to calculate the P matrix from these ray parameters are described in Chapter 3 for

  16. Panoramic Dental X-Ray (United States)

    ... Physician Resources Professions Site Index A-Z Panoramic Dental X-ray Panoramic dental x-ray uses a very small dose of ... x-ray , is a two-dimensional (2-D) dental x-ray examination that captures the entire mouth ...

  17. Subluminous X-ray binaries

    NARCIS (Netherlands)

    Armas Padilla, M.


    The discovery of the first X-ray binary, Scorpius X-1, by Giacconi et al. (1962), marked the birth of X-ray astronomy. Following that discovery, many additional X-ray sources where found with the first generation of X-ray rockets and observatories (e.g., UHURU and Einstein). The short-timescale

  18. X-Ray Exam: Forearm (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Forearm KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  19. X-Ray Exam: Foot (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Foot KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  20. X-Ray Exam: Wrist (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Wrist KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  1. Thoracic spine x-ray (United States)

    Vertebral radiography; X-ray - spine; Thoracic x-ray; Spine x-ray; Thoracic spine films; Back films ... There is low radiation exposure. X-rays are monitored and regulated to provide the minimum amount of radiation exposure needed to produce the image. Most ...

  2. X-Ray Exam: Finger (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Finger KidsHealth / For Parents / X-Ray Exam: ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  3. 11. European cosmic ray symposium

    International Nuclear Information System (INIS)


    The biannual Symposium includes all aspects of cosmic ray research. The scientific programme was organized under three main headings: Cosmic rays in the heliosphere, Cosmic rays in the interstellar and extragalactic space, Properties of high-energy interactions as studied by cosmic rays. Seven invited talks were indexed seprately for the INIS database. (R.P.)

  4. Cosmic ray modulation

    International Nuclear Information System (INIS)

    Ueno, Hirosachi


    It is important to know the physical state of solar plasma region by the observation of intensity variation of cosmic ray which passed through the solar plasma region, because earth magnetosphere is formed by the interaction between geomagnetic field and solar plasma flow. The observation of cosmic ray intensity is useful to know the average condition of the space of 0.1--3 A.U., and gives the structure of the magnetic field in solar wind affecting the earth magnetosphere. The observation of neutron component in cosmic ray has been carried out at Norikura, Tokyo, Fukushima and Morioka. The lower limit of the energy of incident cosmic ray which can be observed at each station is different, and the fine structure of the variation can be known by comparison. The intensity of meson component in cosmic ray has been measured in underground, and the state of solar plasma region 2--3 A.U. from the earth can be known. The underground measurement has been made at Takeyama and Matsumoto, and a new station at Sakashita is proposed. The measurement at Sakashita will be made by proportional counters at the depth of 100m (water equivalent). Arrangement of detectors is shown. (Kato, T.)

  5. CRL X-ray tube

    International Nuclear Information System (INIS)

    Kolchevsky, N.N.; Petrov, P.V.


    A novel types of X-ray tubes with refractive lenses are proposed. CRL-R X-ray tube consists of Compound Refractive Lens- CRL and Reflection X-ray tube. CRL acts as X-ray window. CRL-T X-ray consists of CRL and Transmission X-ray tube. CRL acts as target for electron beam. CRL refractive lens acts as filter, collimator, waveguide and focusing lens. Properties and construction of the CRL X-ray tube are discussed. (authors)

  6. X rays and condensed matter

    International Nuclear Information System (INIS)

    Daillant, J.


    After a historical review of the discovery and study of X rays, the various interaction processes between X rays and matter are described: Thomson scattering, Compton scattering, X-photon absorption through photoelectric effect, and magnetic scattering. X ray sources such as the European Synchrotron Radiation Facility (ESRF) are described. The various X-ray applications are presented: imagery such as X tomography, X microscopy, phase contrast; X-ray photoelectron spectroscopy and X-ray absorption spectroscopy; X-ray scattering and diffraction techniques

  7. X-ray tube

    International Nuclear Information System (INIS)

    Webley, R.S.


    The object of the invention described is to provide an X-ray tube providing a scanned X-ray output which does not require a scanned electron beam. This is obtained by an X-ray tube including an anode which is rotatable about an axis, and a source of a beam of energy, for example an electron beam, arranged to impinge on a surface of the anode to generate X-radiation substantially at the region of incidence on the anode surface. The anode is rotatable about the axis to move the region of incidence over the surface. The anode is so shaped that the rotation causes the region of incidence to move in a predetermined manner relative to fixed parts of the tube so that the generated X-radiation is scanned in a predetermined manner relative to the tube. (UK)

  8. X-ray astronomy

    International Nuclear Information System (INIS)

    Giacconi, R.; Setti, G.


    This book contains the lectures, and the most important seminars held at the NATO meeting on X-Ray astronomy in Erice, July 1979. The meeting was an opportune forum to discuss the results of the first 8-months of operation of the X-ray satellite, HEAO-2 (Einstein Observatory) which was launched at the end of 1978. Besides surveying these results, the meeting covered extragalactic astronomy, including the relevant observations obtained in other portions of the electromagnetic spectrum (ultra-violet, optical, infrared and radio). The discussion on galactic X-ray sources essentially covered classical binaries, globular clusters and bursters and its significance to extragalactic sources and to high energy astrophysics was borne in mind. (orig.)

  9. Cosmic Rays and Climate

    CERN Document Server

    Kirkby, Jasper


    Among the most puzzling questions in climate change is that of solar-climate variability, which has attracted the attention of scientists for more than two centuries. Until recently, even the existence of solar-climate variability has been controversial—perhaps because the observations had largely involved correlations between climate and the sunspot cycle that had persisted for only a few decades. Over the last few years, however, diverse reconstructions of past climate change have revealed clear associations with cosmic ray variations recorded in cosmogenic isotope archives, providing persuasive evidence for solar or cosmic ray forcing of the climate. However, despite the increasing evidence of its importance, solar-climate variability is likely to remain controversial until a physical mechanism is established. Although this remains a mystery, observations suggest that cloud cover may be influenced by cosmic rays, which are modulated by the solar wind and, on longer time scales, by the geomagnetic fiel...

  10. X-ray beam generator

    International Nuclear Information System (INIS)

    Koller, T.J.; Randmer, J.A.


    A method of minimizing the preferential angular absorption of the divergent beam from an X-ray generator is described. The generator consists of an X-ray shielded housing with an X-ray transmissive window symmetrically placed in radial alignment with a focal spot area on a sloped target surface of an X-ray tube in the housing. The X-ray tube may be of the stationary anode type or of the rotating anode type. (U.K.)

  11. Educational Cosmic Ray Arrays

    International Nuclear Information System (INIS)

    Soluk, R. A.


    In the last decade a great deal of interest has arisen in using sparse arrays of cosmic ray detectors located at schools as a means of doing both outreach and physics research. This approach has the unique advantage of involving grade school students in an actual ongoing experiment, rather then a simple teaching exercise, while at the same time providing researchers with the basic infrastructure for installation of cosmic ray detectors. A survey is made of projects in North America and Europe and in particular the ALTA experiment at the University of Alberta which was the first experiment operating under this paradigm

  12. Flash x-ray

    International Nuclear Information System (INIS)

    Johnson, Q.; Pellinen, D.


    The complementary techniques of flash x-ray radiography (FXR) and flash x-ray diffraction (FXD) provide access to a unique domain in nondestructive materials testing. FXR is useful in studies of macroscopic properties during extremely short time intervals, and FXD, the newer technique, is used in studies of microscopic properties. Although these techniques are similar in many respects, there are some substantial differences. FXD generally requires low-voltage, line-radiation sources and extremely accurate timing; FXR is usually less demanding. Phenomena which can be profitably studied by FXR often can also be studied by FXD to permit a complete materials characterization

  13. Cosmic ray investigations

    International Nuclear Information System (INIS)

    Zatsepin, Georgii T; Roganova, Tat'yana M


    The history of cosmic ray research at the Lebedev Institute beginning with the first work and continuing up to now is reviewed. The milestones and main avenues of research are outlined. Pioneering studies on the nuclear cascade process in extensive air showers, investigations of the Vavilov-Cherenkov radiation, and some work on the origin of cosmic rays are discussed. Recent data on ultrahigh-energy particle detection at the Pierre Auger Observatory and the High Resolution Fly's Eye (HiRes) experiments are presented. (conferences and symposia)

  14. X-ray astronomy

    International Nuclear Information System (INIS)

    Narayanan, M.S.


    The deployment of detectors outside the deleterious effects of the atmosphere by sending them in space vehicles, has been explained. This has thrown open the entire spectrum of the electromagnetic and particle radiation to direct observations, thus enlarging the vistas of the field of astronomy and astrophysics. The discovery of strong emitters of X-rays such as SCO X-1, NorX-2, transient sources such as Cen X-2, Cen X-4, Cen X-1, Supernova remnants Tan X-1, etc., are reported. The background of the X-ray spectrum as measured during two rocket flights over Thumba, India is presented. (K.B.)

  15. X-ray masks

    International Nuclear Information System (INIS)

    Greenwood, J.C.; Satchell, D.W.


    In semiconductor manufacture, where X-ray irradiation is used, a thin silicon membrane can be used as an X-ray mask. This membrane has areas on which are patterns to define the regions to be irradiated. These regions are of antireflection material. With the thin, in the order of 3 microns, membranes used, fragility is a problem. Hence a number of ribs of silicon are formed integral with the membrane, and which are relatively thick, 5 to 10 microns. The ribs may be formed by localised deeper boron deposition followed by a selective etch. (author)

  16. X-ray detector

    International Nuclear Information System (INIS)

    Houston, J.M.; Whetten, N.R.


    An ionization chamber for use in determining the spatial distribution of x-ray photons in tomography systems comprises a plurality of substantially parallel, planar anodes separated by parallel, planar cathodes and enclosed in a gas of high atomic weight at a pressure from approximately 10 atmospheres to approximately 50 atmospheres. The cathode and anode structures comprise metals which are substantially opaque to x-ray radiation and thereby tend to reduce the resolution limiting effects of xray fluoresence in the gas. In another embodiment of the invention the anodes comprise parallel conductive bars disposed between two planar cathodes. Guard rings eliminate surface leakage currents between adjacent electrodes

  17. Gamma-Ray Bursts (United States)

    Pellizza, L. J.

    Gamma-ray bursts are the brightest transient sources in the gamma-ray sky. Since their discovery in the late 1960s, the investigation of the astrophysical sys- tems in which these phenomena take place, and the physical mechanisms that drive them, has become a vast and prolific area of modern astrophysics. In this work I will briefly describe the most relevant observations of these sources, and the models that describe their nature, emphasizing on the in- vestigations about the progenitor astrophysical systems. FULL TEXT IN SPANISH

  18. Gamma Ray Bursts (United States)

    Gehrels, Neil; Meszaros, Peter


    Gamma-ray bursts (GRBs) are bright flashes of gamma-rays coming from the cosmos. They occur roughly once per day ,last typically lOs of seconds and are the most luminous events in the universe. More than three decades after their discovery, and after pioneering advances from space and ground experiments, they still remain mysterious. The launch of the Swift and Fermi satellites in 2004 and 2008 brought in a trove of qualitatively new data. In this review we survey the interplay between these recent observations and the theoretical models of the prompt GRB emission and the subsequent afterglows.

  19. Effect of ion beam irradiation on metal particle doped polymer ...

    Indian Academy of Sciences (India)

    and converts polymeric structure into hydrogen depleted carbon network. ... Composite materials; ion beam irradiation; dielectric properties; X-ray diffraction. ..... Coat. Technol. 201 8225. Raja V, Sharma A K and Narasimha V V R 2004 Mater.

  20. JCSC_128_8_1265_1275_SI.docx

    Indian Academy of Sciences (India)


    SUPPLEMENTARY INFORMATION. Synthesis, X-Ray crystal structure, DNA binding and nuclease activity of lanthanide (III) complexes of 2-benzoylpyridine acetyl hydrazone. KARREDDULA RAJA, AKKILI SUSEELAMMA and KATREDDI HUSSAIN REDDY*. Department of Chemistry, Sri Krishnadevaraya University, ...

  1. Gamma ray astronomy

    International Nuclear Information System (INIS)

    Broomhead, Laurent.


    The nuclear gamma astronomy is presented, in particular the Gamma Ray Observatory, an enormous eight tonnes machine fitted with gamma telescopes, scheduled for launching around 1985. It is thereby hoped to study the natural nuclear reactions which occur when stars explode [fr

  2. Chest X-Ray

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos ... x-ray is used to evaluate the lungs, heart and chest wall and may be used to ...

  3. X-ray sources

    International Nuclear Information System (INIS)

    Bonse, U.


    The author describes several possibilities for the production of X-radiation. Especially he discusses the use of bremsstrahlung at electron impact on solid targets and the synchrotron radiation. He presents some equations for the calculation of X-ray intensities. Especially the X-radiation from the DORIS storage ring is discussed. (HSI)

  4. Cosmic rays on earth

    International Nuclear Information System (INIS)

    Allkofer, O.C.; Grieder, P.K.F.


    A data collection is presented that covers cosmic rays on earth. Included are all relevant data on flux and intensity measurements, energy spectra, and related data of all primary and secondary components of the cosmic radiation at all levels in the atmosphere, at sea level and underground. In those cases where no useful experimental data have been available, theoretical predictions were substituted. (GSCH)

  5. Medical x-ray

    International Nuclear Information System (INIS)

    Abd Aziz Mhd Ramli; Gui Ah Auu; Husaini Salleh; Idris Besar; Mohd Ashhar Khalid; Muhammad Jamal Md Isa; Shaharuddin Mohd; Siti Najila Mohd Janib; Mohamed Ali Abdul Khader; Mahalatchimi Dave; Mohd Fazly Abdul Rahim; Ng Chee Moon; Ram Piari; Teoh Hoon Heng; Lee Peter


    This book describes the fundamental subject about medical radiography. It is a multidisciplinary field that requires cross professional input from scientists, engineers and medical doctors. However, it is presented in simple language to suit different levels of readers from x-ray operators and radiographers to physists, general practitioners and radiology specialists.The book is written in accordance to the requirements of the standard syllabus approved by the Ministry of Health Malaysia for the training of medical x-ray operator and general practitioners. In general, the content is not only designed to provide relevant and essential subject for related professionals in medical radiological services such as x-ray operator, radiographer and radiologists, but also to address those in associated radiological services including nurses, medical technologists and physicists.The book is organized and arranged sequentially into 3 parts for easy reference: Radiation safety; X-ray equipment and associated facilities; Radiography practices. With proper grasping of all these parts, the radiological services could be provided with confident and the highest professional standard. Thus, medical imaging with highest quality that can provide useful diagnostic information at minimum doses and at cost effective could be assured

  6. Cosmic rays and climate

    CERN Multimedia


    Inside the new chamber the CLOUD team will be able to recreate the conditions of any part of the atmosphere, from the polar stratosphere to the low level tropics (top). The new chamber safely in position in the East hall. Once carefully cleaned the chamber will be turned sideways onto its legs ready for the beam of 'cosmic rays' (bottom).

  7. Chest X-Ray

    Medline Plus

    Full Text Available ... change into a gown. You may have some concerns about chest x-rays. However, it’s important to ... You Sponsored by About Us | Contact Us | FAQ | Privacy | Terms of Use | Links | Site Map Copyright © 2018 ...

  8. Gamma ray calibration system

    International Nuclear Information System (INIS)

    Rosauer, P.J.; Flaherty, J.J.


    This invention is in the field of gamma ray inspection devices for tubular products and the like employing an improved calibrating block which prevents the sensing system from being overloaded when no tubular product is present, and also provides the operator with a means for visually detecting the presence of wall thicknesses which are less than a required minimum. (author)

  9. Cosmic ray riddle solved?

    International Nuclear Information System (INIS)



    Full text: Physicists from Japan and the United States have discovered a possible answer to the puzzle of the origin of high energy cosmic rays that bombard Earth from all directions in space. Using data from the Japanese/US X-ray astronomical satellite ASCA, physicists have found strong evidence for the production of cosmic particles in the shock wave of a supernova remnant, the expanding fireball produced by the explosion of a star. Primary cosmic rays, mostly electrons and protons, travel near the speed of light. Each second, approximately 4 such particles cross one square centimetre of space just outside the Earth's atmosphere. Subsequently, collisions of these primary particles with atoms in the upper atmosphere produce slower secondary particles. Ever since the discovery of cosmic rays early this century, scientists have debated the origin of these particles and how they can be accelerated to such high speeds. Supernova remnants have long been thought to provide the high energy component, but the evidence has been lacking until now. The international team of investigators used the satellite to determine that cosmic rays are generated profusely in the remains of the supernova of 1006 AD - which appeared to medieval viewers to be as bright as the Moon - and that they are accelerated to high velocities by an iterative process first suggested by Enrico Fermi in 1949. Using solid-state X-ray cameras, the ASCA satellite records simultaneous images and spectra of X-rays from celestial sources, allowing astronomers to distinguish different types of X-ray emission. The tell-tale clue to the discovery was the detection of two diametrically opposite regions in the rapidly expanding supernova remnant, the debris from the stellar explosion. The two regions glow intensely from the synchrotron radiation produced when fast-moving electrons are bent by a magnetic field. The remainder of the supernova remnant, in contrast, emits ordinary ''thermal'' X-rays

  10. X ray Production. Chapter 5

    Energy Technology Data Exchange (ETDEWEB)

    Nowotny, R. [Medical University of Vienna, Vienna (Austria)


    The differential absorption of X rays in tissues and organs, owing to their atomic composition, is the basis for the various imaging methods used in diagnostic radiology. The principles in the production of X rays have remained the same since their discovery. However, much refinement has gone into the design of X ray tubes to achieve the performance required for today’s radiological examinations. In this chapter, an outline of the principles of X ray production and a characterization of the radiation output of X ray tubes will be given. The basic processes producing X rays are dealt with in Section 1.4.

  11. X-ray filter for x-ray powder diffraction (United States)

    Sinsheimer, John Jay; Conley, Raymond P.; Bouet, Nathalie C. D.; Dooryhee, Eric; Ghose, Sanjit


    Technologies are described for apparatus, methods and systems effective for filtering. The filters may comprise a first plate. The first plate may include an x-ray absorbing material and walls defining first slits. The first slits may include arc shaped openings through the first plate. The walls of the first plate may be configured to absorb at least some of first x-rays when the first x-rays are incident on the x-ray absorbing material, and to output second x-rays. The filters may comprise a second plate spaced from the first plate. The second plate may include the x-ray absorbing material and walls defining second slits. The second slits may include arc shaped openings through the second plate. The walls of the second plate may be configured to absorb at least some of second x-rays and to output third x-rays.

  12. Gamma-ray astronomy and cosmic-ray origin theory

    International Nuclear Information System (INIS)

    Ginzburg, V.L.


    A theory of the origin of cosmic radiation is discussed in light of the advances made in gamma-ray astronomy. Arguments against metagalactic models for the origin of cosmic rays are emphasized. (U.S.)

  13. Irradiated ISM : Discriminating between cosmic rays and X-rays

    NARCIS (Netherlands)

    Meijerink, R.; Spaans, M.; Israel, F. P.


    The interstellar medium ( ISM) at the centers of active galaxies is exposed to a combination of cosmic-ray, far-ultraviolet (FUV), and X-ray radiation. We apply photodissociation region (PDR) models to this ISM with both "normal" and highly elevated (5 x 10(-15) s(-1)) cosmic- ray (CR) rates and

  14. Resonance γ-ray polarimetry

    International Nuclear Information System (INIS)

    Gonser, U.; Fischer, H.


    The topics are: Intensity and polarization of radiation in Moessbauer transitions, hyperfine interactions in 57 Fe, polarized γ-rays, polarimetry, γ-ray rotation polarimeters, Birefringence polarimetry. (WL)

  15. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... the body. X-rays are the oldest and most frequently used form of medical imaging. A bone ... bones. top of page How should I prepare? Most bone x-rays require no special preparation. You ...

  16. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... evaluation. National and international radiology protection organizations continually review and update the technique standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose ...

  17. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... can be taken to the patient in a hospital bed or the emergency room. The x-ray ... position possible that still ensures x-ray image quality. top of page Who interprets the results and ...

  18. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... position possible that still ensures x-ray image quality. top of page Who interprets the results and ...

  19. X-ray detector array

    International Nuclear Information System (INIS)

    Houston, J.M.


    The object of the invention (an ionization chamber X-ray detector array for use with high speed computerised tomographic imaging apparatus) is to reduce the time required to produce a tomographic image. The detector array described determines the distribution of X-ray intensities in one or more flat, coplanar X-ray beams. It comprises three flat anode sheets parallel to the X-ray beam, a plurality of rod-like cathodes between the anodes, a detector gas between the electrodes and a means for applying a potential between the electrodes. Each of the X-ray sources is collimated to give a narrow, planar section of X-ray photons. Sets of X-ray sources in the array are pulsed simultaneously to obtain X-ray transmission data for tomographic image reconstruction. (U.K.)

  20. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... tissue shows up in shades of gray and air appears black. Until recently, x-ray images were ... position possible that still ensures x-ray image quality. top of page Who interprets the results and ...

  1. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... changes seen in metabolic conditions. assist in the detection and diagnosis of bone cancer . locate foreign objects ... standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose ...

  2. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose control methods to minimize stray (scatter) radiation. This ensures that ...

  3. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... up in shades of gray and air appears black. Until recently, x-ray images were maintained on ... Safety page for more information about radiation dose. Women should always inform their physician or x-ray ...

  4. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... wrist, arm, elbow, shoulder, spine, pelvis, hip, thigh, knee, leg (shin), ankle or foot. top of page ... the patient standing upright, as in cases of knee x-rays. A portable x-ray machine is ...

  5. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... have very controlled x-ray beams and dose control methods to minimize stray (scatter) radiation. This ensures ...

  6. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... conditions. Imaging with x-rays involves exposing a part of the body to a small dose of ... body. Once it is carefully aimed at the part of the body being examined, an x-ray ...

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... ray examination. X-rays usually have no side effects in the typical diagnostic range for this exam. ... minimize stray (scatter) radiation. This ensures that those parts of a patient's body not being imaged receive ...

  8. X-ray refractometer

    International Nuclear Information System (INIS)

    Tur'yanskij, A.G.; Pirshin, I.V.


    Paper introduces a new circuit of X-ray refractometer to study angular and spectral features of refracted radiation within hard X-ray range. Refractometer incorporates two goniometers, two crystal-analyzers and three radiation detectors. The maximum distance between radiation source focal point and a receiving slit of the second goniometer is equal to 1.4 m. For the first time one obtained refraction patterns of fine-film specimens including C/Si stressed structure. Paper describes a new technique of refractometry via specimen oscillation at fixed position of a detecting device. Paper presents the measurement results of oscillation refraction patterns for specimens of melted quartz and ZnSe single crystal [ru

  9. X-ray radiotherapy

    International Nuclear Information System (INIS)

    Tronc, D.


    Full text: The most common form of radio therapy is X-ray therapy, where a beam of photons or their parent electrons break down hydrogen bonds within the body's cells and remove certain DNA information necessary for cell multiplication. This process can eradicate malignant cells leading to complete recovery, to the remission of some cancers, or at least to a degree of pain relief. The radiotherapy instrument is usually an electron linac, and the electrons are used either directly in 'electrotherapy' for some 10% of patients, or the electrons bombard a conversion target creating a broad beam of high energy photons or 'penetration X-rays'. The simplest machine consists of several accelerating sections at around 3 GHz, accelerating electrons to 6 MeV; a cooled tungsten target is used to produce a 4 Gray/min X-ray field which can be collimated into a rectangular shape at the patient position. This tiny linac is mounted inside a rotating isocentric gantry above the patient who must remain perfectly still. Several convergent beams can also be used to increase the delivered dose. More sophisticated accelerators operate at up to 18 MeV to increase penetration depths and decrease skin exposure. Alternatively, electrotherapy can be used with different energies for lower and variable penetration depths - approximately 0.5 cm per MeV. In this way surface tissue may be treated without affecting deeper and more critical anatomical regions. This type of linac, 1 to 2 metres long, is mounted parallel to the patient with a bending magnet to direct the beam to the radiotherapy system, which includes the target, thick movable collimator jaws, a beam field equalizer, dose rate and optical field simulation and energy controls. There are over 2000 acceleratorbased X-ray treatment units worldwide. Western countries have up to two units per million population, whereas in developing countries such as Bangladesh, the density is only one per 100 million. Several

  10. X-ray generator

    Energy Technology Data Exchange (ETDEWEB)

    Zucarias, A; Shepherd, J W


    An X-ray tube has a tubular envelope with a cathode for directing an electron beam onto a focal spot area of a spaced anode target to generate X-rays. The target is mounted for axial rotation on one end of a rotor disposed in an end portion of the envelope and encircled by a stator of an alternating current induction motor. An annular shield of high permeability magnetic material extends transversely between the electron beam and the stator of the induction motor for shunting stray or fringe electromagnetic fields established by the stator away from the electron beam to avoid consequent lateral deflections of the electron and corresponding lateral movements of the focal spot area.

  11. Gamma-ray bursts

    CERN Document Server

    Wijers, Ralph A M J; Woosley, Stan


    Cosmic gamma ray bursts (GRBs) have fascinated scientists and the public alike since their discovery in the late 1960s. Their story is told here by some of the scientists who participated in their discovery and, after many decades of false starts, solved the problem of their origin. Fourteen chapters by active researchers in the field present a detailed history of the discovery, a comprehensive theoretical description of GRB central engine and emission models, a discussion of GRB host galaxies and a guide to how GRBs can be used as cosmological tools. Observations are grouped into three sets from the satellites CGRO, BeppoSAX and Swift, and followed by a discussion of multi-wavelength observations. This is the first edited volume on GRB astrophysics that presents a fully comprehensive review of the subject. Utilizing the latest research, Gamma-ray Bursts is an essential desktop companion for graduate students and researchers in astrophysics.

  12. Gamma ray camera

    International Nuclear Information System (INIS)

    Wang, S.-H.; Robbins, C.D.


    An Anger gamma ray camera is improved by the substitution of a gamma ray sensitive, proximity type image intensifier tube for the scintillator screen in the Anger camera. The image intensifier tube has a negatively charged flat scintillator screen, a flat photocathode layer, and a grounded, flat output phosphor display screen, all of which have the same dimension to maintain unit image magnification; all components are contained within a grounded metallic tube, with a metallic, inwardly curved input window between the scintillator screen and a collimator. The display screen can be viewed by an array of photomultipliers or solid state detectors. There are two photocathodes and two phosphor screens to give a two stage intensification, the two stages being optically coupled by a light guide. (author)

  13. Cosmic rays and climate

    CERN Multimedia

    CERN. Geneva


    The current understanding of climate change in the industrial age is that it is predominantly caused by anthropogenic greenhouse gases, with relatively small natural contributions due to solar irradiance and volcanoes. However, palaeoclimatic reconstructions show that the climate has frequently varied on 100-year time scales during the Holocene (last 10 kyr) by amounts comparable to the present warming - and yet the mechanism or mechanisms are not understood. Some of these reconstructions show clear associations with solar variability, which is recorded in the light radio-isotope archives that measure past variations of cosmic ray intensity. However, despite the increasing evidence of its importance, solar-climate variability is likely to remain controversial until a physical mechanism is established. Estimated changes of solar irradiance on these time scales appear to be too small to account for the climate observations. This raises the question of whether cosmic rays may directly affect the climate, provi...

  14. X-ray microtomography

    International Nuclear Information System (INIS)

    Dunsmuir, J.H.; Ferguson, S.R.; D'Amico, K.L.; Stokes, J.P.


    In this paper the authors describe the application of a new high-resolution X-ray tomographic microscope to the study of porous media. The microscope was designed to exploit the properties of a synchrotron X-ray source to perform three dimensional tomography on millimeter sized objects with micron resolution and has been used in materials science studies with both synchrotron and conventional and synchrotron sources will be compared. In this work the authors have applied the microscope to measure the three dimensional structure of fused bead packs and berea sandstones with micron resolution and have performed preliminary studies of flow in these media with the microscope operated in a digital subtraction radiography mode. Computer graphics techniques have been applied to the data to visually display the structure of the pore body system. Tomographic imaging after flow experiments should detect the structure of the oil-water interface in the pore network and this work is ongoing

  15. Cathode ray tube screens

    International Nuclear Information System (INIS)

    Cockayne, B.; Robbins, D.J.; Glasper, J.L.


    An improved cathode ray tube screen is described which consists of a single- or a poly-crystalline slice of a material such as yttrium aluminium garnet in which dopants such as Tb 3 + , Eu 3 + , Ce 3 + or Tm 3 + are ion implanted to different depths or in different areas of the screen. Annealing the screen removes lattice damage caused by the ion implanting and assists the diffusion of the dopant into the crystal. (U.K.)

  16. Cathode ray tube

    International Nuclear Information System (INIS)


    A cathode ray tube comprises two electron lens means in combination to crossover the electron beam at a second crossover between the two electron lens means with one of the two lens means having a variable voltage applied thereto to control the location of the beam crossover in order to focus the beam onto a display screen at any location away from the screen center. (Auth.)

  17. X-ray diffraction

    International Nuclear Information System (INIS)

    Einstein, J.R.; Wei, C.H.


    We have been interested in structural elucidation by x-ray diffraction of compounds of biological interest. Understanding exactly how atoms are arranged in three-dimensional arrays as molecules can help explain the relationship between structure and functions. The species investigated may vary in size and shape; our recent studies included such diverse substances as antischistosomal drugs, a complex of cadmium with nucleic acid base, nitrate salts of adenine, and proteins

  18. X-ray apparatus

    International Nuclear Information System (INIS)

    Tomita, Chuji.


    A principal object of the present invention is to provide an X-ray apparatus which is such that the distance between the surface of the patient's table and the floor on which the apparatus is installed is sufficiently small in the horizontal position of the patient's table of the roentgenographical pedestal and that the rotation of the pedestal from the horizontal position to a tilted position and further to the vertical position of the table can be carried out smoothly. (auth)

  19. Cosmic Rays in Thunderstorms (United States)

    Buitink, Stijn; Scholten, Olaf; van den Berg, Ad; Ebert, Ute


    Cosmic Rays in Thunderstorms Cosmic rays are protons and heavier nuclei that constantly bombard the Earth's atmosphere with energies spanning a vast range from 109 to 1021 eV. At typical altitudes up to 10-20 km they initiate large particle cascades, called extensive air showers, that contain millions to billions of secondary particles depending on their initial energy. These particles include electrons, positrons, hadrons and muons, and are concentrated in a compact particle front that propagates at relativistic speed. In addition, the shower leaves behind a trail of lower energy electrons from ionization of air molecules. Under thunderstorm conditions these electrons contribute to the electrical and ionization processes in the cloud. When the local electric field is strong enough the secondary electrons can create relativistic electron run-away avalanches [1] or even non-relativistic avalanches. Cosmic rays could even trigger lightning inception. Conversely, strong electric fields also influence the development of the air shower [2]. Extensive air showers emit a short (tens of nanoseconds) radio pulse due to deflection of the shower particles in the Earth's magnetic field [3]. Antenna arrays, such as AERA, LOFAR and LOPES detect these pulses in a frequency window of roughly 10-100 MHz. These systems are also sensitive to the radiation from discharges associated to thunderstorms, and provide a means to study the interaction of cosmic ray air showers and the electrical processes in thunderstorms [4]. In this presentation we discuss the involved radiation mechanisms and present analyses of thunderstorm data from air shower arrays [1] A. Gurevich et al., Phys. Lett. A 165, 463 (1992) [2] S. Buitink et al., Astropart. Phys. 33, 1 (2010) [3] H. Falcke et al., Nature 435, 313 (2005) [4] S. Buitink et al., Astron. & Astrophys. 467, 385 (2007)

  20. Cosmic ray modulation (United States)

    Agarwal Mishra, Rekha; Mishra, Rajesh Kumar


    Propagation of cosmic rays to and inside the heliosphere, encounter an outward moving solar wind with cyclic magnetic field fluctuation and turbulence, causing convection and diffusion in the heliosphere. Cosmic ray counts from the ground ground-based neutron monitors at different cut of rigidity show intensity changes, which are anti-correlated with sunspot numbers. They also lose energy as they propagate towards the Earth and experience various types of modulations due to different solar activity indices. In this work, we study the first three harmonics of cosmic ray intensity on geo-magnetically quiet days over the period 1965-2014 for Beijing, Moscow and Tokyo neutron monitoring stations located at different cut off rigidity. The amplitude of first harmonic remains high for low cutoff rigidity as compared to high cutoff rigidity on quiet days. The diurnal amplitude significantly decreases during solar activity minimum years. The diurnal time of maximum significantly shifts to an earlier time as compared to the corotational direction having different cutoff rigidities. The time of maximum for first harmonic significantly shifts towards later hours and for second harmonic it shifts towards earlier hours at low cutoff rigidity station as compared to the high cut off rigidity station on quiet days. The amplitude of second/third harmonics shows a good positive correlation with solar wind velocity, while the others (i.e. amplitude and phase) have no significant correlation on quiet days. The amplitude and direction of the anisotropy on quiet days does not show any significant dependence on high-speed solar wind streams for these neutron monitoring stations of different cutoff rigidity threshold. Keywords: cosmic ray, cut off rigidity, quiet days, harmonics, amplitude, phase.

  1. X-ray Ordinance

    International Nuclear Information System (INIS)

    Kramer, R.; Zerlett, G.


    This commentary, presented as volume 2 of the Deutsches Strahlenschutzrecht (German legislation on radiation protection) deals with the legal provisions of the ordinance on the protection against harmful effects of X-radiation (X-ray Ordinance - RoeV), of March 1, 1973 (announced in BGBl.I, page 173), as amended by the ordinance on the protection against harmful effects of ionizing radiation, of October 13, 1976 (announced in BGBl. I, page 2905). Thus volume 2 completes the task started with volume 1, namely to present a comprehensive view and account of the body of laws governing radiation protection, a task which was thought useful as developments in the FRG led to regulations being split up into the X-ray Ordinance, and the Radiation Protection Ordinance. In order to present a well-balanced commentary on the X-ray Ordinance, it was necessary to discuss the provisions both from the legal and the medical point of view. This edition takes into account the Fourth Public Notice of the BMA (Fed. Min. of Labour and Social Affairs) concerning the implementation of the X-ray Ordinance of January 4, 1982, as well as court decisions and literature published in this field, until September 1982. In addition, the judgment of the Federal Constitutional Court, dated October 19, 1982, concerning the voidness of the law on government liability, and two decisions by the Federal High Court, dated November 23, 1982, concerning the right to have insight into medical reports - of great significance in practice - have been considered. This commentary therefore is up to date with current developments. (orig.) [de

  2. Cosmic ray: Studying the origin

    International Nuclear Information System (INIS)

    Szabelski, J.


    Investigations of the origin of cosmic rays are presented. Different methods are discussed: studies of cosmic gamma rays of energy from 30 MeV to about 10 15 eV (since photons point to their places of origin), studies of the mass composition of cosmic rays (because it reflects source morphology), and studies of cosmic rays with energy above 1O 19 eV (for these are the highest energies observed in nature). (author)

  3. Producing x-rays

    International Nuclear Information System (INIS)

    Mallozzi, P.J.; Epstein, H.M.; Jung, R.G.; Applebaum, D.C.; Fairand, B.P.; Gallagher, W.J.


    A method of producing x-rays by directing radiant energy from a laser onto a target is described. Conversion efficiency of at least about 3 percent is obtained by providing the radiant energy in a low-power precursor pulse of approximately uniform effective intensity focused onto the surface of the target for about 1 to 30 nanoseconds so as to generate an expanding unconfined coronal plasma having less than normal solid density throughout and comprising a low-density (underdense) region wherein the plasma frequency is less than the laser radiation frequency and a higher-density (overdense) region wherein the plasma frequency is greater than the laser radiation frequency and, about 1 to 30 nanoseconds after the precursor pulse strikes the target, a higher-power main pulse focused onto the plasma for about 10 -3 to 30 nanoseconds and having such power density and total energy that the radiant energy is absorbed in the underdense region and conducted into the overdense region to heat it and thus to produce x-rays therefrom with the plasma remaining substantially below normal solid density and thus facilitating the substantial emission of x-rays in the form of spectral lines arising from nonequilibrium ionization states

  4. Radiation ray measuring device

    International Nuclear Information System (INIS)

    Maekawa, Tatsuyuki; Ida, Masaki.


    The present invention provides a chained-radiation ray monitoring system which can be applied to an actual monitoring system of a nuclear power plant or the like. Namely, this device comprises a plurality of scintillation detectors. Each of the detectors has two light take-out ports for emitting light corresponding to radiation rays irradiated from the object of the measurement to optical fibers. In addition, incident light from the optical fiber by way of one of the light take-out optical ports is transmitted to the other of the ports and sent from the other optical port to the fibers. Plurality sets of measuring systems are provided in which each of the detectors are disposed corresponding to a plurality of objects to be measured. A signal processing device is (1) connected with optical fibers of plurality sets of measuring systems in conjunction, (2) detects the optical pulses inputted from the optical fibers to identify the detector from which the optical pulses are sent and (3) measures the amount of radiation rays detected by the identified detector. As a result, the device of the present invention can form a measuring system with redundancy. (I.S.)

  5. X-Ray Exam: Hip (United States)

    ... for Educators Search English Español X-Ray Exam: Hip KidsHealth / For Parents / X-Ray Exam: Hip What's in this article? What It Is Why ... You Have Questions Print What It Is A hip X-ray is a safe and painless test ...

  6. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... X-rays are a form of radiation like light or radio waves. X-rays pass through most objects, including the body. Once it is carefully aimed at the part of the body being examined, an x-ray machine produces a small ...

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... x-rays. top of page What does the equipment look like? The equipment typically used for bone x-rays consists of ... and joint abnormalities, such as arthritis. X-ray equipment is relatively inexpensive and widely available in emergency ...

  8. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... The x-ray tube is connected to a flexible arm that is extended over the patient while an x-ray film holder or image recording plate is placed beneath the patient. top of page How does the procedure work? X-rays are a form of radiation like ...

  9. X-Ray Exam: Ankle (United States)

    ... for Educators Search English Español X-Ray Exam: Ankle KidsHealth / For Parents / X-Ray Exam: Ankle What's in this article? What It Is Why ... You Have Questions Print What It Is An ankle X-ray is a safe and painless test ...

  10. Equipment for x- and gamma ray radiography

    International Nuclear Information System (INIS)

    Abd Nasir Ibrahim; Azali Muhammad; Ab Razak Hamzah; Abd Aziz Mohamed; Mohammad Pauzi Ismail


    The following topics related to the equipment for x - and gamma ray radiography are discussed in this chapter. The topics are x-ray source for Industrial Radiography: properties of x-ray, generation of x-ray, mechanism of x-ray production, x-ray equipment, power supply, distribution of x-ray intensity along the tube: gamma ray source for Industrial Radiography: properties of gamma rays, gamma ray sources, gamma ray projectors on cameras, source changing. Care of Radiographic Equipments: Merits and Demerits of x and Gamma Rays

  11. Soft x-ray lasers

    International Nuclear Information System (INIS)

    Matthews, D.L.; Rosen, M.D.


    One of the elusive dreams of laser physicists has been the development of an x-ray laser. After 25 years of waiting, the x-ray laser has at last entered the scientific scene, although those now in operation are still laboratory prototypes. They produce soft x rays down to about five nanometers. X-ray lasers retain the usual characteristics of their optical counterparts: a very tight beam, spatial and temporal coherence, and extreme brightness. Present x-ray lasers are nearly 100 times brighter that the next most powerful x-ray source in the world: the electron synchrotron. Although Lawrence Livermore National Laboratory (LLNL) is widely known for its hard-x-ray laser program which has potential applications in the Strategic Defense Initiative, the soft x-ray lasers have no direct military applications. These lasers, and the scientific tools that result from their development, may one day have a place in the design and diagnosis of both laser fusion and hard x-ray lasers. The soft x-ray lasers now in operation at the LLNL have shown great promise but are still in the primitive state. Once x-ray lasers become reliable, efficient, and economical, they will have several important applications. Chief among them might be the creation of holograms of microscopic biological structures too small to be investigated with visible light. 5 figs

  12. Lunar based gamma ray astronomy

    International Nuclear Information System (INIS)

    Haymes, R.C.


    Gamma ray astronomy represents the study of the universe on the basis of the electromagnetic radiation with the highest energy. Gamma ray astronomy provides a crucial tool for the understanding of astronomical phenomena, taking into account nucleosynthesis in supernovae, black holes, active galaxies, quasars, the sources of cosmic rays, neutron stars, and matter-antimatter annihilation. Difficulties concerning the conduction of studies by gamma ray astronomy are related to the necessity to perform such studies far from earth because the atmosphere is a source of gamma rays. Studies involving the use of gamma ray instruments in earth orbit have been conducted, and more gamma ray astronomy observations are planned for the future. Imperfections of studies conducted in low earth orbit could be overcome by estalishing an observatory on the moon which represents a satellite orbiting at 60 earth radii. Details concerning such an observatory are discussed. 5 references

  13. Gamma ray astronomy and the origin of galactic cosmic rays

    International Nuclear Information System (INIS)

    Gabici, Stefano


    Diffusive shock acceleration operating at expanding supernova remnant shells is by far the most popular model for the origin of galactic cosmic rays. Despite the general consensus received by the model, an unambiguous and conclusive proof of the supernova remnant hypothesis is still missing. In this context, the recent developments in gamma ray astronomy provide us with precious insights into the problem of the origin of galactic cosmic rays, since production of gamma rays is expected both during the acceleration of cosmic rays at supernova remnant shocks and during their subsequent propagation in the interstellar medium. In particular, the recent detection of a number of supernova remnants at TeV energies nicely fits with the model, but it still does not constitute a conclusive proof of it, mainly due to the difficulty of disentangling the hadronic and leptonic contributions to the observed gamma ray emission. The main goal of my research is to search for an unambiguous and conclusive observational test for proving (or disproving) the idea that supernova remnants are the sources of galactic cosmic rays with energies up to (at least) the cosmic ray knee. Our present comprehension of the mechanisms of particle acceleration at shocks and of the propagation of cosmic rays in turbulent magnetic fields encourages beliefs that such a conclusive test might come from future observations of supernova remnants and of the Galaxy in the almost unexplored domain of multi-TeV gamma rays. (author)

  14. Studies in cosmic rays

    International Nuclear Information System (INIS)

    Bemalkhedkar, M.M.


    The investigation of the diurnal variation in the cosmic ray intensity on individual days has revealed a new class of diurnal variation showing a maximum around 09 hour direction in the interplanetary space. It is shown to occur during the recovery phase of Forbush decreases as well as during quiet periods. The rigidity spectrum of the anomalous diurnal variation has an exponent around zero, the same as that for the average diurnal variation exhibiting maximum around 18 hours in the interplanetary space. It is shown that the Forbush decreases associated with the diurnal variation exhibiting morning maximum, are 27 day recurrent in nature and are preceded by east limb solar flares on most of the occasions. A qualitative model of the transient modulation by solar corotating corpuscular streams of enhanced solar wind velocity, emanating from the active regions on the solar disc, is proposed to explain the anomalous diurnal anisotropy in the recovery phase of 27 day recurrent Forbush decreases. From this model, the cosmic ray diffusion coefficients, parallel and perpendicular to the interplanetary magnetic field inside the corotating stream, are derived and compared with the average values. To investigate the possibility of determining the energy spectra of cosmic ray intensity variations from a single station, a continuous record of neutron multiplicity spectrum has been obtained for the period October, 1967 - October, 1971, using the Gulmarg neutron monitor. The average multiplicity spectrum in the Gulmarg neutron monitor shows a mean multiplicity approximately equal to 1.4 for 12 Boron-tri-fluoride counters and is an increasing function of the number of counters used. The mean multiplicity measured in various other neutron monitors, when normalized to the cutoff rigidity of Gulmurg (11.91 GV), shows a systematic increase with the altitude of the station. (author)

  15. SMM x ray polychromator (United States)

    Saba, J. L. R.


    The objective of the X-ray Polychromator (XRP) experiment was to study the physical properties of solar flare plasma and its relation to the parent active region to understand better the flare mechanism and related solar activity. Observations were made to determine the temperature, density, and dynamic structure of the pre-flare and flare plasma as a function of wavelength, space and time, the extent to which the flare plasma departs from thermal equilibrium, and the variation of this departure with time. The experiment also determines the temperature and density structure of active regions and flare-induced changes in the regions.

  16. Obstetric X-rays

    International Nuclear Information System (INIS)

    Mwachi, M.K.


    Radiography of the pelvis should never be taken to diagnose early pregnancy, because of potential hazards of radiation damage to the growing foetus. the only indication occurs in the last week of pregnancy (37 weeks). Obstetric X-ray will help you answer like confirmation of malposition,multiple pregnancies; fetal abnormalities e.g. hydrocephalus, foetal disposition. The choice of radiographic projection will help give foetal presentation, disposition as well as foetal maturity. The search pattern helps you determine maternal and spine deformity, foetal spine and head , foetal presentation and any other anomalies

  17. X-ray film

    International Nuclear Information System (INIS)

    Arndt, U.W.; Gilmore, D.J.; Wonacott, A.J.


    The performance of film as an X-ray detector is discussed and its behaviour is compared with that of a perfect Poissonian detector. The efficiency of microdensitometry as a method of extracting the information recorded on the film is discussed. More emphasis is placed in the precision of microdensitometric measurements than on the more obvious characteristic of film speed. The effects of chemical fog and background on the precision of the measurements is considered and it is concluded that the final limit to precision is set by the chemical fog. (B.D.)

  18. X-ray diffraction

    International Nuclear Information System (INIS)

    Vries, J.L. de.


    The seventh edition of Philips' Review of literature on X-ray diffraction begins with a list of conference proceedings on the subject, organised by the Philips' organisation at regular intervals in various European countries. This is followed by a list of bulletins. The bibliography is divided according to the equipment (cameras, diffractometers, monochromators) and its applications. The applications are subdivided into sections for high/low temperature and pressure, effects due to the equipment, small angle scattering and a part for stress, texture and phase analyses of metals and quantitative analysis of minerals

  19. X-ray instrumentation in astronomy

    International Nuclear Information System (INIS)

    Cuhlane, J.L.


    This book presents the proceedings of a conference devoted to x-ray instrumentation in astronomy. Special sections are: AXAF X-Ray Optical Systems; Specialized X-Ray Systems; X-Ray Optical Systems I; X-Ray Optical Systems II; Gas Filled X-Ray Detectors II; The NASA Advanced X-Ray Astrophysics Facility; X-Ray and EUV Spectrometers; Microchannel Plates; and Solid State Detectors

  20. X-ray spectrometry

    International Nuclear Information System (INIS)

    Markowicz, A.A.; Van Grieken, R.E.


    In the period under review, i.e, through 1984 and 1985, some 600 articles on XRS (X-ray spectrometry) were published; most of these have been scanned and the most fundamental ones are discussed. All references will refer to English-language articles, unless states otherwise. Also general books have appeared on quantitative EPXMA (electron-probe X-ray microanalysis) and analytical electron microscopy (AEM) as well as an extensive review on the application of XRS to trace analysis of environmental samples. In the period under review no radically new developments have been seen in XRS. However, significant improvements have been made. Gain in intensities has been achieved by more efficient excitation, higher reflectivity of dispersing media, and better geometry. Better understanding of the physical process of photon- and electron-specimen interactions led to complex but more accurate equations for correction of various interelement effects. Extensive use of micro- and minicomputers now enables fully automatic operation, including qualitative analysis. However, sample preparation and presentation still put a limit to further progress. Although some authors find XRS in the phase of stabilization or even stagnation, further gradual developments are expected, particularly toward more dedicated equipment, advanced automation, and image analysis systems. Ways are outlined in which XRS has been improved in the 2 last years by excitation, detection, instrumental, methodological, and theoretical advances. 340 references

  1. Gamma ray beam transmutation

    International Nuclear Information System (INIS)

    Imasaki, K.; Li, D.; Miyamoto, S.; Amano, S.; Motizuki, T.


    We have proposed a new approach to nuclear transmutation by a gamma ray beam of Compton scattered laser photon. We obtained 20 MeV gamma ray in this way to obtain transmutation rates with the giant resonance of 1 97Au and 1 29Iodine. The rate of the transmutation agreed with the theoretical calculation. Experiments on energy spectrum of positron, electron and neutron from targets were performed for the energy balance and design of the system scheme. The reaction rate was about 1.5∼4% for appropriate photon energies and neutron production rate was up to 4% in the measurements. We had stored laser photon more than 5000 times in a small cavity which implied for a significant improvement of system efficiency. Using these technologies, we have designed an actual transmutation system for 1 29Iodine which has a 16 million year's activity. In my presentation, I will address the properties of this scheme, experiments results and transmutation system for iodine transmutation

  2. X-ray echoes from gamma-ray bursts

    International Nuclear Information System (INIS)

    Dermer, C.D.; Hurley, K.C.; Hartmann, D.H.


    The identification of an echo of reflected radiation in time histories of gamma-ray burst spectra can provide important information about the existence of binary companions or accretion disks in gamma-ray burst systems. Because of the nature of Compton scattering, the spectrum of the echo will be attenuated at gamma-ray energies compared with the spectrum of the primary burst emission. The expected temporal and spectral signatures of the echo and a search for such echoes are described, and implications for gamma-ray burst models are discussed. 35 refs

  3. X-Ray Lasers 2016

    CERN Document Server

    Bulanov, Sergei; Daido, Hiroyuki; Kato, Yoshiaki


    These proceedings comprise a selection of invited and contributed papers presented at the 15th International Conference on X-Ray Lasers (ICXRL 2016), held at the Nara Kasugano International Forum, Japan, from May 22 to 27, 2016. This conference was part of an ongoing series dedicated to recent developments in the science and technology of x-ray lasers and other coherent x-ray sources with additional focus on supporting technologies, instrumentation and applications.   The book showcases recent advances in the generation of intense, coherent x-rays, the development of practical devices and their applications across a wide variety of fields. It also discusses emerging topics such as plasma-based x-ray lasers, 4th generation accelerator-based sources and higher harmonic generations, as well as other x-ray generation schemes.

  4. Quantum electrodynamics and light rays

    International Nuclear Information System (INIS)

    Sudarshan, E.C.G.


    Light is a quantum electrodynamic entity and hence bundles of rays must be describable in this framework. The duality in the description of elementary optical phenomena is demonstrated in terms of two-point correlation functions and in terms of collections of light rays. The generalizations necessary to deal with two-slit interference and diffraction by a rectangular slit are worked out and the usefulness of the notion of rays of darkness illustrated. 10 references

  5. Topological X-Rays Revisited (United States)

    Lynch, Mark


    We continue our study of topological X-rays begun in Lynch ["Topological X-rays and MRI's," iJMEST 33(3) (2002), pp. 389-392]. We modify our definition of a topological magnetic resonance imaging and give an affirmative answer to the question posed there: Can we identify a closed set in a box by defining X-rays to probe the interior and without…

  6. Complex ray analysis for plasmas

    International Nuclear Information System (INIS)

    Connor, K.A.


    An extension of ray tracing techniques is considered for a variety of cases in which the dispersion relation of the plasma medium is complex. The ray trajectories are permitted to begin and/or at least travel through complex space-time; the wave propagation process so characterized becomes significant only where the rays intersect real space-time. It is found that rules and guidelines can be established for limited application of this idea

  7. Gamma Ray Bursts - Observations (United States)

    Gehrels, N.; Cannizzo, J. K.


    We are in an exciting period of discovery for gamma-ray bursts. The Swift observatory is detecting 100 bursts per year, providing arcsecond localizations and sensitive observations of the prompt and afterglow emission. The Fermi observatory is observing 250 bursts per year with its medium-energy GRB instrument and about 10 bursts per year with its high-energy LAT instrument. In addition, rapid-response telescopes on the ground are providing new capabilities to study optical emission during the prompt phase and spectral signatures of the host galaxies. The combined data set is enabling great advances in our understanding of GRBs including afterglow physics, short burst origin, and high energy emission.

  8. X-ray table

    International Nuclear Information System (INIS)

    Craig, J.R.; Otto, G.W.


    An X-ray radiographic or fluoroscopic table is described which includes a film holder with a frame attached to a cable running over end pulleys for positioning the holder longitudinally as desired under the table top. The holder has a front opening to receive a cassette-supporting tray which can be slid out on tracks to change the cassette. A reed switch on the frame is opened by a permanent magnet on the tray only when the tray is half-way out. When the switch is closed, an electromagnet locks the pulley and the holder in place. The holder is thus automatically locked in place not only during exposure (tray in) but when the tray is out for changing the cassette. To re-position the holder, the operator pulls the tray half-out and, using the tray itself, pushes the holder along the table, the holder being counterbalanced by a weight. (author)

  9. Cosmic ray synergies

    CERN Multimedia

    Laëtitia Pedroso


    In laboratories, cosmic rays have been the subject of scientific research for many years. A more recent development is their appearance in schools, as educational tools. A recent workshop at CERN, organised by ASPERA in collaboration with EPPOG and EPPCN, had the goal of bringing together ideas and initiatives with a view to setting up a future common project.   Presentation at the workshop on 15 October. In research, as in education, you can sometimes get things done more rapidly and easily by joining forces. For roughly the past decade, physicists have been taking their particle detectors to secondary schools. “The challenge now is to bring all of these existing projects together in a network,” says Arnaud Marsollier, in charge of communication for the ASPERA network and organiser of the workshop. The workshop held on Friday, 15 October was attended by representatives of major European educational projects and members of the European Particle Physics Communication Network...

  10. X-ray equipment

    International Nuclear Information System (INIS)

    Redmayne, I.G.B.


    The patent concerns a warning and protection system for mobile x-ray equipment used for 'on site' radiography, so that workers in the vicinity of such a working unit can be alerted to its presence. The invention is a local repeater warning system which gives a preliminary warning that energisation of the tubehead is imminent, as well as a switch near the tubehead to abort or inhibit energisation. The latter switch allows personnel caught in the vicinity of the tubehead to prevent energisation. The preliminary warning may be flashing lamps or by a klaxon. The control unit for the equipment may include a monitoring circuit to detect failure of the warning light or klaxon. (U.K.)

  11. X-ray equipment

    Energy Technology Data Exchange (ETDEWEB)

    Redmayne, I.G.B.


    The patent concerns a warning and protection system for mobile x-ray equipment used for 'on site' radiography, so that workers in the vicinity of such a working unit can be alerted to its presence. The invention is a local repeater warning system which gives a preliminary warning that energisation of the tubehead is imminent, as well as a switch near the tubehead to abort or inhibit energisation. The latter switch allows personnel caught in the vicinity of the tubehead to prevent energisation. The preliminary warning may be flashing lamps or by a klaxon. The control unit for the equipment may include a monitoring circuit to detect failure of the warning light or klaxon. (U.K.).

  12. Cosmic Ray Antimatter

    CERN Multimedia

    CERN. Geneva


    Over the last decade, space-born experiments have delivered new measurements of high energy cosmic-ray (CR) antiprotons and positrons, opening new frontiers in energy reach and precision. While being a promising discovery tool for new physics or exotic astrophysical phenomena, an irreducible background of antimatter comes from CR collisions with interstellar matter in the Galaxy. Understanding this irreducible source or constraining it from first principles is an interesting challenge: a game of hide-and-seek where the objective is to identify the laws of basic particle physics among the forest of astrophysical uncertainties. I describe an attempt to obtain such understanding, combining information from a zoo of CR species including massive nuclei and relativistic radioisotopes. I show that: (i) CR antiprotons most likely come from CR-gas collisions; (ii) positron data is consistent with, and suggestive of the same astrophysical production mechanism responsible for antiprotons and dominated by proton-proton c...

  13. Applied gamma-ray spectrometry

    CERN Document Server

    Dams, R; Crouthamel, Carl E


    Applied Gamma-Ray Spectrometry covers real life application of the gamma-ray and the devices used in their experimental studies. This book is organized into 9 chapters, and starts with discussions of the various decay processes, the possible interaction mechanisms of gamma radiation with matter, and the intrinsic and extrinsic variables, which affect the observed gamma-ray and X-ray spectra. The subsequent chapters deal with the properties and fabrication of scintillation detectors, semiconductor detectors, and proportional gas counters. These chapters present some of the most widely utilized

  14. X-ray Absorption Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Yano, Junko; Yachandra, Vittal K.


    This review gives a brief description of the theory and application of X-ray absorption spectroscopy, both X-ray absorption near edge structure (XANES) and extended X-ray absorption fine structure (EXAFS), especially, pertaining to photosynthesis. The advantages and limitations of the methods are discussed. Recent advances in extended EXAFS and polarized EXAFS using oriented membranes and single crystals are explained. Developments in theory in understanding the XANES spectra are described. The application of X-ray absorption spectroscopy to the study of the Mn4Ca cluster in Photosystem II is presented.

  15. Cosmic ray: Studying the origin

    Energy Technology Data Exchange (ETDEWEB)

    Szabelski, J. [Cosmic Ray Laboratory, Soltan Institute for Nuclear Studies, Lodz (Poland)


    Investigations of the origin of cosmic rays are presented. Different methods are discussed: studies of cosmic gamma rays of energy from 30 MeV to about 10{sup 15} eV (since photons point to their places of origin), studies of the mass composition of cosmic rays (because it reflects source morphology), and studies of cosmic rays with energy above 1O{sup 19} eV (for these are the highest energies observed in nature). (author) 101 refs, 19 figs, 7 tabs

  16. γ ray astronomy with muons

    International Nuclear Information System (INIS)

    Halzen, F.; Stanev, T.; Yodh, G.B.


    Although γ ray showers are muon poor, they still produce a number of muons sufficient to make the sources observed by GeV and TeV telescopes observable also in muons. For sources with hard γ ray spectra there is a relative open-quotes enhancementclose quotes of muons from γ ray primaries as compared to that from nucleon primaries. All shower γ rays above the photoproduction threshold contribute to the number of muons N μ , which is thus proportional to the primary γ ray energy. With γ ray energy 50 times higher than the muon energy and a probability of muon production by the γ close-quote s of about 1%, muon detectors can match the detection efficiency of a GeV satellite detector if their effective area is larger by 10 4 . The muons must have enough energy for sufficiently accurate reconstruction of their direction for doing astronomy. These conditions are satisfied by relatively shallow neutrino detectors such as AMANDA and Lake Baikal, and by γ ray detectors such as MILAGRO. TeV muons from γ ray primaries, on the other hand, are rare because they are only produced by higher energy γ rays whose flux is suppressed by the decreasing flux at the source and by absorption on interstellar light. We show that there is a window of opportunity for muon astronomy with the AMANDA, Lake Baikal, and MILAGRO detectors. copyright 1997 The American Physical Society

  17. X-ray filtration apparatus

    International Nuclear Information System (INIS)

    Thompson, G.


    This invention relates to an X-ray shielding support device. In spite of considerable development in X-ray taking techniques, a need still exists for effective shielding, inter alia, to compensate for variations in the thickness, density and the absorption properties of the object being studied. By appropriate shielding, the X-ray image produced is of sufficient detail, contrast and intensity over its entire area to constitute a useful diagnostic aid. It is also desirable to subject the patient to the smallest possible X-ray dosage. 4 figs

  18. X-ray emission spectroscopy. X-ray fluorescence

    International Nuclear Information System (INIS)

    Despujols, J.


    Principles of X-ray emission spectrometry are first recalled, then wave-length dispersive and energy dispersive X-ray fluorescence spectrometer are described. They are essentially designed for qualitative and quantitative analysis of elements (Z>10). Sample preparation, calibration, corrections, interferences, accuracy are reviewed. Examples of use in different industries are given. (71 refs.)

  19. X-ray diagnostics for TFTR

    International Nuclear Information System (INIS)

    von Goeler, S.; Hill, K.W.; Bitter, M.


    A short description of the x-ray diagnostic preparation for the TFTR tokamak is given. The x-ray equipment consists of the limiter x-ray monitoring system, the soft x-ray pulse-height-analysis-system, the soft x-ray imaging system and the x-ray crystal spectrometer. Particular attention is given to the radiation protection of the x-ray systems from the neutron environment

  20. X-ray photoelectron spectroscopy

    International Nuclear Information System (INIS)

    Attekum, P.M.T.M. van.


    The methods and results of X-ray photoelectron spectroscopy in the study of plasmons, alloys and gold compounds are discussed. After a comprehensive introduction, seven papers by the author, previously published elsewhere, are reprinted and these cover a wide range of the uses of X-ray photoelectron spectroscopy. (W.D.L.)

  1. Semiconductor X-ray detectors

    CERN Document Server

    Lowe, Barrie Glyn


    Identifying and measuring the elemental x-rays released when materials are examined with particles (electrons, protons, alpha particles, etc.) or photons (x-rays and gamma rays) is still considered to be the primary analytical technique for routine and non-destructive materials analysis. The Lithium Drifted Silicon (Si(Li)) X-Ray Detector, with its good resolution and peak to background, pioneered this type of analysis on electron microscopes, x-ray fluorescence instruments, and radioactive source- and accelerator-based excitation systems. Although rapid progress in Silicon Drift Detectors (SDDs), Charge Coupled Devices (CCDs), and Compound Semiconductor Detectors, including renewed interest in alternative materials such as CdZnTe and diamond, has made the Si(Li) X-Ray Detector nearly obsolete, the device serves as a useful benchmark and still is used in special instances where its large, sensitive depth is essential. Semiconductor X-Ray Detectors focuses on the history and development of Si(Li) X-Ray Detect...

  2. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.


    Intra-oral dental X-ray apparatus for panoramic radiography is described in detail. It comprises a tubular target carrier supporting at its distal end a target with an inclined forward face. Image definition is improved by positioning in the path of the X-rays a window of X-ray transmitting ceramic material, e.g. 90% oxide of Be, or Al, 7% Si0 2 . The target carrier forms a probe which can be positioned in the patient's mouth. X-rays are directed forwardly and laterally of the target to an X-ray film positioned externally. The probe is provided with a detachable sleeve having V-form arms of X-ray opaque material which serve to depress the tongue out of the radiation path and also shield the roof of the mouth and other regions of the head from the X-ray pattern. A cylindrical lead shield defines the X-ray beam angle. (author)

  3. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... over time. top of page What are the benefits vs. risks? Benefits Bone x-rays are the fastest and easiest ... bear denotes child-specific content. Related Articles and Media Radiation Dose in X-Ray and CT Exams ...

  4. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... ray examination. X-rays usually have no side effects in the typical diagnostic range for this exam. Risks There is always a slight chance of cancer from excessive exposure to radiation. However, the benefit of an accurate ...

  5. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... have very controlled x-ray beams and dose control methods to minimize stray (scatter) radiation. This ensures that those parts of a patient's body not being imaged receive minimal radiation exposure. top of page What are the limitations of Bone X-ray (Radiography)? ...

  6. Traditional x-ray imaging

    International Nuclear Information System (INIS)

    Hay, G.A.


    Methods of imaging x-rays, with particular reference to medicine, are reviewed. The history and nature of x-rays, their production and spectra, contrast, shapes and fine structure, image transducers, including fluorescent screens, radiography, fluoroscopy, and image intensifiers, image detection, perception and enhancement and clinical applications are considered. (U.K.)

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... standards used by radiology professionals. Modern x-ray systems have very controlled x-ray beams and dose control methods to minimize stray (scatter) radiation. This ensures that those parts of a patient's body not being imaged receive minimal radiation exposure. ...

  8. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... have special pediatric considerations. The teddy bear denotes child-specific content. Related Articles and Media Radiation Dose in X-Ray and CT Exams Arthritis X-ray, Interventional Radiology and Nuclear Medicine Radiation Safety How to Read Your Radiology Report ...

  9. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... are a form of radiation like light or radio waves. X-rays pass through most objects, including the body. Once it is carefully aimed at the part of the body being examined, an x-ray machine produces a small burst of radiation that passes through the body, recording ...

  10. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... body. Once it is carefully aimed at the part of the body being examined, an x-ray machine produces a small burst of radiation that passes through the body, recording an image on photographic film or a special detector. Different parts of the body absorb the x-rays in ...

  11. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... clothing that might interfere with the x-ray images. Women should always inform their physician and x-ray ... lowest radiation dose possible while producing the best images for ... organizations continually review and update the technique standards used ...

  12. X-ray imaging system

    International Nuclear Information System (INIS)

    Houston, J.M.


    A novel, high-speed apparatus for use in X-ray computerised tomography is described in detail. It consists of a semi-circular array of X-ray sources, collimators and an ion chamber array for detection of the X-rays. The X-ray sources may be pulsed in salvos such that the corresponding detectors in the array are only illuminated by one source. The use of computer controlled salvos speeds up the image processing by at least a factor of two. The ion chamber array is designed to have a constant detection efficiency for varying angles of X-ray incidence. A detailed description of the detector construction and suggested gaseous fillings are given. It is claimed that the present tomographic system allows fast and accurate imaging of internal body organs and is insensitive to the blurring effects which motion of these organs tends to produce. (UK)

  13. X-ray filter for chest X-rays

    International Nuclear Information System (INIS)

    Ferlic, D.J.


    A description is given of an X-ray filter comprised of a sheet of radiation absorbing material with an opening corresponding to the spine and central portion of the heart. The upper portion of the filter exhibits a relatively narrow opening which becomes gradually wider toward the lower portion of the filter. This filter will permit an acceptable density level of x-ray exposure for the lungs while allowing a higher level of x-ray exposure for the mediastinum areas of the body. (author)

  14. X-ray filter for chest x-rays

    International Nuclear Information System (INIS)

    Ferlic, D.J.


    Filter for use in medical x-ray apparatus to permit higher intensity x-ray exposure in the heart and mediastinum area while maintaining a normal level of x-ray exposure in other areas of the body, particlarly in the lung area. The filter comprises a sheet of radiation absorbing material having an opening therein, said opening corresponding to the spine and central portion of the heart. Accordingly, the upper portion of the filter exhibits a relatively narrow opening which becomes gradually wider toward the lower portion of the filter

  15. Upsurge of X-ray astronomy 230-

    International Nuclear Information System (INIS)

    Hudec, D.R.


    Instruments are described used for X-ray astronomy, namely X-ray detectors and X-ray telescopes. Unlike telescopes, the detectors do not comprise X-ray optics. A survey is given of the results obtained in solar and stellar X-ray astronomy and hypotheses are submitted on the origin of X radiation in the interstellar space. (J.B.)

  16. Low energy (soft) x rays

    International Nuclear Information System (INIS)

    Hoshi, Masaharu; Antoku, Shigetoshi; Russell, W.J.; Miller, R.C.; Nakamura, Nori; Mizuno, Masayoshi; Nishio, Shoji.


    Dosimetry of low-energy (soft) X rays produced by the SOFTEX Model CMBW-2 was performed using Nuclear Associates Type 30 - 330 PTW, Exradin Type A2, and Shonka-Wyckoff ionization chambers with a Keithley Model 602 electrometer. Thermoluminescent (BeO chip) dosimeters were used with a Harshaw Detector 2000-A and Picoammeter-B readout system. Beam quality measurements were made using aluminum absorbers; exposure rates were assessed by the current of the X-ray tube and by exposure times. Dose distributions were established, and the average factors for non-uniformity were calculated. The means of obtaining accurate absorbed and exposed doses using these methods are discussed. Survival of V79 cells was assessed by irradiating them with soft X rays, 200 kVp X rays, and 60 Co gamma rays. The relative biological effectiveness (RBE) values for soft X rays with 0, 0.2, 0.7 mm added thicknesses of aluminum were 1.6, which were compared to 60 Co. The RBE of 200 kVp X rays relative to 60 Co was 1.3. Results of this study are available for reference in future RERF studies of cell survival. (author)

  17. Apparatus for gamma ray radiography

    International Nuclear Information System (INIS)

    Kobayashi, Masatoshi; Enomoto, Shigemasa; Oga, Hiroshi


    This is the standard of Japan Non-Destructive Inspection Society, NDIS 1101-79, which stipulates on the design, construction and testing method of the apparatuses for gamma ray radiography used for taking industrial radiograms. The gamma ray apparatuses stipulated in this standard are those containing sealed radioactive isotopes exceeding 100 μCi, which emit gamma ray. The gamma ray apparatuses are classified into three groups according to their movability. The general design conditions, the irradiation dose rate and the sealed radiation sources for the gamma ray apparatuses are stipulated. The construction of the gamma ray apparatuses must be in accordance with the notification No. 52 of the Ministry of Labor, and safety devices and collimators must be equipped. The main bodies of the gamma ray apparatuses must pass the vibration test, penetration test, impact test and shielding efficiency test. The method of each test is described. The attached equipments must be also tested. The tests according to this standard are carried out by the makers of the apparatuses. The test records must be made when the apparatuses have passed the tests, and the test certificates are attached. The limit of guarantee by the endurance test must be clearly shown. The items to be shown on the apparatuses are stipulated. (Kako, I.)

  18. X-ray and gamma ray waveguide, cavity and method

    International Nuclear Information System (INIS)

    Vali, V.; Krogstad, R.S.; Willard, H.R.


    An x-ray and gamma ray waveguide, cavity, and method for directing electromagnetic radiation of the x-ray, gamma ray, and extreme ultraviolet wavelengths are described. A hollow fiber is used as the waveguide and is manufactured from a material having an index of refraction less than unity for these wavelengths. The internal diameter of the hollow fiber waveguide and the radius of curvature for the waveguide are selectively predetermined in light of the wavelength of the transmitted radiation to minimize losses. The electromagnetic radiation is obtained from any suitable source ad upon introduction into the waveguide is transmitted along a curvilinear path. The waveguide may be formed as a closed loop to create a cavity or may be used to direct the electromagnetic radiation to a utilization site

  19. X-Ray and Gamma-Ray Radiation Detector

    DEFF Research Database (Denmark)


    Disclosed is a semiconductor radiation detector for detecting X-ray and / or gamma-ray radiation. The detector comprises a converter element for converting incident X-ray and gamma-ray photons into electron-hole pairs, at least one cathode, a plurality of detector electrodes arranged with a pitch...... (P) along a first axis, a plurality of drift electrodes, a readout circuitry being configured to read out signals from the plurality of detector electrodes and a processing unit connected to the readout circuitry and being configured to detect an event in the converter element. The readout circuitry...... is further configured to read out signals from the plurality of drift electrodes, and the processing unit is further configured to estimate a location of the event along the first axis by processing signals obtained from both the detector electrodes and the drift electrodes, the location of the event along...

  20. Detectors of Cosmic Rays, Gamma Rays, and Neutrinos

    International Nuclear Information System (INIS)

    Altamirano, A.; Navarra, G.


    We summarize the main features, properties and performances of the typical detectors in use in Cosmic Ray Physics. A brief historical and general introduction will focus on the main classes and requirements of such detectors.

  1. Cosmic Ray and Tev Gamma Ray Generation by Quasar Remnants (United States)

    Boldt, Elihu; Loewenstein, Michael; White, Nicholas E. (Technical Monitor)


    Results from new broadband (radio to X-ray) high-resolution imaging studies of the dormant quasar remnant cores of nearby giant elliptical galaxies are now shown to permit the harboring of compact dynamos capable of generating the highest energy cosmic ray particles and associated curvature radiation of TeV photons. Confirmation would imply a global inflow of interstellar gas all the way to the accretion powered supermassive black hole at the center of the host galaxy.

  2. Cosmic rays, clouds and climate

    Energy Technology Data Exchange (ETDEWEB)

    Svensmark, Henrik [Danish Space Research Institute, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark)


    Changes in the intensity of galactic cosmic rays seems alter the Earth's cloudiness. A recent experiment has shown how electrons liberated by cosmic rays assist in making aerosols, the building blocks of cloud condensation nuclei, while anomalous climatic trends in Antarctica confirm the role of clouds in helping to drive climate change. Variations in the cosmic-ray influx due to solar magnetic activity account well for climatic fluctuations on decadal, centennial and millennial timescales. Over longer intervals, the changing galactic environment of the Solar System has had dramatic consequences, including Snowball Earth episodes.

  3. X-ray film calibration

    International Nuclear Information System (INIS)

    Stone, G.F.; Dittmore, C.H.; Henke, B.L.


    This paper discusses the use of silver halide x-ray films for imaging and spectroscopy which is limited by the range of intensities that can be recorded and densitometered. Using the manufacturers processing techniques can result in 10 2-3 range in intensity recorded over 0-5 density range. By modifying the chemistry and processing times, ranges of 10 5-6 can be recorded in the same density range. The authors report on x-ray film calibration work and dynamic range improvements. Changes to the processing chemistry and the resulting changes in dynamic range and x-ray sensitivity are discussed

  4. Women and x-rays

    Energy Technology Data Exchange (ETDEWEB)

    Dunkley, P A; Stewart, J H


    When a woman comes to an X-Ray Department it is usually necessary to know the present stage of her menstrual cycle. X-Rays may have an adverse effect on the embryo, especially in early pregnancy. However, exposure to X-Rays at any stage may be associated with a slightly increased incidence of malignant disease in childhood. The International Commission on Radiological Protection recommends that in women of child-bearing age (in some cases as young as 11 years), non-urgent diagnostic radiography be confined to the preovulatory phase of the menstrual cycle: that is, 14 days following the first day of the last menstrual period.

  5. Coherent γ-ray production

    International Nuclear Information System (INIS)

    Bertolotti, M.; Sibilia, C.


    In this article the authors discuss a new approach for developing a coherent source of γ-rays. They offer a completely different scheme for development of the source that should overcome most of the problems encountered in ''classical γ-ray lasers,'' and in which the use of inverse Compton scattering of laser radiation onto a relativistic electron beam is made. This kind of interaction has been used to obtain γ-ray photons with good polarization and monochromaticity properties. The authors describe a new geometry of interaction which allows one to obtain coherent emission

  6. Center for X-Ray Optics, 1992

    International Nuclear Information System (INIS)


    This report discusses the following topics: Center for X-Ray Optics; Soft X-Ray Imaging wit Zone Plate Lenses; Biological X-Ray microscopy; Extreme Ultraviolet Lithography for Nanoelectronic Pattern Transfer; Multilayer Reflective Optics; EUV/Soft X-ray Reflectometer; Photoemission Microscopy with Reflective Optics; Spectroscopy with Soft X-Rays; Hard X-Ray Microprobe; Coronary Angiography; and Atomic Scattering Factors

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... more information about pregnancy and x-rays. A Word About Minimizing Radiation Exposure Special care is taken ... and/or your insurance provider to get a better understanding of the possible charges you will incur. ...

  8. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... is repeated. Two or three images (from different angles) will typically be taken. An x-ray may ... is not a medical facility. Please contact your physician with specific medical questions or for ...

  9. Cosmic rays and global warming

    Energy Technology Data Exchange (ETDEWEB)

    Erlykin, A.D. [P.N. Lebedev Physical Institute, Moscow (Russian Federation); Sloan, T. [Lancaster University (United Kingdom); Wolfendale, A.W. [Durham University (United Kingdom)


    The possible effects of cosmic rays on clouds could contribute to global warming. The argument is that the observed increased solar activity during the last century caused a decrease in the ionization due to cosmic rays since the lower energy cosmic particles are deflected by the magnetic field created by the increasing solar wind. This would lead to a decrease in cloud cover allowing more heating of the earth by the sun. Meteorological data combined to solar activity observations and simulations show that any effect of solar activity on clouds and the climate is likely to be through irradiance rather than cosmic rays. Since solar irradiance transfers 8 orders of magnitude more energy to the atmosphere than cosmic rays it is more plausible that this can produce a real effect. The total contribution of variable solar activity to global warming is shown to be less than 14% of the total temperature rise. (A.C.)

  10. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... ray (radiograph) is a noninvasive medical test that helps physicians diagnose and treat medical conditions. Imaging with ... or other positioning devices will be used to help you maintain the proper position. A lead apron ...

  11. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... no special preparation. Tell your doctor and the technologist if there is any possibility you are pregnant. ... should always inform their physician and x-ray technologist if there is any possibility that they are ...

  12. X-ray guided biopsy

    International Nuclear Information System (INIS)

    Casanova, R.; Lezana, A.H.; Pedrosa, C.S.


    Fine needle aspiration biopsy (FNAB) is now a routine procedure in many X-ray Departments. This paper presents the authors' experience with this technique in chest, abdominal and skeletal lesions. (Auth.)

  13. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... Radiography) - Bone Bone x-ray uses a very small dose of ionizing radiation to produce pictures of ... exposing a part of the body to a small dose of ionizing radiation to produce pictures of ...

  14. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... replacement and fracture reductions. look for injury, infection, arthritis , abnormal bone growths and bony changes seen in ... injuries, including fractures, and joint abnormalities, such as arthritis. X-ray equipment is relatively inexpensive and widely ...

  15. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.


    Intra-oral dental X-ray apparatus for panoramic dental radiography is described in detail. It comprises an electron gun having an elongated tubular target carrier extending into the patient's mouth. The carrier supports an inclined target for direction of an X-ray pattern towards a film positioned externally of the patient's mouth. Image definition is improved by a focusing anode which focuses the electron beam into a sharp spot (0.05 to 0.10 mm diameter) on the target. The potential on the focusing anode is adjustable to vary the size of the spot. An X-ray transmitting ceramic (oxides of Be, Al and Si) window is positioned adjacent to the front face of the target. The electron beam can be magnetically deflected to change the X-ray beam direction. (author)

  16. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... procedure varies. See the Safety page for more information about radiation dose. Women should always inform their ...

  17. X-Ray Assembler Data (United States)

    U.S. Department of Health & Human Services — Federal regulations require that an assembler who installs one or more certified components of a diagnostic x-ray system submit a report of assembly. This database...

  18. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... technologist, an individual specially trained to perform radiology examinations, positions the patient on the x-ray table ... bone is forming), for comparison purposes. When the examination is complete, you may be asked to wait ...

  19. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... in a known abnormality can be monitored over time. Follow-up examinations are sometimes the best way ...

  20. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... the radiation while soft tissue, such as muscle, fat and organs, allow more of the x-rays ... taken of the unaffected limb, or of a child's growth plate (where new bone is forming), for ...

  1. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... the radiation while soft tissue, such as muscle, fat and organs, allow more of the x-rays ... information you were looking for? Yes No Please type your comment or suggestion into the following text ...

  2. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... pregnant. Many imaging tests are not performed during pregnancy so as not to expose the fetus to ... See the Safety page for more information about pregnancy and x-rays. top of page What does ...

  3. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... a large photographic negative). Today, most images are digital files that are stored electronically. These stored images ... and places the x-ray film holder or digital recording plate under the table in the area ...

  4. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... in metabolic conditions. assist in the detection and diagnosis of bone cancer . locate foreign objects in soft ... frequently compared to current x-ray images for diagnosis and disease management. top of page How is ...

  5. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... of any bone in the body, including the hand, wrist, arm, elbow, shoulder, spine, pelvis, hip, thigh, knee, leg ( ... Image Gallery Radiological technologist preparing to take an arm x-ray on a ... Images related ...

  6. Energy deposition by delta rays

    International Nuclear Information System (INIS)

    Weigand, F.C.; Braby, L.A.


    Monte Carlo calculations for proton tracks were extended to projectile with more complex electronic structures which add additional delta ray production processes. An experimental apparatus was used to detect gas gain and resolution for H 2+ and 3 He ++

  7. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... care is taken during x-ray examinations to use the lowest radiation dose possible while producing the best images for evaluation. National and international radiology protection organizations continually review ...

  8. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... very controlled x-ray beams and dose control methods to minimize stray (scatter) radiation. This ensures that ... radiation oncology provider in your community, you can search the ACR-accredited facilities database . This website does ...

  9. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... small burst of radiation that passes through the body, recording an image on photographic film or a special detector. Different parts of the body absorb the x-rays in varying degrees. Dense ...

  10. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... x-ray machine is a compact apparatus that can be taken to the patient in a hospital ... so that any change in a known abnormality can be monitored over time. Follow-up examinations are ...

  11. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... of page What will I experience during and after the procedure? A bone x-ray examination itself ... available in emergency rooms, physician offices, ambulatory care centers, nursing homes and other locations, making it convenient ...

  12. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... will analyze the images and send a signed report to your primary care or referring physician , who ... Medicine Radiation Safety How to Read Your Radiology Report Images related to X-ray (Radiography) - Bone Sponsored ...

  13. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... bear denotes child-specific content. Related Articles and Media Radiation Dose in X-Ray and CT Exams ... the web pages found at these links. About Us | Contact Us | FAQ | Privacy | Terms of Use | Links | ...

  14. Interplanetary cosmic-ray scintillations

    Energy Technology Data Exchange (ETDEWEB)

    Toptygin, I N; Vasiliev, V N [Kalininskij Sel' skokhozyajstvennyj Inst. (USSR)


    The equation for the two-particles cosmic-ray distribution function is derived by means of the Boltzmann kinetic equation averaging. This equation is valid for arbitrary ratio of regular and random parts of the magnetic field. For small energy particles the guiding-center approximation is used. On the basis of the derived equation the dependence between power spectra of cosmic-ray intensity and random magnetic field is obtained. If power spectra are degree functions for high energy particles (approximately 10 GeV nucleon/sup -1/), then the spectral exponent ..gamma.. of magnetic field lies between rho and rho-2, where rho is the spectral exponent of cosmic-ray power spectra. The experimental data concerning moderate energy particles are in accordance with ..gamma..=rho, which demonstrates that the magnetic fluctuations are isotropic or cosmic-ray space gradient is small near the Earth orbit.

  15. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... to produce pictures of any bone in the body. It is commonly used to diagnose fractured bones ... x-rays involves exposing a part of the body to a small dose of ionizing radiation to ...

  16. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... to X-ray (Radiography) - Bone Sponsored by Please note is not a medical facility. Please ... is further reviewed by committees from the American College of Radiology (ACR) and the Radiological Society of ...

  17. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... the baby. See the Safety page for more information about pregnancy and x-rays. top of page ... procedure varies. See the Safety page for more information about radiation dose. Women should always inform their ...

  18. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... and fracture reductions. look for injury, infection, arthritis , abnormal bone growths and bony changes seen in metabolic ... to current x-ray images for diagnosis and disease management. top of page How is the procedure ...

  19. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... imaged. When necessary, sandbags, pillows or other positioning devices will be used to help you maintain the ... here Images × Image Gallery Radiological technologist preparing to take an arm x-ray on a patient. View ...

  20. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... foot. top of page What are some common uses of the procedure? A bone x-ray is ... community, you can search the ACR-accredited facilities database . This website does not provide cost information. The ...

  1. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... patient. top of page How does the procedure work? X-rays are a form of radiation like ... taken of the unaffected limb, or of a child's growth plate (where new bone is forming), for ...

  2. Flash x-ray cinematography

    International Nuclear Information System (INIS)

    Stein, W.E.


    Experiments intended to provide an overview of the potential capabilities and limitations of flash x-ray cinematography as a diagnostic technique for a Fast Reactor Safety Test Facility are described. The results provide estimates of the x-ray pulse intensity required to obtain adequate radiographs of an array of fuel pins in a typical reactor configuration. An estimate of the upper limit on the pulse duration imposed by the reactor background radiation was also determined. X-ray cinematography has been demonstrated at a repetition rate limited only by the recording equipment on hand at the time of these measurements. These preliminary results indicate that flash x-ray cinematography of the motion of fuel in a Fast Reactor Test Facility is technically feasible

  3. X-ray screening materials

    International Nuclear Information System (INIS)

    Wardley, R.B.


    This invention relates to x-ray screening materials and especially to materials in sheet form for use in the production of, for example, protective clothing such as aprons and lower back shields, curtains, mobile screens and suspended shields. The invention is based on the observation that x-ray screening materials in sheet form having greater flexiblity than the hitherto known x-ray screening materials of the same x-ray absorber content can be produced if, instead of using a single sheet of filled sheet material of increased thickness, one uses a plurality of sheets of lesser thickness together forming a laminar material of the desired thickness and one bonds the individual sheets together at their edges and, optionally, at other spaced apart points away from the edges thereby allowing one sheet to move relative to another. (U.K.)

  4. X-ray luminescent glasses

    International Nuclear Information System (INIS)

    Takahashi, T.; Yamada, O.


    X-ray luminescent glasses comprising a divalent cation such as an alkaline earth metal or other divalent cations such as pb, cd, or zn, and certain rare earth metaphosphates are suitable as vitreous, x-ray phosphors or x-ray luminescent glass fibers in an x-ray intensifying screen. The glasses have the composition n(Mo X p2o5)((1-y)tb2o3 X yce2o3 X 3p2o5) wherein N is greater than zero but less than or equal to 16, M is an alkaline earth metal or other divalent cation such as pb, cd, or zn, and Y is greater than or equal to zero but less than one

  5. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... x-ray uses a very small dose of ionizing radiation to produce pictures of any bone in the ... of the body to a small dose of ionizing radiation to produce pictures of the inside of the ...

  6. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... current x-ray images for diagnosis and disease management. top of page How is the procedure performed? ... examination may also be necessary so that any change in a known abnormality can be monitored over ...

  7. Gamma rays at airplane altitudes

    International Nuclear Information System (INIS)

    Iwai, J.; Koss, T.; Lord, J.; Strausz, S.; Wilkes, J.; Woosley, J.


    An examination of the gamma ray flux above 1 TeV in the atmosphere is needed to better understand the anomalous showers from point sources. Suggestions are made for future experiments on board airplanes

  8. Miniature x-ray source (United States)

    Trebes, James E.; Bell, Perry M.; Robinson, Ronald B.


    A miniature x-ray source utilizing a hot filament cathode. The source has a millimeter scale size and is capable of producing broad spectrum x-ray emission over a wide range of x-ray energies. The miniature source consists of a compact vacuum tube assembly containing the hot filament cathode, an anode, a high voltage feedthru for delivering high voltage to the cathode, a getter for maintaining high vacuum, a connector for initial vacuum pump down and crimp-off, and a high voltage connection for attaching a compact high voltage cable to the high voltage feedthru. At least a portion of the vacuum tube wall is fabricated from highly x-ray transparent materials, such as sapphire, diamond, or boron nitride.

  9. Duodenal X-ray diagnostics

    International Nuclear Information System (INIS)

    Scheppach, W.


    The publication provides an overview of duodenal X-ray diagnostics with the aid of barium meals in 1362 patients. The introducing paragraphs deal with the topographic anatomy of the region and the methodics of X-ray investigation. The chapter entitled ''processes at the duodenum itself'' describes mainly ulcers, diverticula, congenital anomalies, tumors and inflammations. The neighbourhood processes comprise in the first place diseases having their origin at the pancreas and bile ducts. As a conclusion, endoscopic rectograde cholangio-pancreaticography and percutaneous transhepatic cholangiography are pointed out as advanced X-ray investigation methods. In the annex of X-ray images some of the described phenomena are shown in exemplary manner. (orig./MG) [de

  10. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... position possible that still ensures x-ray image quality. top of page Who interprets the results and ... accredited facilities database . This website does not provide cost information. The costs for specific medical imaging tests, ...

  11. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... top of page What are the benefits vs. risks? Benefits Bone x-rays are the fastest and ... in the typical diagnostic range for this exam. Risks There is always a slight chance of cancer ...

  12. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... fracture. guide orthopedic surgery, such as spine repair/fusion, joint replacement and fracture reductions. look for injury, ... CT Exams Arthritis X-ray, Interventional Radiology and Nuclear Medicine Radiation Safety How to Read Your Radiology ...

  13. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... the oldest and most frequently used form of medical imaging. A bone x-ray makes images of any ... a radiologist or other physician. To locate a medical imaging or radiation oncology provider in your community, you ...

  14. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... carefully aimed at the part of the body being examined, an x-ray machine produces a small ... the table in the area of the body being imaged. When necessary, sandbags, pillows or other positioning ...

  15. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... Leave jewelry at home and wear loose, comfortable clothing. You may be asked to wear a gown. ... appliances, eye glasses and any metal objects or clothing that might interfere with the x-ray images. ...

  16. Magnetic x-ray microdiffraction

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Paul G [Computer-Aided Engineering Center, University of Wisconsin, Madison, WI 53706 (United States); Isaacs, Eric D [Center for Nanoscale Materials, Argonne National Laboratory, Argonne, IL 60439 (United States)


    Magnetic x-ray microdiffraction uses the structural specificity of x-ray diffraction to probe complex magnetic structures at the length scales relevant to physical phenomena including domain dynamics and phase transitions. Conventional magnetic crystallography techniques such as neutron or x-ray diffraction lack this spatial resolution. The combination of both reciprocal space and real space resolution with a rich magnetic cross section allows new microscopy techniques to be developed and applied to magnetism at the scale of single domains. Potential applications include a wide range of magnetic problems in nanomagnetism, the interaction of strain, polarization and magnetization in complex oxides and spatially resolved studies of magnetic phase transitions. We present the physical basis for x-ray microdiffraction and magnetic scattering processes, review microdiffraction domain imaging techniques in antiferromagnetic and ferromagnetic materials and discuss potential directions for studies. (topical review)

  17. Compton Gamma-Ray Observatory (United States)


    This photograph shows the Compton Gamma-Ray Observatory (GRO) being deployed by the Remote Manipulator System (RMS) arm aboard the Space Shuttle Atlantis during the STS-37 mission in April 1991. The GRO reentered Earth atmosphere and ended its successful mission in June 2000. For nearly 9 years, the GRO Burst and Transient Source Experiment (BATSE), designed and built by the Marshall Space Flight Center (MSFC), kept an unblinking watch on the universe to alert scientists to the invisible, mysterious gamma-ray bursts that had puzzled them for decades. By studying gamma-rays from objects like black holes, pulsars, quasars, neutron stars, and other exotic objects, scientists could discover clues to the birth, evolution, and death of stars, galaxies, and the universe. The gamma-ray instrument was one of four major science instruments aboard the Compton. It consisted of eight detectors, or modules, located at each corner of the rectangular satellite to simultaneously scan the entire universe for bursts of gamma-rays ranging in duration from fractions of a second to minutes. In January 1999, the instrument, via the Internet, cued a computer-controlled telescope at Las Alamos National Laboratory in Los Alamos, New Mexico, within 20 seconds of registering a burst. With this capability, the gamma-ray experiment came to serve as a gamma-ray burst alert for the Hubble Space Telescope, the Chandra X-Ray Observatory, and major gound-based observatories around the world. Thirty-seven universities, observatories, and NASA centers in 19 states, and 11 more institutions in Europe and Russia, participated in the BATSE science program.

  18. Electromechanical x-ray generator (United States)

    Watson, Scott A; Platts, David; Sorensen, Eric B


    An electro-mechanical x-ray generator configured to obtain high-energy operation with favorable energy-weight scaling. The electro-mechanical x-ray generator may include a pair of capacitor plates. The capacitor plates may be charged to a predefined voltage and may be separated to generate higher voltages on the order of hundreds of kV in the AK gap. The high voltage may be generated in a vacuum tube.

  19. Cosmic rays and Earth's climate

    DEFF Research Database (Denmark)

    Svensmark, Henrik


    During the last solar cycle the Earth's cloud cover underwent a modulation in phase with the cosmic ray flux. Assuming that there is a causal relationship between the two, it is expected and found that the Earth's temperature follows more closely decade variations in cosmic ray flux than other...... solar activity parameters. If the relationship is real the state of the Heliosphere affects the Earth's climate....

  20. Accelerator x-ray sources

    CERN Document Server

    Talman, Richard


    This first book to cover in-depth the generation of x-rays in particle accelerators focuses on electron beams produced by means of the novel Energy Recovery Linac (ERL) technology. The resulting highly brilliant x-rays are at the centre of this monograph, which continues where other books on the market stop. Written primarily for general, high energy and radiation physicists, the systematic treatment adopted by the work makes it equally suitable as an advanced textbook for young researchers.

  1. X-ray tube target

    International Nuclear Information System (INIS)

    Weber, R.G.


    A target with an improved heat emissive surface for use in a rotating anode type x-ray tube is described. The target consists of a body having a first surface portion made of x-ray emissive material and a second surface portion made of a heat emissive material comprising at least one of hafnium boride, hafnium oxide, hafnium nitride, hafnium silicide, and hafnium aluminide. (U.K.)

  2. X-ray fluorescence holography

    CERN Document Server

    Hayashi, K; Takahashi, Y


    X-ray fluorescence holography (XFH) is a new structural analysis method of determining a 3D atomic arrangement around fluorescing atoms. We developed an XFH apparatus using advanced X-ray techniques and succeeded in obtaining high-quality hologram data. Furthermore, we introduced applications to the structural analysis of a thin film and the environment around dopants and, discussed the quantitative analysis of local lattice distortion. (author)

  3. About cosmic gamma ray lines (United States)

    Diehl, Roland


    Gamma ray lines from cosmic sources convey the action of nuclear reactions in cosmic sites and their impacts on astrophysical objects. Gamma rays at characteristic energies result from nuclear transitions following radioactive decays or high-energy collisions with excitation of nuclei. The gamma-ray line from the annihilation of positrons at 511 keV falls into the same energy window, although of different origin. We present here the concepts of cosmic gamma ray spectrometry and the corresponding instruments and missions, followed by a discussion of recent results and the challenges and open issues for the future. Among the lessons learned are the diffuse radioactive afterglow of massive-star nucleosynthesis in 26Al and 60Fe gamma rays, which is now being exploited towards the cycle of matter driven by massive stars and their supernovae; large interstellar cavities and superbubbles have been recognised to be of key importance here. Also, constraints on the complex processes making stars explode as either thermonuclear or core-collapse supernovae are being illuminated by gamma-ray lines, in this case from shortlived radioactivities from 56Ni and 44Ti decays. In particular, the three-dimensionality and asphericities that have recently been recognised as important are enlightened in different ways through such gamma-ray line spectroscopy. Finally, the distribution of positron annihilation gamma ray emission with its puzzling bulge-dominated intensity disctribution is measured through spatially-resolved spectra, which indicate that annihilation conditions may differ in different parts of our Galaxy. But it is now understood that a variety of sources may feed positrons into the interstellar medium, and their characteristics largely get lost during slowing down and propagation of positrons before annihilation; a recent microquasar flare was caught as an opportunity to see positrons annihilate at a source.

  4. X-ray data processing


    Powell, Harold R.


    The method of molecular structure determination by X-ray crystallography is a little over a century old. The history is described briefly, along with developments in X-ray sources and detectors. The fundamental processes involved in measuring diffraction patterns on area detectors, i.e. autoindexing, refining crystal and detector parameters, integrating the reflections themselves and putting the resultant measurements on to a common scale are discussed, with particular reference to the most c...

  5. Descriptions and revised key to the eggcases of the skates (Rajiformes: Rajidae) and catsharks (Carcharhiniformes: Scyliorhinidae) of the British Isles. (United States)

    Gordon, Cat A; Hood, Ali R; Ellis, Jim R


    Updated descriptions and measurements for the eggcases of 10 rajiform and three scyliorhinid species occurring in the shelf seas around the British Isles are given, based on museum material, specimens collected during the 'Great Eggcase Hunt' (a Shark Trust recording project), and specimens obtained from fishery surveys. Quantitative data are given for Amblyraja radiata (n = 94), Dipturus batis (n = 24), D. cf. intermedia (n = 33), Leucoraja naevus (n = 94), Raja brachyura (n = 53), R. clavata (n = 52), R. microocellata (n = 57), R. montagui (n = 52), R. undulata (n = 52), Rostroraja alba (n = 5), Galeus melastomus (n = 7), Scyliorhinus canicula (n = 52) and S. stellaris (n = 58). An updated key for the identification of elasmobranch eggcases is provided, incorporating recent changes in skate taxonomy.

  6. Humidity measurement using alpha-ray and beta-ray

    International Nuclear Information System (INIS)

    Matsumoto, Shigeaki; Kobayashi, Hisanobu


    Two new hygrometers using radioisotopes were proposed, and the results of tests are described. The one is a dew-point hygrometer utilizing the backscattering phenomena of beta-ray by dew, and the other is a hygrometer by measuring the variation of ionization current by alpha ray due to humidity. The backscattering of beta-ray depends on the atomic number of scatters and the energy of beta-ray. Therefore, the backscattering from dew on a gold plate is different from that from the gold itself. The temperature dependence of the backscattering intensity was measured with a GM counter. Decrease of the intensity was seen at the dew point. A control circuit was designed to measure the dew point automatically. The error of the measurement was within 1 degree C. An alpha-ray ionization hygrometer was constructed. The dependence of ionization current on humidity was measured with an operational amplifier. The resolution of humidity measurement was within 5 percent. (Kato, T.)

  7. Cosmic gamma-ray burst

    International Nuclear Information System (INIS)

    Yamagami, Takamasa


    Ballon experiments for searching gamma-ray burst were carried out by employing rotating-cross modulation collimators. From a very long observation of total 315 hours during 1975 to 1979, three gamma-ray intensity anomalies were observed which were speculated as a gamma-ray burst. As for the first gamma-ray intensity anomaly observed in 1975, the burst source could be located precisely but the source, heavenly body, could not be specified. Gamma-ray burst source estimation was made by analyzing distribution of burst source in the celestial sphere, burst size distribution, and burst peak. Using the above-mentioned data together with previously published ones, apparent inconsistency was found between the observed results and the adopted theory that the source was in the Galaxy, and this inconsistency was found due to the different time profiles of the burst observed with instruments of different efficiency. It was concluded by these analysis results that employment of logN - logP (relation between burst frequency and burst count) was better than that of logN - logS (burst size) in the examination of gamma-ray burst because the former was less uncertain than the latter. Analyzing the author's observed gamma-ray burst data and the related published data, it was clarified that the burst distribution was almost P -312 for the burst peak value larger than 10 -6 erg/cm 2 .sec. The author could indicate that the calculated celestial distribution of burst source was consistent with the observed results by the derivation using the logN - logP relationship and that the burst larger than 10 -6 erg/cm 2 .sec happens about one thousand times a year, about ten times of the previous value. (Takagi, S.)

  8. Identification of potential essential fish habitats for skates based on fishers' knowledge. (United States)

    Serra-Pereira, Bárbara; Erzini, Karim; Maia, Catarina; Figueiredo, Ivone


    Understanding of spatio-temporal patterns of sensitive fish species such as skates (Rajidae) is essential for implementation of conservation measures. With insufficient survey data available for these species in Portuguese Continental waters, this study shows that fishery-dependent data associated with fishers' knowledge can be used to identify potential Essential Fish Habitats (EFH) for seven skate species. Sites with similar geomorphology were associated with the occurrence of juveniles and/or adults of the same group of species. For example, sites deeper than 100 m with soft sediment include predominantly adults of Raja clavata, and are the habitat for egg deposition of this species. Raja undulata and R. microocellata are the more coastal species, preferring sand or gravel habitats, while coastal areas with rocks and sand seabed are potential nursery areas for R. brachyura, R. montagui and R. clavata. The main output of this study is the identification of preferential fishing sites enclosing potential EFH for some species, associated with egg-laying and nursery grounds. The location of these areas will be considered for future seasonal closures, and studies will be conducted to evaluate the biological and socio-economic impacts of such measures. As in the past, fishermen will collaborate in the process of evaluating those impacts, since they have practical and applied knowledge that is extremely valuable for evaluating the advantages and disadvantages of such closures. In conclusion, this study is a first contribution to the understanding and identification of EFH for skate species, associated with nursery and egg deposition sites, with direct application to management.

  9. Identification of Potential Essential Fish Habitats for Skates Based on Fishers' Knowledge (United States)

    Serra-Pereira, Bárbara; Erzini, Karim; Maia, Catarina; Figueiredo, Ivone


    Understanding of spatio-temporal patterns of sensitive fish species such as skates (Rajidae) is essential for implementation of conservation measures. With insufficient survey data available for these species in Portuguese Continental waters, this study shows that fishery-dependent data associated with fishers' knowledge can be used to identify potential Essential Fish Habitats (EFH) for seven skate species. Sites with similar geomorphology were associated with the occurrence of juveniles and/or adults of the same group of species. For example, sites deeper than 100 m with soft sediment include predominantly adults of Raja clavata, and are the habitat for egg deposition of this species. Raja undulata and R. microocellata are the more coastal species, preferring sand or gravel habitats, while coastal areas with rocks and sand seabed are potential nursery areas for R. brachyura, R. montagui and R. clavata. The main output of this study is the identification of preferential fishing sites enclosing potential EFH for some species, associated with egg-laying and nursery grounds. The location of these areas will be considered for future seasonal closures, and studies will be conducted to evaluate the biological and socio-economic impacts of such measures. As in the past, fishermen will collaborate in the process of evaluating those impacts, since they have practical and applied knowledge that is extremely valuable for evaluating the advantages and disadvantages of such closures. In conclusion, this study is a first contribution to the understanding and identification of EFH for skate species, associated with nursery and egg deposition sites, with direct application to management.

  10. X-ray Emission from Solar Flares

    Indian Academy of Sciences (India)


    Jan 27, 2016 ... Solar flares; X-ray detectors; X-ray line emission and continuum; break energy; microflares. Abstract. Solar X-ray Spectrometer (SOXS), the first space-borne solar astronomy experiment of India was designed to improve our current understanding of X-ray emission from the Sun in general and solar flares in ...

  11. Chest X-Ray (Chest Radiography) (United States)

    ... Resources Professions Site Index A-Z X-ray (Radiography) - Chest Chest x-ray uses a very small dose ... Radiography? What is a Chest X-ray (Chest Radiography)? The chest x-ray is the most commonly performed diagnostic ...

  12. On evolutionary ray-projection dynamics

    NARCIS (Netherlands)

    Joosten, Reinoud A.M.G.; Roorda, Berend


    We introduce the ray-projection dynamics in evolutionary game theory by employing a ray projection of the relative fitness (vector) function, i.e., a projection unto the unit simplex along a ray through the origin. Ray-projection dynamics are weakly compatible in the terminology of Friedman

  13. X-Ray Exam: Cervical Spine (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Cervical Spine KidsHealth / For Parents / X-Ray ... MRI): Lumbar Spine Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  14. X-Ray Exam: Neck (For Parents) (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Neck KidsHealth / For Parents / X-Ray Exam: ... Neck Enlarged Adenoids Croup Sinusitis Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  15. Extragalactic Gamma-Ray Astrophysics

    CERN Multimedia

    CERN. Geneva


    During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...

  16. Stellar X-ray sources

    International Nuclear Information System (INIS)

    Katz, J.I.; Washington Univ., St. Louis, MO


    I Review some of the salient accomplishments of X-rap studies of compact objects. Progress in this field has closely followed the improvement of observational methods, particularly in angular resolution and duration of exposure. Luminous compact X-ray sources are accreting neutron stars or black holes. Accreting neutron stars may have characteristic temporal signatures, but the only way to establish that an X-ray source is a black hole is to measure its mass. A rough phenomenological theory is succesful, but the transport of angular momentum in accretion flows is not onderstood. A number of interesting complications have been observed, including precessing accretion discs, X-ray bursts, and the acceleration of jets in SS433. Many puzzles remain unsolved, including the excitation of disc precession, the nature of the enigmatic A- and gamma-ray source Cyg X-3, the mechanism by which slowly spinning accreting neutron stars lose angular momentum, and the superabundance of X-ray sources in globular clusters. 41 refs.; 5 figs

  17. Optical observations of Gamma-Ray Bursts

    International Nuclear Information System (INIS)

    Hjorth, J.; Pian, E.; Fynbo, J.P.U.


    We briefly review the status and recent progress in the field of optical observations of gamma-ray burst afterglows. We will focus on the fundamental observational evidence for the relationship between gamma-ray bursts and the final evolutionary phases of massive stars. In particular, we will address (i) gamma-ray burst host galaxies, (ii) optically dark gamma-ray burst afterglows, (iii) the gamma-ray burst-supernova connection, and (iv) the relation between X-ray flashes, gamma-ray bursts, and supernovae

  18. X-ray cardiovascular examination apparatus

    International Nuclear Information System (INIS)


    An X-ray source is mounted in an enclosure for angulating longitudinally about a horizontal axis. An X-ray-permeable, patient-supporting table is mounted on the top of the enclosure for executing lateral and longitudinal movements. An X-ray image-receiving device such as an X-ray image intensifier is mounted above the table on a vertically movable arm which is on a longitudinally movable carriage. Electric control means are provided for angulating the X-ray source and image intensifier synchronously as the image intensifier system is shifted longitudinally or vertically such that the central ray from the X-ray source is kept intensifier

  19. Ultra high energy gamma-ray astronomy

    International Nuclear Information System (INIS)

    Wdowczyk, J.


    The experimental data on ultra high energy γ-rays are reviewed and a comparison of the properties of photon and proton initiated shower is made. The consequences of the existence of the strong ultra high energy γ-ray sources for other observations is analysed and possible mechanisms for the production of ultra high energy γ-rays in the sources are discussed. It is demonstrated that if the γ-rays are produced via cosmic ray interactions the sources have to produce very high fluxes of cosmic ray particles. In fact it is possible that a small number of such sources can supply the whole Galactic cosmic ray flux

  20. Illumination system for X-ray lithography

    International Nuclear Information System (INIS)

    Buckley, W.D.


    An X-ray lithography system is described, comprising: a point source of X-Ray radiation; a wafer plane disposed in spaced relation to the point source of X-Ray radiation; a mask disposed between the point source of X-Ray radiation and the wafer plane whereby X-Ray radiation from the point source of X-ray radiation passes through the mask to the water plane; and X-Ray absorbent means mounted between the point source of X-Ray radiation and the wafer plane, the X-Ray absorbent means being of quadratically absorption from maximum absorption at the center to minimum absorption at the edge so as to have a radial absorption gradient profile to compensate for radial flux variation of the X-Ray radiation

  1. Transmission X-ray mirror

    International Nuclear Information System (INIS)

    Lairson, B.M.; Bilderback, D.H.


    Transmission X-ray mirrors have been made from 400 A to 10 000 A thick soap films and have been shown to have novel properties. Using grazing angles of incidence, low energy X-rays were reflected from the front surface while more energetic X-rays were transmitted through the mirror largely unattenuated. A wide bandpass monochromator was made from a silicon carbide mirror followed by a soap film transmission mirror and operated in the white beam at the cornell High Energy Synchrotron Source (CHESS). Bandpasses of ΔE/E=12% to 18% were achieved at 13 keV with peak efficiencies estimated to be between 55% and 75%, respectively. Several wide angle scattering photographs of stretched polyethylene and a phospholipid were obtained in 10 s using an 18% bandpass. (orig.)

  2. Aerosols Produced by Cosmic Rays

    DEFF Research Database (Denmark)

    Enghoff, Martin Andreas Bødker

    an experiment in order to investigate the underlying microphysical processes. The results of this experiment will help to understand whether ionization from cosmic rays, and by implication the related processes in the universe, has a direct influence on Earth’s atmosphere and climate. Since any physical...... mechanism linking cosmic rays to clouds and climate is currently speculative, there have been various suggestions of the role atmospheric ions may play; these involve any one of a number of processes from the nucleation of aerosols up to the collection processes of cloud droplets. We have chosen to start......Satellite observations have shown that the Earth’s cloud cover is strongly correlated with the galactic cosmic ray flux. While this correlation is indicative of a possible physical connection, there is currently no confirmation that a physical mechanism exists. We are therefore setting up...

  3. Cosmic rays, clouds, and climate

    DEFF Research Database (Denmark)

    Marsh, N.; Svensmark, Henrik


    cloud radiative properties. Thus, a moderate influence on atmospheric aerosol distributions from cosmic ray ionisation would have a strong influence on the Earth's radiation budget. Historical evidence over the past 1000 years indicates that changes in climate have occurred in accord with variability......A correlation between a global average of low cloud cover and the flux of cosmic rays incident in the atmosphere has been observed during the last solar cycle. The ionising potential of Earth bound cosmic rays are modulated by the state of the heliosphere, while clouds play an important role...... in the Earth's radiation budget through trapping outgoing radiation and reflecting incoming radiation. If a physical link between these two features can be established, it would provide a mechanism linking solar activity and Earth's climate. Recent satellite observations have further revealed a correlation...

  4. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.


    Intra-oral X-ray apparatus which reduces the number of exposures necessary to obtain panoramic dental radiographs is described in detail. It comprises an electron gun, a tubular target carrier projecting from the gun along the beam axis and carrying at its distal end a target surrounded by a shield of X-ray opaque material. This shield extends forward and laterally of the target and has surfaces which define a wedge or cone-shaped radiation pattern delimited vertically by the root tips of the patient's teeth. A film holder is located externally of the patient's mouth. A disposable member can fit on the target carrier to depress the patient's tongue out of the radiation pattern and to further shield the roof of the mouth. The electron beam can be magnetically deflected to change the X-ray beam direction. (author)

  5. Exponential x-ray transform

    International Nuclear Information System (INIS)

    Hazou, I.A.


    In emission computed tomography one wants to determine the location and intensity of radiation emitted by sources in the presence of an attenuating medium. If the attenuation is known everywhere and equals a constant α in a convex neighborhood of the support of f, then the problem reduces to that of inverting the exponential x-ray transform P/sub α/. The exponential x-ray transform P/sub μ/ with the attenuation μ variable, is of interest mathematically. For the exponential x-ray transform in two dimensions, it is shown that for a large class of approximate δ functions E, convolution kernels K exist for use in the convolution backprojection algorithm. For the case where the attenuation is constant, exact formulas are derived for calculating the convolution kernels from radial point spread functions. From these an exact inversion formula for the constantly attenuated transform is obtained

  6. Terrestrial gamma-ray flashes (United States)

    Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo


    Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models.

  7. Terrestrial gamma-ray flashes

    International Nuclear Information System (INIS)

    Marisaldi, Martino; Fuschino, Fabio; Labanti, Claudio; Tavani, Marco; Argan, Andrea; Del Monte, Ettore; Longo, Francesco; Barbiellini, Guido; Giuliani, Andrea; Trois, Alessio; Bulgarelli, Andrea; Gianotti, Fulvio; Trifoglio, Massimo


    Lightning and thunderstorm systems in general have been recently recognized as powerful particle accelerators, capable of producing electrons, positrons, gamma-rays and neutrons with energies as high as several tens of MeV. In fact, these natural systems turn out to be the highest energy and most efficient natural particle accelerators on Earth. Terrestrial Gamma-ray Flashes (TGFs) are millisecond long, very intense bursts of gamma-rays and are one of the most intriguing manifestation of these natural accelerators. Only three currently operative missions are capable of detecting TGFs from space: the RHESSI, Fermi and AGILE satellites. In this paper we review the characteristics of TGFs, including energy spectrum, timing structure, beam geometry and correlation with lightning, and the basic principles of the associated production models. Then we focus on the recent AGILE discoveries concerning the high energy extension of the TGF spectrum up to 100 MeV, which is difficult to reconcile with current theoretical models

  8. X-ray of osteopathies

    International Nuclear Information System (INIS)

    Freyschmidt, J.


    Osteoporosis, osteomalcia, fibro-osteoclasia and osteosclerosis are essential reactions to pathologicometabolic processes of the bone. The X-ray film shows precisely which changes have taken place in the bone structure, thus supplying the means for an analysis based on anatomic pathology. These phenomena are discussed in detail, special attention being paid to structural modifications. Attention is also focused on the problems connected with X-ray technology. The value of direct and indirect magnification of the skeleton of the hand for the identification and classification of esteopathies is explained. Phenomena observed in X-ray films, such as enosteal erosion, intracortical longitudinal stripes or tunnelisation, as well as subperiostal absorption, can be of pathognomonic importance for certain osteopathies. (orig.) [de

  9. Imaging X-ray astronomy

    International Nuclear Information System (INIS)

    Elvis, M.


    The launch of the High Energy Astrophysical Observatory, more appealingly called the Einstein Observatory, marked one of the most revolutionary steps taken in astrophysics this century. Its greater sensitivity compared with earlier satellites and its ability to make high spacial and spectral resolution observations transformed X-ray astronomy. This book is based on a Symposium held in Cambridge, Massachusetts, to celebrate a decade of Einstein Observatory's achievements. It discusses the contributions that this satellite has made to each area of modern astrophysics and the diversity of the ongoing work based on Einstein data. There is a guide to each of the main data bases now coming on-line to increase the availability and to preserve this valuable archive for the future. A review of NASA's next big X-ray mission, AXAF, and a visionary program for novel X-ray astronomy satellites by Riccardo Giacconi conclude this wide-ranging volume. (author)

  10. Cosmic Ray Energetics and Mass

    CERN Multimedia

    Baylon cardiel, J L; Wallace, K C; Anderson, T B; Copley, M

    The cosmic-ray energetics and mass (CREAM) investigation is designed to measure cosmic-ray composition to the supernova energy scale of 10$^{15}$ eV in a series of ultra long duration balloon (ULDB) flights. The first flight is planned to be launched from Antarctica in December 2004. The goal is to observe cosmic-ray spectral features and/or abundance changes that might signify a limit to supernova acceleration. The particle ($\\{Z}$) measurements will be made with a timing-based charge detector and a pixelated silicon charge detector to minimize the effect of backscatter from the calorimeter. The particle energy measurements will be made with a transition radiation detector (TRD) for $\\{Z}$ > 3 and a sampling tungsten/scintillator calorimeter for $\\{Z}$ $\\geq$1 particles, allowing inflight cross calibration of the two detectors. The status of the payload construction and flight preparation are reported in this paper.

  11. Interpreting the cosmic ray composition

    International Nuclear Information System (INIS)

    O'C Drury, L.; Ellisson, D.C; Meyer, J.-P.


    The detailed pattern of elemental abundances in the Galactic Cosmic Rays is well determined at energies of a few GeV per nucleon. After correction for propagation effects the inferred source composition shows significant deviations from the standard pattern of Galactic elemental abundances. These deviations, surprisingly overabundances of the heavy elements relative to Hydrogen, are clearly a significant clue to the origin of the cosmic rays, but one which has proven very difficult to interpret. We have recently shown that the 'standard' model for the origin of the bulk of the Galactic cosmic rays, namely acceleration by the diffusive shock acceleration process at the strong shocks associated with supernova remnants, can quantitatively explain all features of the source composition if the acceleration occurs from a dusty interstellar medium. This success must be regarded as one of the stronger pieces of evidence in favour of the standard model

  12. Interpreting the cosmic ray composition

    Energy Technology Data Exchange (ETDEWEB)

    O' C Drury, L.; Ellisson, D.C; Meyer, J.-P


    The detailed pattern of elemental abundances in the Galactic Cosmic Rays is well determined at energies of a few GeV per nucleon. After correction for propagation effects the inferred source composition shows significant deviations from the standard pattern of Galactic elemental abundances. These deviations, surprisingly overabundances of the heavy elements relative to Hydrogen, are clearly a significant clue to the origin of the cosmic rays, but one which has proven very difficult to interpret. We have recently shown that the 'standard' model for the origin of the bulk of the Galactic cosmic rays, namely acceleration by the diffusive shock acceleration process at the strong shocks associated with supernova remnants, can quantitatively explain all features of the source composition if the acceleration occurs from a dusty interstellar medium. This success must be regarded as one of the stronger pieces of evidence in favour of the standard model.

  13. Solar X-ray bursts

    International Nuclear Information System (INIS)

    Urnov, A.M.


    In the popular form the consideration is given to the modern state tasks and results of X-ray spectrometry of solar bursts. The operation of X-ray spectroheliograph is described. Results of spectral and polarization measurings of X-ray radiation of one powerful solar burst are presented. The conclusion has been drawn that in the process of burst development three characteristic stages may be distingwished: 1) the initial phase; just in this period processes which lead to observed consequences-electromagnetic and corpuscular radiation are born; 2) the impulse phase, or the phase of maximum, is characterised by sharp increase of radiation flux. During this phase the main energy content emanates and some volumes of plasma warm up to high temperatures; 3) the phase of burst damping, during which plasma cools and reverts to the initial condition

  14. X-ray fluorescence holography. (United States)

    Hayashi, Kouichi; Happo, Naohisa; Hosokawa, Shinya; Hu, Wen; Matsushita, Tomohiro


    X-ray fluorescence holography (XFH) is a method of atomic resolution holography which utilizes fluorescing atoms as a wave source or a monitor of the interference field within a crystal sample. It provides three-dimensional atomic images around a specified element and has a range of up to a few nm in real space. Because of this feature, XFH is expected to be used for medium-range local structural analysis, which cannot be performed by x-ray diffraction or x-ray absorption fine structure analysis. In this article, we explain the theory of XFH including solutions to the twin-image problem, an advanced measuring system, and data processing for the reconstruction of atomic images. Then, we briefly introduce our recent applications of this technique to the analysis of local lattice distortions in mixed crystals and nanometer-size clusters appearing in the low-temperature phase of a shape-memory alloy.

  15. X-ray fluorescence holography

    International Nuclear Information System (INIS)

    Hayashi, Kouichi; Happo, Naohisa; Hosokawa, Shinya; Hu Wen; Matsushita, Tomohiro


    X-ray fluorescence holography (XFH) is a method of atomic resolution holography which utilizes fluorescing atoms as a wave source or a monitor of the interference field within a crystal sample. It provides three-dimensional atomic images around a specified element and has a range of up to a few nm in real space. Because of this feature, XFH is expected to be used for medium-range local structural analysis, which cannot be performed by x-ray diffraction or x-ray absorption fine structure analysis. In this article, we explain the theory of XFH including solutions to the twin-image problem, an advanced measuring system, and data processing for the reconstruction of atomic images. Then, we briefly introduce our recent applications of this technique to the analysis of local lattice distortions in mixed crystals and nanometer-size clusters appearing in the low-temperature phase of a shape-memory alloy. (topical review)

  16. X-ray hot plasma diagnostics

    International Nuclear Information System (INIS)

    Cojocaru, E.


    X-ray plasma emission study is powerful diagnostic tool of hot plasmas. In this review article the main techniques of X-ray plasma emission measurement are shortly presented: X-ray spectrometry using absorbent filters, crystal and grating spectrometers, imaging techniques using pinhole cameras, X-ray microscopes and Fresnel zone plate cameras, X-ray plasma emission calorimetry. Advances in these techniques with examples for different hot plasma devices are also presentes. (author)

  17. Overutilization of x-rays

    International Nuclear Information System (INIS)

    Abrams, H.L.


    In this article on the overutilization of x-rays the author defines the term overutilization as excessive irradiation per unit of diagnostic information, therapeutic impact, or health outcome. Three main factors are described which lead to overutilization of x-rays: excessive radiation per film; excessive films per examination; and excessive examinations per patient. Topics discussed which influence the excessive examinations per patient are: the physician's lack of knowledge; undue dependence; lack of screening by radiologists; the physician's need for action and certainty; patient demand; reimbursement policies; institutional requirements; preventive medicine; defensive medicine; and the practice of radiology by nonradiologists

  18. Gamma-ray burst spectra

    International Nuclear Information System (INIS)

    Teegarden, B.J.


    A review of recent results in gamma-ray burst spectroscopy is given. Particular attention is paid to the recent discovery of emission and absorption features in the burst spectra. These lines represent the strongest evidence to date that gamma-ray bursts originate on or near neutron stars. Line parameters give information on the temperature, magnetic field and possibly the gravitational potential of the neutron star. The behavior of the continuum spectrum is also discussed. A remarkably good fit to nearly all bursts is obtained with a thermal-bremsstrahlung-like continuum. Significant evolution is observed of both the continuum and line features within most events

  19. Multichannel X-ray detectors

    Energy Technology Data Exchange (ETDEWEB)

    Khabakhpashev, A


    A typical design is discussed of multiwire proportional counters and their characteristic feature is explained, ie., the possibility of showing one or two coordinates of the X-ray quantum absorption site. The advantages of such instruments are listed, such as increased sensitivity of determination, the possibility of recording radiations of a different intensity, the possibility of on-line data processing and of the digital display of results. The fields of application include X-ray structural analysis in solid state physics, crystallography, molecular biology, astronomy, materials testing, and medicine.

  20. Semiconductor X-ray spectrometers

    International Nuclear Information System (INIS)

    Muggleton, A.H.F.


    An outline is given of recent developments in particle and photon induced x-ray fluorescence (XRF) analysis. Following a brief description of the basic mechanism of semiconductor detector operation a comparison is made between semiconductor detectors, scintillators and gas filled proportional devices. Detector fabrication and cryostat design are described in more detail and the effects of various device parameters on system performance, such as energy resolution, count rate capability, efficiency, microphony, etc. are discussed. The main applications of these detectors in x-ray fluorescence analysis, electron microprobe analysis, medical and pollution studies are reviewed

  1. Portable X-Ray Device (United States)


    Portable x-ray instrument developed by NASA now being produced commercially as an industrial tool may soon find further utility as a medical system. The instrument is Lixiscope - Low Intensity X-Ray Imaging Scope -- a self-contained, battery-powered fluoroscope that produces an instant image through use of a small amount of radioactive isotope. Originally developed by Goddard Space Flight Center, Lixiscope is now being produced by Lixi, Inc. which has an exclusive NASA license for one version of the device.

  2. Airborne gamma-ray spectrometry

    DEFF Research Database (Denmark)

    Hovgaard, Jens

    A new method - Noise Adjusted Singular Value Decomposition, NASVD - for processing gamma-ray spectra has been developed as part of a Ph.D. project. By using this technique one is able to decompose a large set of data - for example from airborne gamma-ray surveys - into a few spectral components....... By knowing the spectral components and their amplitudes in each of the measured spectra one is able to extract more information from the data than possible with the methods used otherwise....

  3. High energy cosmic ray astronomy

    International Nuclear Information System (INIS)

    Fonseca, V.


    A brief introduction to High Energy Cosmic Ray Astronomy is presented. This field covers a 17 decade energy range (2.10 4 -10 20 ) eV. Recent discoveries done with gamma-ray detectors on-board satellites and ground-based Cherenkov devices are pushing for a fast development of new and innovative techniques, specially in the low energy region which includes the overlapping of satellite and ground-based measurements in the yet unexplored energy range 20 keV-250 GeV. Detection of unexpected extremely high energy events have triggered the interest of the international scientific community. (orig.)

  4. X-ray tube targets

    International Nuclear Information System (INIS)

    Hirsch, H.H.


    In rotary targets for X-ray tubes warping is a problem which causes X-ray deficiency. A rotary target is described in which warping is reduced by using alloys of molybdenum with 0.05 to 10% iron, silicon, cobalt, tantalum, niobium, hafnium, stable metal oxide or mixture thereof. Suitable mixtures are 0.5 to 10% of tantalum, niobium or hafnium with from 0.5 to 5% yttrium oxide, or 0.05 to 0.3% of cobalt or silicon. Optionally 0.1 to 5% by weight of additional material may be alloyed with the molybdenum, such as tantalum or hafnium carbides. (author)

  5. Gamma-ray Imaging Methods

    Energy Technology Data Exchange (ETDEWEB)

    Vetter, K; Mihailescu, L; Nelson, K; Valentine, J; Wright, D


    In this document we discuss specific implementations for gamma-ray imaging instruments including the principle of operation and describe systems which have been built and demonstrated as well as systems currently under development. There are several fundamentally different technologies each with specific operational requirements and performance trade offs. We provide an overview of the different gamma-ray imaging techniques and briefly discuss challenges and limitations associated with each modality (in the appendix we give detailed descriptions of specific implementations for many of these technologies). In Section 3 we summarize the performance and operational aspects in tabular form as an aid for comparing technologies and mapping technologies to potential applications.

  6. X-ray data processing. (United States)

    Powell, Harold R


    The method of molecular structure determination by X-ray crystallography is a little over a century old. The history is described briefly, along with developments in X-ray sources and detectors. The fundamental processes involved in measuring diffraction patterns on area detectors, i.e. autoindexing, refining crystal and detector parameters, integrating the reflections themselves and putting the resultant measurements on to a common scale are discussed, with particular reference to the most commonly used software in the field. © 2017 The Author(s).

  7. Ultra high energy cosmic rays

    International Nuclear Information System (INIS)

    Watson, A.A.


    Cosmic radiation was discovered 70 years ago but its origin remains an open question. The background to this problem is outlined and attempts to discover the origin of the most energetic and rarest group above 10 15 eV are described. Measurements of the energy spectrum and arrival direction pattern of the very highest energy particles, mean energy about 6 x 10 19 eV, are used to argue that these particles originate outside our galaxy. Recent evidence from the new field of ultra high energy γ-ray astronomy are discussed in the context of a galactic origin hypothesis for lower energy cosmic rays. (author)

  8. High-Resolution X-ray Emission and X-ray Absorption Spectroscopy

    NARCIS (Netherlands)

    Groot, F.M.F. de


    In this review, high-resolution X-ray emission and X-ray absorption spectroscopy will be discussed. The focus is on the 3d transition-metal systems. To understand high-resolution X-ray emission and reso-nant X-ray emission, it is first necessary to spend some time discussing the X-ray absorption

  9. X-ray fluorescence spectrometry

    International Nuclear Information System (INIS)

    Vries, J.L. de.


    The seventh edition of Philips' Review of Literature on x-ray fluorescence spectrometry starts with a list of conference proceedings on the subject, organised by the Philips organisation at regular intervals in various European countries. It is followed by a list of bulletins. The bibliography is subdivided according to spectra, equipment, applications and absorption analysis

  10. Stellar X-Ray Polarimetry (United States)

    Swank, J.


    Most of the stellar end-state black holes, pulsars, and white dwarfs that are X-ray sources should have polarized X-ray fluxes. The degree will depend on the relative contributions of the unresolved structures. Fluxes from accretion disks and accretion disk corona may be polarized by scattering. Beams and jets may have contributions of polarized emission in strong magnetic fields. The Gravity and Extreme Magnetism Small Explorer (GEMS) will study the effects on polarization of strong gravity of black holes and strong magnetism of neutron stars. Some part of the flux from compact stars accreting from companion stars has been reflected from the companion, its wind, or accretion streams. Polarization of this component is a potential tool for studying the structure of the gas in these binary systems. Polarization due to scattering can also be present in X-ray emission from white dwarf binaries and binary normal stars such as RS CVn stars and colliding wind sources like Eta Car. Normal late type stars may have polarized flux from coronal flares. But X-ray polarization sensitivity is not at the level needed for single early type stars.

  11. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z X-ray (Radiography) - Bone ...

  12. X-ray Sensitive Material (United States)


    TM 8772 5 Literature reports on BiI3/nylon composites used X-ray sources with a Mo target (Reference 18) or magnesium target (Reference 19). However...1981. Pp. D-155 to D-160. 22. G. Pretzsch, B. Dorschel, and T. Schonmuth. IEEE Transactions on Electrical Insulation, Vol. EI -21, No.3, June 1986

  13. X-ray system analysis

    International Nuclear Information System (INIS)

    Shapiro, J.S.


    An X-ray system tester for measuring anode voltage, cathode voltage, anode current, filament current and line voltage in an X-ray system has a selector which couples one of these analog signals or one of a plurality of processing control signals entered by an operator from a control panel to a digitizing section selectively in accordance with control signals provided to the selector by a computing section. The digitizing section converts the selected signal into a train of pulses having a frequency proportional to the value of the selected signal. These pulses are counted, the counts being used by the computing section to determine the value of the selected signal. This computed value is stored in a computing memory section of the computing section. The computing section is adapted to store a plurality of the sets of signals produced during a corresponding sequence of operational intervals of the X-ray system and determines a measure of the deviation of any selected one of the stored electrical signals over the sequence of operating intervals. Each signal produced during the sequential operational intervals can be recalled to aid analysis of the operation of the X-ray system. (author)

  14. Cosmic-ray sum rules

    International Nuclear Information System (INIS)

    Frandsen, Mads T.; Masina, Isabella; Sannino, Francesco


    We introduce new sum rules allowing to determine universal properties of the unknown component of the cosmic rays; we show how they can be used to predict the positron fraction at energies not yet explored by current experiments, and to constrain specific models.

  15. X-ray image coding

    International Nuclear Information System (INIS)


    The invention aims at decreasing the effect of stray radiation in X-ray images. This is achieved by putting a plate between source and object with parallel zones of alternating high and low absorption coefficients for X-radiation. The image is scanned with the help of electronic circuits which decode the signal space coded by the plate, thus removing the stray radiation

  16. X-ray simulation development

    International Nuclear Information System (INIS)

    Posey, L.D.; Tollefsrud, P.B.; Woodall, H.W.; McDaniel, D.H.; Allred, R.E.


    Design modifications are discussed for an electron beam accelerator used as a Bremsstrahlung x-ray source. The primary goal of the program, to obtain a reliable 5 cal/gm exposure capability, can be accomplished with beam compression by an external magnetic guide field. Initial operating characteristics and performance improvements are presented

  17. X-ray fluorescence spectrometry

    International Nuclear Information System (INIS)

    Ray, N.B.


    The principle, instrument and procedure of X-ray fluorescence spectrometry are described. It is a rapid, simple and sensitive method for the trace analysis of elements from sodium to uranium in powder, liquid or metal samples. (M.G.B.)

  18. X-rays from stars (United States)

    Güdel, Manuel


    Spectroscopic studies available from Chandra and XMM-Newton play a pivotal part in the understanding of the physical processes in stellar (magnetic and non-magnetic) atmospheres. It is now routinely possible to derive densities and to study the influence of ultraviolet radiation fields, both of which can be used to infer the geometry of the radiating sources. Line profiles provide important information on bulk mass motions and attenuation by neutral matter, e.g. in stellar winds. The increased sensitivity has revealed new types of X-ray sources in systems that were thought to be unlikely places for X-rays: flaring brown dwarfs, including rather old, non-accreting objects, and terminal shocks in jets of young stars are important examples. New clues concerning the role of stellar high-energy processes in the modification of the stellar environment (ionization, spallation, etc.) contribute significantly to our understanding of the "astro-ecology" in forming planetary systems. Technological limitations are evident. The spectral resolution has not reached the level where bulk mass motions in cool stars become easily measurable. Higher resolution would also be important to perform X-ray "Doppler imaging" in order to reconstruct the 3-D distribution of the X-ray sources around a rotating star. Higher sensitivity will be required to perform high-resolution spectroscopy of weak sources such as brown dwarfs or embedded pre-main-sequence sources. A new generation of satellites such as Constellation-X or XEUS should pursue these goals.

  19. Gamm-ray absorption techniques

    International Nuclear Information System (INIS)

    Charlton, J.S.


    In this chapter the principles of gamma-ray absorption are described and important applications in plant and process techniques such as measurement of thickness of deposits on pipes, checking for voids in concrete, metal corrosion, measurement of the density of materials inside vessels in industrial radiography are discussed. (U.K.)

  20. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... ray (Radiography) - Bone Sponsored by Please note is not a medical facility. Please contact your ... links: For the convenience of our users, RadiologyInfo .org provides links to relevant websites. , ACR ...

  1. Chandra's X-ray Vision

    Indian Academy of Sciences (India)


    Jul 23, 1999 ... CXO is 13.8 metres long and its solar arrays have a wingspan of. 19.5 metres as shown in ... the Universe (for example, coronae of stars, matter ejected from .... The telescope system and the scientific instruments were put through ..... solve the puzzle about the origin of cosmic X-ray background- one of the ...

  2. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician ... An x-ray (radiograph) is a noninvasive medical test that helps physicians diagnose and treat medical conditions. ...

  3. Solar-cosmic-ray variability

    International Nuclear Information System (INIS)

    Reedy, R.C.


    The maximum flux of particles from solar events that should be considered in designing the shielding for a space habitation is discussed. The activities of various radionuclides measured in the top few centimeters of lunar rocks are used to examine the variability of solar cosmic ray fluxes over the last five million years. 10 references

  4. X-rays and magnetism

    International Nuclear Information System (INIS)

    Fischer, Peter; Ohldag, Hendrik


    Magnetism is among the most active and attractive areas in modern solid state physics because of intriguing phenomena interesting to fundamental research and a manifold of technological applications. State-of-the-art synthesis of advanced magnetic materials, e.g. in hybrid structures paves the way to new functionalities. To characterize modern magnetic materials and the associated magnetic phenomena, polarized x-rays have emerged as unique probes due to their specific interaction with magnetic materials. A large variety of spectroscopic and microscopic techniques have been developed to quantify in an element, valence and site-sensitive way properties of ferro-, ferri-, and antiferromagnetic systems, such as spin and orbital moments, and to image nanoscale spin textures and their dynamics with sub-ns time and almost 10 nm spatial resolution. The enormous intensity of x-rays and their degree of coherence at next generation x-ray facilities will open the fsec time window to magnetic studies addressing fundamental time scales in magnetism with nanometer spatial resolution. This review will give an introduction into contemporary topics of nanoscale magnetic materials and provide an overview of analytical spectroscopy and microscopy tools based on x-ray dichroism effects. Selected examples of current research will demonstrate the potential and future directions of these techniques. (report on progress)

  5. Personnel monitoring for beta rays

    International Nuclear Information System (INIS)

    Piesch, E.; Johns, T.F.


    The practical considerations which have to be taken into account in the design of personnel monitors intended to measure doses resulting from exposure to beta rays are discussed. These include the measurement of doses in situations involving either fairly uniform or non-uniform irradiation and of doses to the male gonads. (UK)

  6. X-ray examination apparatus

    International Nuclear Information System (INIS)

    Bernstein, S.; Griswa, P.J.; Halter, P. Jr.; Kidd, H.J.


    Apparatus for x-ray cardiovascular examination and which can also be used for general purpose examination is described. An advantage of the system is that there is no mechanical connection between the image intensifier and source to interfere with the medical examiner or emergency procedures. (U.K.)

  7. X-ray tube transformer

    International Nuclear Information System (INIS)


    An X-ray generator is described which comprises a transmission line transformer including an electrical conductor with a cavity and a second electrical conductor including helical windings disposed along a longitudinal axis within the cavity of the first conductor. The windings have a pitch which varies per unit length along the axis. There is dielectric material in the cavity for insulation and to couple electromagnetically the two conductors in response to an electric current flowing through the conductors, which have an impedance between them; this varies with distance along the axis of the helix of the second conductor. An X-ray tube is disposed along the longitudinal axis within the cavity, for radiating X-rays. The invention increases the voltage of applied voltage pulses at the remote tube-head with a transformer formed by using a spiral delay line geometry to give a tapered-impedance coaxial high voltage multiplier for pulse voltage operation. This transformer is smaller and lighter than previous designs for the same high peak voltage and power ratings. This is important because the penetration capabilities of Flash X-ray equipment increase with voltage, particularly in heavy materials such as steel. (U.K.)

  8. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... of bone cancer . locate foreign objects in soft tissues around or in bones. top of page How should I prepare? Most ... absorb the x-rays in varying degrees. Dense bone absorbs much of the radiation while soft tissue, such as muscle, fat and organs, allow more ...

  9. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us ... the equipment look like? How does the procedure work? How is the procedure ... diagnose and treat medical conditions. Imaging with x-rays involves exposing a part ...

  10. Proton exciting X ray analysis

    International Nuclear Information System (INIS)

    Ma Xinpei


    The analyzing capability of proton exciting X ray analysis for different elements in organisms was discussed, and dealing with examples of trace element analysis in the human body and animal organisms, such as blood serum, urine, and hair. The sensitivity, accuracy, and capability of multielement analysis were discussed. Its strong points for the trace element analysis in biomedicine were explained

  11. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available ... over time. top of page What are the benefits vs. risks? Benefits Bone x-rays are the fastest and easiest ... cancer from excessive exposure to radiation. However, the benefit of an accurate diagnosis far outweighs the risk. ...

  12. Bone X-Ray (Radiography)

    Medline Plus

    Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z X-ray ( ...

  13. X-ray absorption holography

    Czech Academy of Sciences Publication Activity Database

    Kopecký, Miloš; Lausi, A.; Bussetto, E.; Kub, Jiří; Savoia, A.


    Roč. 88, č. 18 (2002), s. 185503-1 - 185503-3 ISSN 0031-9007 R&D Projects: GA MŠk LN00A100 Institutional research plan: CEZ:AV0Z1010921 Keywords : x-ray holography Subject RIV: BH - Optics, Masers, Lasers Impact factor: 7.323, year: 2002

  14. The Gamma-ray Sky with Fermi (United States)

    Thompson, David


    Gamma rays reveal extreme, nonthermal conditions in the Universe. The Fermi Gamma-ray Space Telescope has been exploring the gamma-ray sky for more than four years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge gamma-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.

  15. The Gamma-ray Universe through Fermi (United States)

    Thompson, David J.


    Gamma rays, the most powerful form of light, reveal extreme conditions in the Universe. The Fermi Gamma-ray Space Telescope and its smaller cousin AGILE have been exploring the gamma-ray sky for several years, enabling a search for powerful transients like gamma-ray bursts, novae, solar flares, and flaring active galactic nuclei, as well as long-term studies including pulsars, binary systems, supernova remnants, and searches for predicted sources of gamma rays such as dark matter annihilation. Some results include a stringent limit on Lorentz invariance derived from a gamma-ray burst, unexpected gamma-ray variability from the Crab Nebula, a huge ga.nuna-ray structure associated with the center of our galaxy, surprising behavior from some gamma-ray binary systems, and a possible constraint on some WIMP models for dark matter.

  16. Calculation of cosmic ray induced single event upsets: Program CRUP (Cosmic Ray Upset Program) (United States)

    Shapiro, P.


    This report documents PROGRAM CRUP, COSMIC RAY UPSET PROGRAM. The computer program calculates cosmic ray induced single-event error rates in microelectronic circuits exposed to several representative cosmic-ray environments.

  17. Relation between X-Ray and γ-Ray Emissions for Fermi Blazars ...

    Indian Academy of Sciences (India)

    Abstract. Using γ-ray band data detected by Fermi Large Area Tele- scope (LAT) and X-ray band data for 78 blazars, we find a medium cor- relation between X-ray and γ-ray fluxes in the average state. A medium anticorrelation is also found between X-ray (1 KeV) mean spectral index αx and γ-ray mean spectral index αγ for ...

  18. Center for X-Ray Optics, 1986

    International Nuclear Information System (INIS)


    The Center for X-Ray Optics has made substantial progress during the past year on the development of very high resolution x-ray technologies, the generation of coherent radiation at x-ray wavelengths, and, based on these new developments, had embarked on several scientific investigations that would not otherwise have been possible. The investigations covered in this report are topics on x-ray sources, x-ray imaging and applications, soft x-ray spectroscopy, synchrotron radiation, advanced light source and magnet structures for undulators and wigglers

  19. X-ray diagnostic in gas discharge

    International Nuclear Information System (INIS)

    Chen Suhe; Wang Dalun; Cui Gaoxian; Wang Mei; Fu Yibei; Zhang Xinwei; Zhang Wushou


    X rays were observed when the anomalous phenomenon in the metal loaded with deuterium studied by the gas-discharge method. Therefore the X-ray energy spectra were measured by the absorption method, the specific X-ray approach and the NaI scintillation counter, while X-ray intensity was estimated by using 7 Li thermoluminescent foils. The X-ray average energy measured by the absorption method is 27.6 +- 2.1 keV, which is fitted within the error extent to 26.0 +-2.4 keV monoenergetic X rays measured by the NaI scintillation counter

  20. Wide field X-ray telescopes: Detecting X-ray transients/afterglows related to gamma ray bursts

    International Nuclear Information System (INIS)

    Hudec, Rene; Pina, Ladislav; Inneman, Adolf; Gorenstein, Paul; Rezek, Tomas


    The recent discovery of X-ray afterglows of GRBs opens the possibility of analyses of GRBs by their X-ray detections. However, imaging X-ray telescopes in current use mostly have limited field of view. Alternative X-ray optics geometries achieving very large fields of view have been theoretically suggested in the 70ies but not constructed and used so far. We review the geometries and basic properties of the wide-field X-ray optical systems based on one- and two-dimensional lobster-eye geometry and suggest technologies for their development and construction. First results of the development of double replicated X-ray reflecting flats for use in one-dimensional X-ray optics of lobster eye type are presented and discussed. Optimum strategy for locating GRBs upon their X-ray counterparts is also presented and discussed

  1. Achromatic X-ray lenses

    International Nuclear Information System (INIS)

    Umbach, Marion


    This thesis presents first results on the development of achromatic refractive X-ray lenses which can be used for scientific experiments at synchrotron sources. First of all the different requirements for achromatic X-ray lenses have been worked out. There are different types of lenses, one type can be used for monochromatized sources when the energy is scanned while the spot size should be constant. The other type can be used at beamlines providing a broad energy band. By a combination of focusing and defocusing elements we have developed a lens system that strongly reduces the chromatic aberration of a refractive lens in a given energy range. The great challenge in the X-ray case - in contrast to the visible range - the complex refractive index, which is very similar for the possible materials in the X-ray spectrum. For precise studies a numerical code has been developed, which calculates the different rays on their way through the lenses to the detector plane via raytracing. In this numerical code the intensity distribution in the detector plane has been analyzed for a chromatic and the corresponding achromatic system. By optimization routines for the two different fields of applications specific parameter combinations were found. For the experimental verification an achromatic system has been developed, consisting of biconcave SU-8 lenses and biconvex Nickel Fresnel lenses. Their fabrication was based on the LIGA-process, including a further innovative development, namely the fabrication of two different materials on one wafer. In the experiment at the synchrotron source ANKA the energy was varied in a specific energy range in steps of 0.1 keV. The intensity distribution for the different energies was detected at a certain focal length. For the achromatic system a reduction of the chromatic aberration could be clearly shown. Achromatic refractive X-ray lenses, especially for the use at synchrotron sources, have not been developed so far. As a consequence of the

  2. X-ray electromagnetic application technology

    International Nuclear Information System (INIS)


    The investigating committee aimed at research on electromagnetic fields in functional devices and X-ray fibers for efficient coherent X-ray generation and their material science, high-precision manufacturing, particularly for X-ray electromagnetic application technology from January 2006 to December 2008. In this report, we describe our research results, in particular, on the topics of synchrotron radiation and free-electron laser, Saga Synchrotron Project, X-ray waveguides and waveguide-based lens-less hard-X-ray imaging, X-ray nanofocusing for capillaries and zone plates, dispersion characteristics in photonics crystal consisting of periodic atoms for nanometer waveguides, electromagnetic characteristics of grid structures for scattering fields of nano-meter electromagnetic waves and X-rays, FDTD parallel computing of fundamental scattering and attenuation characteristics of X-ray for medical imaging diagnosis, orthogonal relations of electromagnetic fields including evanescent field in dispersive medium. (author)

  3. Ray Tracing for Ocean Acoustic Tomography

    National Research Council Canada - National Science Library

    Dushaw, Brian


    .... The Numerical Recipes software package provided the basis for much of this computer code. The ray equations are reviewed, and ray equations that include the effects of ocean current are derived...

  4. Aspergillosis - chest x-ray (image) (United States)

    ... usually occurs in immunocompromised individuals. Here, a chest x-ray shows that the fungus has invaded the lung ... are usually seen as black areas on an x-ray. The cloudiness on the left side of this ...

  5. Soft x-ray Planetary Imager (United States)

    National Aeronautics and Space Administration — The project is to prototype a soft X-ray Imager for planetary applications that has the sensitivity to observe solar system sources of soft  X-ray emission. A strong...

  6. Stabilized x-ray generator power supply

    International Nuclear Information System (INIS)

    Saha, Subimal; Purushotham, K.V.; Bose, S.K.


    X-ray diffraction and X-ray fluorescence analysis are very much adopted in laboratories to determine the type and structure of the constituent compounds in solid materials, chemical composition of materials, stress developed on metals etc. These experiments need X-ray beam of fixed intensity and wave length. This can only be achieved by X-ray generator having highly stabilized tube voltage and tube current. This paper describes how X-ray tube high voltage and electron beam current are stabilized. This paper also highlights generation of X-rays, diffractometry and X-ray fluorescence analysis and their wide applications. Principle of operation for stabilizing the X-ray tube voltage and current, different protection circuits adopted, special features of the mains H.V. transformer and H.T. tank are described in this report. (author)

  7. Airborne gamma ray spectrometer surveying

    International Nuclear Information System (INIS)


    The International Atomic Energy Agency (IAEA) in its role as collector and disseminator of information on nuclear techniques has long had an interest in gamma ray spectrometer methods and has published a number of Technical Reports on various aspects of the subject. At an Advisory Group Meeting held in Vienna in November 1986 to review appropriate activities the IAEA could take following the Chernobyl accident, it was recommended that preparation begin on a new Technical Report on airborne gamma ray spectrometer surveying, taking into account the use of the technique for environmental monitoring as well as for nuclear emergency response requirements. Shortly thereafter the IAEA became the lead organization in the Radioelement Geochemical Mapping section of the International Geological Correlation Programme/United Nations Educational, Scientific and Cultural Organization (UNESCO) Project on International Geochemical Mapping. These two factors led to the preparation of the present Technical Report. 18 figs, 4 tabs

  8. Characterising CCDs with cosmic rays

    International Nuclear Information System (INIS)

    Fisher-Levine, M.; Nomerotski, A.


    The properties of cosmic ray muons make them a useful probe for measuring the properties of thick, fully depleted CCD sensors. The known energy deposition per unit length allows measurement of the gain of the sensor's amplifiers, whilst the straightness of the tracks allows for a crude assessment of the static lateral electric fields at the sensor's edges. The small volume in which the muons deposit their energy allows measurement of the contribution to the PSF from the diffusion of charge as it drifts across the sensor. In this work we present a validation of the cosmic ray gain measurement technique by comparing with radioisotope gain measurments, and calculate the charge diffusion coefficient for prototype LSST sensors

  9. Compton suppression gamma ray spectrometry

    International Nuclear Information System (INIS)

    Landsberger, S.; Iskander, F.Y.; Niset, M.; Heydorn, K.


    In the past decade there have been many studies to use Compton suppression methods in routine neutron activation analysis as well as in the traditional role of low level gamma ray counting of environmental samples. On a separate path there have been many new PC based software packages that have been developed to enhance photopeak fitting. Although the newer PC based algorithms have had significant improvements, they still suffer from being effectively used in weak gamma ray lines in natural samples or in neutron activated samples that have very high Compton backgrounds. We have completed a series of experiments to show the usefulness of Compton suppression. As well we have shown the pitfalls when using Compton suppression methods for high counting deadtimes as in the case of neutron activated samples. We have also investigated if counting statistics are the same both suppressed and normal modes. Results are presented in four separate experiments. (author)

  10. Galactic cosmic ray iron composition

    International Nuclear Information System (INIS)

    Scherzer, R.; Enge, W.; Beaujean, R.


    We have studied the isotopic compostition of galactic cosmic ray iron in the energy interval 500-750 MeV/nucleon with a visual track detector system consisting of nuclear emulsion and cellulose-nitrate platic. Stopping iron nuclei were identified from ionization - range measurements in the two detector parts. Cone lengths were measured in the plastic sheets and the residual ranges of the particles were measured in plastic and in emulsion. We have determined the mass of 17 iron nuclei with an uncertainty of about 0.3 amu. The isotopic composition at the detector level was found to be 52 Fe: 53 Fe: 54 Fe: 55 Fe: 56 Fe: 57 Fe: 58 Fe = 0:1: 4:3:8:1:0. These numbers are not in conflict with the assumption that the isotopic composition of cosmic ray iron at the source is similar to the solar system composition. (author)

  11. High-energy cosmic rays

    CERN Document Server

    Cronin, James Watson


    Recently two cosmic rays with energy in excess of 2 1020 eV have been recorded. These are some 108 times more energetic than the protons produced by accelerators on earth. There is no credible understanding of the mechanism of acceleration by known a Because of the short mean free path in the cosmic background radiation they must come from nearby distances on a cosmological scale (< 50 Mpc). Their magnetic rigidity suggests that they should point to their source. Lectures will cover the present available data on the highest energy cosmic rays, their detection, possible acceleration mechanisms, their propagation in the galaxy and in extra galactic space and design of new detectors where simulations of air show ers play an important role.

  12. X-ray tube arrangements

    International Nuclear Information System (INIS)

    Gillard, R.G.


    A technique for ensuring the rapid correction of both amplitude and offset errors in the deflectional movement of an electron beam along an X-ray emissive target is described. The movement is monitored at at least two positions during a sweep and differences, between the two movements and a desired movement, at these positions are combined in different proportions to produce a corrective servo signal. Such arrangements find application, for example, in computerised tomographic scanners. (author)

  13. Smart X-ray optics

    International Nuclear Information System (INIS)

    Michette, A G; Pfauntsch, S J; Sahraei, S; Shand, M; Morrison, G R; Hart, D; Vojnovic, B; Stevenson, T; Parkes, W; Dunare, C; Willingale, R; Feldman, C; Button, T; Zhang, D; Rodriguez-Sanmartin, D; Wang, H


    This paper describes reflective adaptive/active optics for applications including studies of biological radiation damage. The optics work on the polycapillary principle, but use arrays of channels in thin silicon. For optimum performance the x-rays should reflect once off a channel wall in each of two successive arrays. This reduces aberrations since then the Abbe sine condition is approximately satisfied. Adaptivity is achieved by flexing the arrays via piezo actuation, providing further aberration reduction and controllable focal length.

  14. Development of quantitative x-ray microtomography

    International Nuclear Information System (INIS)

    Deckman, H.W.; Dunsmuir, J.A.; D'Amico, K.L.; Ferguson, S.R.; Flannery, B.P.


    The authors have developed several x-ray microtomography systems which function as quantitative three dimensional x-ray microscopes. In this paper the authors describe the evolutionary path followed from making the first high resolution experimental microscopes to later generations which can be routinely used for investigating materials. Developing the instrumentation for reliable quantitative x-ray microscopy using synchrotron and laboratory based x-ray sources has led to other imaging modalities for obtaining temporal and spatial two dimensional information

  15. Gamma-Ray Astronomy Technology Needs (United States)

    Gehrels, N.; Cannizzo, J. K.


    In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.

  16. X-ray diagnostics - benefits and risks

    International Nuclear Information System (INIS)

    Bartholomaeus, Melanie


    The brochure on benefits and risks of X-ray diagnostics discusses the following issues: X radiation - a pioneering discovery and medical sensation, fundamentals of X radiation, frequency of X-ray examinations in Germany in relation to CT imaging, radiation doses resulting from X-ray diagnostics, benefits of X-ray diagnostics - indication and examples, risks - measures for radiation exposure reductions, avoidance of unnecessary examinations.

  17. X rays from radio binaries

    International Nuclear Information System (INIS)

    Apparao, K.M.V.


    Reference is made to the radio binary systems CC Cas, AR Lac, β Per (Algol), β Lyr, b Per and Cyg X-1. It is stated that a thermal interpretation of the radiation from Algol requires a much larger x-ray flux than the observed value of 3.8 x 10 -11 erg/cm 2 /sec/keV in the 2 to 6 keV energy range. Observations of some non-thermal flares, together with the small size of the radio source in Algol, indicate that the radio emission is non-thermal in nature. The radio emission is interpreted as synchrotron radiation and it is suggested that the observed x-ray emission is due to inverse Compton scattering of the light of the primary star by the radio electrons. The x-ray emission from other radio binaries is also calculated using this model. The energy for the radio electrons can arise from annihilation of magnetic lines connecting the binary stars, twisted by the rotation of the stars. (U.K.)

  18. Ray trajectories for Alcubierre spacetime

    International Nuclear Information System (INIS)

    Anderson, Tom H; Mackay, Tom G; Lakhtakia, Akhlesh


    The Alcubierre spacetime was simulated by means of a Tamm medium which is asymptotically identical to vacuum and has constitutive parameters which are continuous functions of the spatial coordinates. Accordingly, the Tamm medium is amenable to physical realization as a micro- or nanostructured metamaterial. A comprehensive characterization of ray trajectories in the Tamm medium was undertaken, within the geometric-optics regime. Propagation directions corresponding to evanescent waves were identified: these occur in the region of the Tamm medium which corresponds to the warp bubble of the Alcubierre spacetime, especially for directions perpendicular to the velocity of the warp bubble at high speeds of that bubble. Ray trajectories are acutely sensitive to the magnitude and direction of the warp bubble's velocity, but rather less sensitive to the thickness of the transition zone between the warp bubble and its background. In particular, for rays which travel in the same direction as the warp bubble, the latter acts as a focusing lens, most notably at high speeds

  19. X-ray area monitor

    International Nuclear Information System (INIS)

    Nintrakit, N.


    The X-ray area monitor is a nuclear electronic device that is essential in radiation protection in high radiation laboratories, e.g. in medical diagnosis using X-rays and in industrial X-radiography. Accidentally the level of X-radiator may arise above the safe permissible level and in such a case the alarm system of the area monitor will work and disconnect the ac power supply form the X-ray unit. Principally the device is a radiation counter using as radiation detector with high voltage supply variable form 200 to 2,000 volts. The maximum count rate of the scaler is 1.5 MHz and the total count is displayed on 4 digit LED's. A time base is used to control the counting time, the frequency multiplier, radiation safety limit, comparator and the radiation hazard warning signal. The reliability of the instrument is further enhanced through the addition of the random correction circuit, and it is applicable both in X- and γ -radiation

  20. Elemental composition of cosmic ray

    International Nuclear Information System (INIS)

    Yanagida, Shohei


    The report first summarizes some data that have been obtained so far from observation of isotopes and elements in cosmic rays in the low energy region. Then, objectives of studies planned to be carried out with Astromag are outlined and the number of incident particles expected to be measured by baloon observation is estimated. Heavy elements with atomic numbers of greater than 30 are considered to be formed through neutron absorption reactions by the s- or r-process. Observations show that products of the r-process is abundant in cosmic ray sources. The escape length depends on energy. In relation to this, it has been reported that the ratios Ar-Fe and Ca-Fe increase above 200 GeV-n while such a tendency is not observed for K, Sc, Ti or V. Thus, no satisfactory models are available at present which can fully explain the changes in the escape length. The ratio 3 He- 4 He in the range of 5 - 10 GeV-n is inconsistent with the general theory that interprets the escape length of heavy elements. Some models, including the supermetallicity model and Wolf Rayet theory, have been proposed to explain unusual ratios of isotopes in cosmic rays, but more measurements are required to verify them. It is expected that Astromag can serve to make observations that can clarify these points. (Nogami, K.)

  1. CAMAC gamma ray scanning system

    International Nuclear Information System (INIS)

    Moss, C.E.; Pratt, J.C.; Shunk, E.R.


    A flexible gamma-ray scanning system, based on a LeCroy 3500 multichannel analyzer and CAMAC modules, is described. The system is designed for making simultaneous passive and active scans of objects of interest to nuclear safeguards. The scanner is a stepping-motor-driven carriage; the detectors, a bismuth-germanate scintillator and a high-purity germanium detector. A total of sixteen peaks in the two detector-produced spectra can be integrated simultaneously, and any scan can be viewed during data acquisition. For active scanning, the 2615-keV gamma-ray line from a 232 U source and the 4439-keV gamma-ray line from 9 Be(α,n) 12 C were selected. The system can be easily reconfigured to accommodate up to seven detectors because it is based on CAMAC modules and FORTRAN. The system is designed for field use and is easily transported. Examples of passive and active scans are presented

  2. Cryotomography x-ray microscopy state (United States)

    Le Gros, Mark; Larabell, Carolyn A.


    An x-ray microscope stage enables alignment of a sample about a rotation axis to enable three dimensional tomographic imaging of the sample using an x-ray microscope. A heat exchanger assembly provides cooled gas to a sample during x-ray microscopic imaging.

  3. Multifrequency Observations of Gamma-Ray Burst


    Greiner, J.


    Neither a flaring nor a quiescent counterpart to a gamma-ray burst has yet been convincingly identified at any wavelength region. The present status of the search for counterparts of classical gamma-ray bursts is given. Particular emphasis is put on the search for flaring counterparts, i.e. emission during or shortly after the gamma-ray emission.

  4. Stellar Sources of Gamma-ray Bursts


    Luchkov, B. I.


    Correlation analysis of Swift gamma-ray burst coordinates and nearby star locations (catalog Gliese) reveals 4 coincidences with good angular accuracy. The random probability is 4\\times 10^{-5}, so evidencing that coincident stars are indeed gamma-ray burst sources. Some additional search of stellar gamma-ray bursts is discussed.

  5. Gamma ray astronomy from satellites and balloons

    International Nuclear Information System (INIS)

    Schoenfelder, V.


    A survey is given of gamma ray astronomy topics presented at the Cosmic Ray Conference. The major conclusions at the Cosmic Ray Conference in the field of gamma ray astronomy are given. (1) MeV-emission of gamma-ray bursts is a common feature. Variations in duration and energy spectra from burst to burst may explain the discrepancy between the measured log N - log S dependence and the observed isotropy of bursts. (2) The gamma-ray line at 1.809 MeV from Al(26) is the first detected line from a radioactive nucleosynthesis product. In order to understand its origin it will be necessary to measure its longitude distribution in the Milky Way. (3) The indications of a gamma-ray excess found from the direction of Loop I is consistent with the picture that the bulk of cosmic rays below 100 GeV is produced in galactic supernova remnants. (4) The interpretation of the large scale distribution of gamma rays in the Milky Way is controversial. At present an extragalactic origin of the cosmic ray nuclei in the GeV-range cannot be excluded from the gamma ray data. (5) The detection of MeV-emission from Cen A is a promising step towards the interesting field of extragalactic gamma ray astronomy

  6. Transient soft X-ray sources

    International Nuclear Information System (INIS)

    Hayakawa, S.; Murakami, T.; Nagase, F.; Tanaka, Y.; Yamashita, K.


    A rocket observation of cosmic soft X-rays suggests the existence of transient, recurrent soft X-ray sources which are found variable during the flight time of the rocket. Some of the soft X-ray sources thus far reported are considered to be of this time. These sources are listed and their positions are shown. (Auth.)

  7. Center for X-ray Optics, 1988

    International Nuclear Information System (INIS)


    This report briefly reviews the following topics: soft-x-ray imaging; reflective optics for hard x-rays; coherent XUV sources; spectroscopy with x-rays; detectors for coronary artery imaging; synchrotron-radiation optics; and support for the advanced light source

  8. X-Ray Exam: Femur (Upper Leg) (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Femur (Upper Leg) KidsHealth / For Parents / X- ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  9. X-Rays, Pregnancy and You (United States)

    ... Emitting Products and Procedures Medical Imaging Medical X-ray Imaging X-Rays, Pregnancy and You Share Tweet Linkedin Pin it ... the decision with your doctor. What Kind of X-Rays Can Affect the Unborn Child? During most x- ...

  10. Gamma-rays from deep inelastic collisions

    International Nuclear Information System (INIS)

    Stephens, F.S.


    My objective in this talk is to consider the question: 'What can be learned about deep inelastic collisions (DIC) from studying the associated gamma-rays'. First, I discuss the origin and nature of the gamma-rays from DIC, then the kinds of information gamma-ray spectra contain, and finally come to the combination of these two subjects. (orig./HSI)

  11. Automatic weld joint X-ray inspection

    International Nuclear Information System (INIS)

    Richter, H.U.; Linke, D.; Siems, K.D.; Kruse, H.; Schuetze, E.


    A gantry mounted robotic x-ray inspection unit has been developed for the series testing of small and medium sized welded components (pipe bends and nozzles). The unit features computer controlled positioning of the x-ray tube and x-ray image amplifier. Image quality classes 2 and even 1 could be achieved without difficulty. (author)

  12. Metamaterials for light rays: ray optics without wave-optical analog in the ray-optics limit

    International Nuclear Information System (INIS)

    Hamilton, Alasdair C; Courtial, Johannes


    Volumes of sub-wavelength electromagnetic elements can act like homogeneous materials: metamaterials. In analogy, sheets of optical elements such as prisms can act ray-optically like homogeneous sheet materials. In this sense, such sheets can be considered to be metamaterials for light rays (METATOYs). METATOYs realize new and unusual transformations of the directions of transmitted light rays. We study here, in the ray-optics and scalar-wave limits, the wave-optical analog of such transformations, and we show that such an analog does not always exist. Perhaps, this is the reason why many of the ray-optical possibilities offered by METATOYs have never before been considered.

  13. Ultra-high energy cosmic rays and prompt TeV gamma rays from ...

    Indian Academy of Sciences (India)

    physics pp. 789-792. Ultra-high energy cosmic rays and prompt. TeV gamma rays from gamma ray bursts ... The origin of the observed ultra-high energy cosmic ray (UHECR) events with ... are proton and electron rest mass, respectively.

  14. Phase-contrast X-ray imaging using an X-ray interferometer for biological imaging

    Energy Technology Data Exchange (ETDEWEB)

    Momose, Atsushi; Koyama, Ichiro [Tokyo Univ., Dept. of Applied Physics, Tokyo (Japan); Takeda, Tohoru; Itai, Yuji [Tsukuba Univ., Inst. of Clinical Medicine, Tsukuba, Ibaraki (Japan); Yoneyama, Akio [Hitachi Ltd., Advanced Research Laboratory, Saitama (Japan)


    The potential of phase-contrast X-ray imaging using an X-ray interferometer is discussed comparing with other phase-contrast X-ray imaging methods, and its principle of contrast generation is presented including the case of phase-contrast X-ray computed tomography. The status of current instrumentation is described and perspectives for practical applications are discussed. (author)

  15. Method for spatially modulating X-ray pulses using MEMS-based X-ray optics (United States)

    Lopez, Daniel; Shenoy, Gopal; Wang, Jin; Walko, Donald A.; Jung, Il-Woong; Mukhopadhyay, Deepkishore


    A method and apparatus are provided for spatially modulating X-rays or X-ray pulses using microelectromechanical systems (MEMS) based X-ray optics. A torsionally-oscillating MEMS micromirror and a method of leveraging the grazing-angle reflection property are provided to modulate X-ray pulses with a high-degree of controllability.

  16. X-ray geometrical smoothing effect in indirect x-ray-drive implosion

    International Nuclear Information System (INIS)

    Mochizuki, Takayasu; Sakabe, Shuji; Yamanaka, Chiyoe


    X-ray geometrical smoothing effect in indirect X-ray drive pellet implosion for inertial confinement fusion has been numerically analyzed. Attainable X-ray driven ablation pressure has been found to be coupled with X-ray irradiation uniformity. (author)

  17. X-ray diffraction device comprising cooling medium connections provided on the x-ray tube

    NARCIS (Netherlands)


    An X-ray diffraction device comprises a water-cooled X-ray tube which exhibits a line focus as well as, after rotation through 90 DEG , a point focus. Contrary to customary X-ray tubes, the cooling water is not supplied via the housing (12) in which the X-ray tube is mounted, but the cooling water

  18. Miniature x-ray point source for alignment and calibration of x-ray optics

    International Nuclear Information System (INIS)

    Price, R.H.; Boyle, M.J.; Glaros, S.S.


    A miniature x-ray point source of high brightness similar to that of Rovinsky, et al. is described. One version of the x-ray source is used to align the x-ray optics on the Argus and Shiva laser systems. A second version is used to determine the spatial and spectral transmission functions of the x-ray optics. The spatial and spectral characteristics of the x-ray emission from the x-ray point source are described. The physical constraints including size, intensity and thermal limitations, and useful lifetime are discussed. The alignment and calibration techniques for various x-ray optics and detector combinations are described

  19. Relativistic motion in gamma-ray bursts

    International Nuclear Information System (INIS)

    Krolik, J.H.; Pier, E.A.


    Three fundamental problems affect models of gamma-ray bursts, i.e., the energy source, the ability of high-energy photons to escape the radiation region, and the comparative weakness of X-ray emission. It is indicated that relativistic bulk motion of the gamma-ray-emitting plasma generically provides a solution to all three of these problems. Results show that, if the plasma that produces gamma-ray bursts has a bulk relativistic velocity with Lorentz factor gamma of about 10, several of the most troubling problems having to do with gamma-ray bursts are solved. 42 refs



    Rade R. Babic


    After professor Wilhelm Konrad Röntgen published his study of an x-ray discovery (Academy Bulletin, Berlin, 08. 11. 1895.), Nikola Tesla published his first study of an x-ray on the 11th of March in 1896. (X-ray, Electrical Review). Until the 11th of August in 1897 he had published ten studies on this subject. All Tesla,s x-ray studies were experimental, which is specific to his work. Studying the nature of the x-ray, he established a new medical branch-radiology. He wrote:” There’s no doubt...

  1. Einstein pictures the x-ray sky

    International Nuclear Information System (INIS)

    Hartline, B.K.


    The second High Energy Astronomy Observatory (HEAO-2, Einstein) is revolutionizing x-ray astronomy just as its namesake revolutionized physics. Earlier x-ray observatories, including HEAO-1, were designed to scan the sky for x-ray emitters. With Einstein, the challenge has shifted from discovering x-ray sources to understanding the processes producing the x-rays. But having 500 times the sensitivity of previous detectors, Einstein makes more than its share of discoveries, too. For example, it sees distant quasars and clusters of galaxies that can barely be detected by the largest optical telescopes

  2. Propagation of ultrahigh-energy cosmic rays

    Energy Technology Data Exchange (ETDEWEB)

    Stanev, Todor [Bartol Research Institute and Department of Physics and Astronomy, University of Delaware, Newark, DE 19716 (United States)], E-mail:


    We briefly describe the energy loss processes of ultrahigh-energy protons, heavier nuclei and {gamma}-rays in interactions with the universal photon fields of the Universe. We then discuss the modification of the accelerated cosmic-ray energy spectrum in propagation by the energy loss processes and the charged cosmic-ray scattering in the extragalactic magnetic fields. The energy lost by the ultrahigh-energy cosmic rays goes into {gamma}-rays and neutrinos that carry additional information about the sources of highest energy particles. The new experimental results of the HiRes and the Auger collaborations are discussed in view of the predictions from propagation calculations.

  3. Picosecond x-ray streak camera studies

    International Nuclear Information System (INIS)

    Kasyanov, Yu.S.; Malyutin, A.A.; Richardson, M.C.; Chevokin, V.K.


    Some initial results of direct measurement of picosecond x-ray emission from laser-produced plasmas are presented. A PIM-UMI 93 image converter tube, incorporating an x-ray sensitive photocathode, linear deflection, and three stages of image amplification was used to analyse the x-ray radiation emanating from plasmas produced from solid Ti targets by single high-intensity picosecond laser pulses. From such plasmas, the x-ray emission typically persisted for times of 60psec. However, it is shown that this detection system should be capable of resolving x-ray phenomena of much shorter duration. (author)

  4. Si(Li) X-ray detector

    International Nuclear Information System (INIS)

    Yuan Xianglin; Li Zhiyong; Hong Xiuse


    The fabrication technology of the 10∼80 mm 2 Si(Li) X-ray detectors are described and some problems concerning technology and measurement are discussed. The specifications of the detectors are shown as well. The Si(Li) X-ray detector is a kind of low energy X-ray detectors. Owing to very high energy resolution, fine linearity and high detection efficiency in the range of low energy X-rays, it is widely used in the fields of nuclear physics, medicine, geology and environmental protection, etc,. It is also a kernel component for the scanning electron microscope and X-ray fluorescence analysis systems

  5. Inverse Compton gamma-rays from pulsars

    International Nuclear Information System (INIS)

    Morini, M.


    A model is proposed for pulsar optical and gamma-ray emission where relativistic electrons beams: (i) scatter the blackbody photons from the polar cap surface giving inverse Compton gamma-rays and (ii) produce synchrotron optical photons in the light cylinder region which are then inverse Compton scattered giving other gamma-rays. The model is applied to the Vela pulsar, explaining the first gamma-ray pulse by inverse Compton scattering of synchrotron photons near the light cylinder and the second gamma-ray pulse partly by inverse Compton scattering of synchrotron photons and partly by inverse Compton scattering of the thermal blackbody photons near the star surface. (author)

  6. Remote planetary geochemical exploration with the NEAR X-ray/gamma-ray spectrometer

    International Nuclear Information System (INIS)

    Trombka, J.I.; Boynton, W.V.; Brueckner, J.; Squyres, S.; Clark, P.E.; Starr, R.; Evans, L.G.; Floyd, S.R.; McClanahan, T.P.; Goldsten, J.; Mcnutt, R.; Schweitzer, J.S.


    The X-ray/gamma-ray spectrometer (XGRS) instrument onboard the Near Earth Asteroid Rendezvous (NEAR) spacecraft will map asteroid 433 Eros in the 0.2 keV to 10 MeV energy region. Measurements of the discrete line X-ray and gamma-ray emissions in this energy domain can be used to obtain both qualitative and quantitative elemental composition maps of the asteroid surface. The NEAR X-ray/gamma-ray spectrometer (XGRS) was turned on for the first time during the week of 7 April 1996. Rendezvous with Eros 433 is expected during December 1998. Observations of solar X-ray spectra during both quiescent and active periods have been made. A gamma-ray transient detection system has been implemented and about three gamma-ray transient events a week have been observed which are associated with either gamma-ray bursts or solar flares

  7. High-speed X-ray topography

    International Nuclear Information System (INIS)

    Eckers, W.; Oppolzer, H.


    The investigation of lattice defects in semiconductor crystals by conventional X-ray diffraction topography is very time-consuming. Exposure times can be reduced by using high-intensity X-rays and X-ray image intensifiers. The described system comprises a high-power rotating-anode X-ray tube, a remote-controlled X-ray topography camera, and a television system operating with an X-ray sensing VIDICON. System performance is demonstrated with reference to exploratory examples. The exposure time for photographic plates is reduced to 1/20 and for the X-ray TV system (resolution of the order of 30 μm) to 1/100 relative to that required when using a conventional topography system. (orig.) [de

  8. X-ray and gamma radiography devices

    International Nuclear Information System (INIS)

    Abdul Nassir Ibrahim; Azali Muhammad; Ab. Razak Hamzah; Abd. Aziz Mohamed; Mohamad Pauzi Ismail


    When we are using this technique, we also must familiar with the device and instrument that used such as gamma projector, crawler, x-ray tubes and others. So this chapter discussed detailed on device used for radiography work. For the x-ray and gamma, their characteristics are same but the source to produce is a big different. X-ray produced from the machine meanwhile, gamma produce from the source such as Co-60 and IR-192. Both are electromagnetic waves. So, the reader can have some knowledge on what is x-ray tube, discrete x-ray and characteristic x-ray, how the machine works and how to control a machine, what is source for gamma emitter, how to handle the projector and lastly difference between x-ray and gamma. Of course this cannot be with the theory only, so detailed must be learned practically.

  9. Exploring the X-Ray Universe (United States)

    Seward, Frederick D.; Charles, Philip A.


    Exploring the X-Ray Universe describes the view of the stars and galaxies that is obtained through X-ray telescopes. X-rays, which are invisible to human sight, are created in the cores of active galaxies, in cataclysmic stellar explosions, and in streams of gas expelled by the Sun and stars. The window on the heavens used by the X-ray astronomers shows the great drama of cosmic violence on the grandest scale. This account of X-ray astronomy incorporates the latest findings from several observatories operating in space. These include the Einstein Observatory operated by NASA, and the EXOSAT satellite of the European Space Agency. The book covers the entire field, with chapters on stars, supernova remnants, normal and active galaxies, clusters of galaxies, the diffuse X-ray background, and much more. The authors review basic principles, include the necessary historical background, and explain exactly what we know from X-ray observations of the Universe.

  10. Small scale soft x-ray lasers

    International Nuclear Information System (INIS)

    Skinner, C.H.; DiCicco, D.S.; Kim, D.; Voorhees, D.; Suckewer, S.


    The widespread application of soft x-ray laser technology is contingent on the development of small scale soft x-ray lasers that do not require large laser facilities. Progress in the development of soft x-ray lasers pumped by a Nd laser of energy 6-12J is reported below. Application of an existing soft x-ray laser to x-ray microscopy has begun. A soft x-ray laser of output energy 1-3 mJ at 18,2 nm has been used to record high resolution images of biological specimens. The contact images were recorded on photoresist which was later viewed in a scanning electron microscope. The authors present a composite optical x-ray laser microscope design

  11. X-ray photographic apparatus

    International Nuclear Information System (INIS)


    The X-ray photographic system is designed for medical applications. Two detectors are used for surveys in different planes, and produce electrical signals which are supplied to a comparator. The electron beams are examined according to a system of reference time steps. The apparatus includes a light source and a photo-detector and enables a reference signal to be produced against which the detected signals are compared. The beam source is formed from an electron gun, an extractor electrode and an anode; beam then passes through a collimator. (G.C.)

  12. International Conference on Cosmic Rays

    CERN Multimedia

    W.O. LOCK


    Towards the end of last year the 8th International conference on cosmic rays, held under the auspices of the International Union of Pure and Applied Physics (I.U.P.A.P.) and the Department of Atomic Energy of the Government of India, was held at Jaipur, India. Among the participants was W.O. Lock, head of CERN's Emulsion Group, who gave an invited talk on recent work in the field of what is normally known as high-energy physics — though in the context of this conference such energies seem quite low. In this article, Dr. Lock gives a general review of the conference and of the subjects discussed.

  13. Coincidence gamma-ray spectrometry

    DEFF Research Database (Denmark)

    Markovic, Nikola; Roos, Per; Nielsen, Sven Poul


    Gamma-ray spectrometry with high-purity germanium (HPGe) detectors is often the technique of choice in an environmental radioactivity laboratory. When measuring environmental samples associated activities are usually low so an important parameter that describes the performance of the spectrometer...... for a nuclide of interest is the minimum detectable activity (MDA). There are many ways for lowering the MDAs in gamma spectrometry. Recently, developments of fast and compact digital acquisition systems have led to growing number of multiple HPGe detector spectrometers. In these applications all detected...

  14. Ground level cosmic ray observations

    Energy Technology Data Exchange (ETDEWEB)

    Stephens, S.A. [Tata Institute of Fundamental Research, Bombay (International Commission on Radiation Units and Measurements); Grimani, C.; Brunetti, M.T.; Codino, A. [Perugia Univ. (Italy)]|[INFN, Perugia (Italy); Papini, P.; Massimo Brancaccio, F.; Piccardi, S. [Florence Univ. (Italy)]|[INFN, Florence (Italy); Basini, G.; Bongiorno, F. [INFN, Laboratori Nazionali di Frascati, Rome (Italy); Golden, R.L. [New Mexico State Univ., Las Cruces, NM (United States). Particle Astrophysics Lab.; Hof, M. [Siegen Univ. (Germany). Fachbereich Physik


    Cosmic rays at ground level have been collected using the NMSU/Wizard - MASS2 instrument. The 17-hr observation run was made on September 9. 1991 in Fort Sumner, New Mexico, Usa. Fort Sumner is located at 1270 meters a.s.l., corresponding to an atmospheric depth of about 887 g/cm{sup 2}. The geomagnetic cutoff is 4.5 GV/c. The charge ratio of positive and negative muons and the proton to muon ratio have been determined. These observations will also be compared with data collected at a higher latitude using the same basic apparatus.

  15. X-ray source array

    International Nuclear Information System (INIS)

    Cooperstein, G.; Lanza, R.C.; Sohval, A.R.


    A circular array of cold cathode diode X-ray sources, for radiation imaging applications, such as computed tomography includes electrically conductive cathode plates each of which cooperates with at least two anodes to form at least two diode sources. In one arrangement, two annular cathodes are separated by radially extending, rod-like anodes. Field enhancement blades may be provided on the cathodes. In an alternative arrangement, the cathode plates extend radially and each pair is separated by an anode plate also extending radially. (author)

  16. X-ray intensifying screens

    International Nuclear Information System (INIS)

    Bossomaier, T.R.J.; Sangway, P.C.


    It is claimed that stabilization of X-ray intensifying screens against discolouration and hydrolysis of lanthanum or gadolinium oxyhalide phosphors can be achieved by incorporating into the phosphor/binder formulation a compound containing free epoxy groups. Suitable epoxy compounds include gamma glycidoxy trimethoxy silane and dimethyl di(m-glycidoxy methylphenyl) methane. The oxyhalide may be activated by Tb, Tm or Yb and may be mixed with other phosphors. Plasticisers and organo-tin stabilisers for the formulation are given. Many binders are specified, preferably these should not react with the free epoxy groups. (UK)

  17. High-energy cosmic rays

    Energy Technology Data Exchange (ETDEWEB)

    Gaisser, Thomas K. [Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States)]. E-mail:; Stanev, Todor [Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States)


    After a brief review of galactic cosmic rays in the GeV to TeV energy range, we describe some current problems of interest for particles of very high energy. Particularly interesting are two features of the spectrum, the knee above 10{sup 15} eV and the ankle above 10{sup 18} eV. An important question is whether the highest-energy particles are of extra-galactic origin and, if so, at what energy the transition occurs. A theme common to all energy ranges is use of nuclear abundances as a tool for understanding the origin of the cosmic radiation.

  18. Haynes, Ray oral history interviews


    Interviewee: Haynes, Ray; Interviewer: Walliser, Andrea; Interviewer: Bauder, Ken; Principal Investigator: Hall, Peter V


    Ray Haynes is a former president of the BC Federation of Labour. As a young man Haynes worked at Hudson’s Bay Company Wholesale, a division of the Hudson’s Bay Company, where he reported earning a low wage and working in poor conditions. He then worked at Canadian White Pine sawmill where he learned about labour and other social issues from union members who were communist, Leninist, and Trotskyist. He worked at White Pine for only 18 months even though he was earning a high wage. Haynes told...

  19. Protonium X-ray spectroscopy

    CERN Document Server

    Gotta, D


    The Lyman and Balmer transitions from antiprotonic hydrogen and deuterium were studied extensively at the low-energy-antiproton ring LEAR at CERN in order to determine the strong interaction effects. A first series of experiments $9 was performed with semiconductor and gaseous X-ray detectors. In the last years of LEAR operation using a Bragg crystal spectrometer, strong interaction parameters in the 2p states of antiprotonic hydrogen and deuterium were measured $9 directly. The results of the measurements support the meson-exchange models describing the medium and long range part of the nucleon-antinucleon interaction. (39 refs).

  20. Cosmic gamma-ray bursts

    International Nuclear Information System (INIS)

    Hurley, K.


    This paper reviews the essential aspects of the gamma-ray burst (GRB) phenomenon, with emphasis on the more recent results. GRBs are introduced by their time histories, which provide some evidence for a compact object origin. The energy spectra of bursts are presented and they are seen to demonstrate practically unambiguously that the origin of some GRBs involves neutron stars. Counterpart searches are reviewed briefly and the statistical properties of bursters treated. This paper presents a review of the three known repeating bursters (the Soft Gamma Repeaters). Extragalactic and galactic models are discussed and future prospects are assessed