Siim Nestor soovitab : Tulebki tagasi...ja veel / Siim Nestor
Nestor, Siim, 1974-
2003-01-01
Üritusest kohvik-klubis Moskva 1. juunil, esinejateks Louie Vega, Dave Storm ja Raul Saaremets. Üritusest Jazz'N Motion Eesti Näituste Sinises Paviljonis 29. mail, esinejateks The Gotan Projekt ja Kimmo Pohjonen. Üritusest Barclay Dance Blend klubis BonBon 31. mail, esinejateks DJ Marine, Rhytm Doktor ja Saaremets. Üritusest 3. juunil Von Krahlis, külaliseks Electronicat
Saaremets, Raul
2002-01-01
Heliplaatidest Starsailor" Love is Here". Chicago Underground Quartet "Chicago Underground Quartet". Mower "Mower". Kim Wilde "The Very Best of". Mull Historical Society "Loss". Jill Scott "Experience: 826+"
Saaremets, Raul
2006-01-01
Heliplaatidest: Giant Drag "Hearts and Unicorns", Speak Low "I'm Gonna Groove YA!!", Agent M "Šokolaad EP", A.F.I. "Decemberunderground", Angels & Airwaves "We Don't Need To Whisper", Andrew Liles "In My Father's House are Many Mansions"
Saaremets, Raul
2007-01-01
Heliplaatidest: The Horrors "Strange House", Earlies "The Enemy Chorus", Finish Me Off "Seed", Kasabian "Empire", Norah Jones "Not Too Late", Kaiser Chiefs "Yours Truly Angry Mob", Skinny Puppy "Mythmaker", Patrick Wolf "The Magic Position"
Saaremets, Raul
2000-01-01
Dj Assault "Belle Isle Tech", Dj Krush "Code 4109", Dream City Film Club "Stranger Blues", Eels "Daisies of the Galaxy", Evergrey "Solitude, Dominance, Tragedy", Ghostface Killah "Supreme" albumite tutvustused
Saaremets, Raul
2002-01-01
Heliplaatidest Koop. "Waltz For Koop.". Lovage "Music To Make Love To Your Old Lady By". Cabaret Voltaire "The Original Sound Of Sheffield '83-'87 - The Best Of The Virgin/EMI Years". Erinevad esitajad "Lord Of The Rings: The Fellowship Of The Ring". Bugge Wesseltoft "Moving". Flanger "Inner Space/Outer Space". Femi Kuti "Fight To Win".
2008-01-01
Üritustest kontsertsarja Soul Spectrum raames Kumus: 14. märstsil Ursula Rucker (soojendusesinejad Riho Sibul, Jaak Sooäär ja Raul Saaremets), 15. märtsil folk-jazzlaulja Terry Callier (soojendusesinejad Tõnis Mägi ja Chalice)
Siim Nestor soovitab : Sports Cabaret. Ans. Flirt. DJ Krii / Siim Nestor
Nestor, Siim, 1974-
2002-01-01
29. nov. Tartus Club-Tallinnas toimuvast üritusest Sports Cabaret. 4. dets. klubis BonBon projekt-ansambli Flirt (koosseisus Raul Saaremets, Andres Peets, Sten Sheripov, Leslie Laasner) kontserdist. 29. nov. Von Krahlis toimuvast hip-hop peost Check One, Two, kus esinejaks läti diskor Krii
Siim Nestor soovitab : Teenage Kicks. Bängin / Siim Nestor
Nestor, Siim, 1974-
2002-01-01
12. aprillil alustatakse Pif-Pafi klubis live-muusikale orienteeritud muusikaõhtute sarjaga Teenage Kicks. Esinevad ansamblid BAP ja Id Rev ( andis 2001. aasta suvel välja albumi "Sina Ei"). Bängin on väike technopidu 13. apr. Wimbledonis, kus valivad technot Erkki Tero, Orav, Ilmar Kerm ja Raul Saaremets
Aus meeleliigutus - Raul Meelest, koos Kaspariga / Ly Lestberg
Lestberg, Ly, 1965-
2011-01-01
Raul Meele ja Kaspar Ausi loomingust. Raul Meele näitusest "Saalomon & Raul" Munkadetaguse torni galeriis. Raul Meele ja Kaspar Ausi Pärnus koos tehtud lavastusest "Inimene = Man". Kaspar Ausi tantsuprojektist "Enigma - kuuludes teadmata väljadele" ja videotest "Falling" ja "Arrival"
Vestlus Raul Kelleriga = A conversation with Raul Keller / intervjueerinud Margit Aule
Keller, Raul, 1973-
2012-01-01
Tallinna linnainstallatsioonide festivali "LIFT11" installatsioonist "Tütarlaps kloaagis", mis koosnes helist ja realistlikust inimkäte imitatsioonist endise Pegasuse kohviku ees kanalisatsioonikaevus. Autor Raul Keller
Saalomon ja Raul / Jaak Jõerüüt
Jõerüüt, Jaak, 1947-
2010-01-01
Raul Meele näitus Genti ülikooli raamatukogus 20.04.- 28.05.2010. Kunstniku kunstnikuraamat üheteistkümnes keeles: Meel, Raul. Salomon's Song of Songs = Saalomoni Ülemlaul / kujundanud Tiit Jürna. Tallinn, 2010
Siim Nestor soovitab : Wicked Beat. President of Funk. Muuseumiööl. Springz Bashmendil / Siim Nestor
Nestor, Siim, 1974-
2002-01-01
16. mail toimub Emajõe äärses klubis Atlantis Eesti esimene nu-skool breaks õhtu Wicked Beat, kus peaesinejaks on DJ ja produtsent Databass (plaadifirma Freakaboom "juhatuse esimees" Justin Owen). 18. mail house-muusika pidu Tartus muusikagaleriis Damtan Dance. 17. mai ööl Rotermanni soolalaos triod: 1. Riho Sibul, Jaak Sooäär ja Raul Saaremets ning 2. Tõnis Leemets, Robert Jürjendal ja Aivar Tõnso. 17. mail Von Krahlis Dj Dr. Koit
Villa Rocca al Mares = Villa in Rocca al Mare / Raul Vaiksoo ; intervjueerinud Margit Mutso
Vaiksoo, Raul, 1955-
2011-01-01
Tallinnas Loigu t. 3 asuva villa arhitektuursest lahendusest. Majas on kasutatud palju klaasi, konstruktsioonid on avatud. Arhitekt Raul Vaiksoo, kaasautor Kristo Vaiksoo, sisearhitektid Raul Vaiksoo ja Krista Aren (Raul Vaiksoo Arhitektuuribüroo). Raul Vaiksoo pälvis Rocca al Mare villa eest EK arhitektuuri sihtkapitali 2010. a. arhitektuuripreemia
Directory of Open Access Journals (Sweden)
LUCAS MARCELO TOMAZ DE SOUZA
2013-08-01
Full Text Available Resumo: Este trabalho possui dois objetivos distintos, porém complementares. O primeiro visa pensar a estruturação do mercado fonográfico brasileiro durante a década de 1970, focando a inserção do cantor e compositor Raul Seixas no mesmo. O segundo objetivo é o de analisar o LP Krig-ha Bandolo! de Raul Seixas, lançado em 1973, pela Philips, como forma de compreendermos as possíveis relações existentes entre a sua produção musical e as demandas comercias e simbólicas que sobre ele recaiam.Palavras-chave: Raul Seixas – Música Popular – Rock e Indústria Cultural na Década de 1970. Abstract: This paper has two distinct goals, however they complement each other. The first one aims to think the structural organization of the Brazilian phonographic market during the 70s, focusing on the participation of the singer and songwriter Raul Seixas. The second goal is the analysis of Raul Seixas’ LP Krig-ha Bandolo!, released in 1973 by Philips, as a way of understanding the possible existing relations between him and his musical production and the commercial and symbolic demands that he had to deal with.Keywords: Raul Seixas – Popular Music – Rock and 1970's cultural industry.
2006-01-01
2. märtsil tähistab oma 65. sünnipäeva kunstnik Raul Meel. R. Meel kirjutas-joonistas 2005. a. kaks raamatut. Seoses juubeliga toimub tema loomingut käsitlev konverents Shotimaal Dundee ülikoolis. USA New Jersey Rutgers'i ülikooli juures kirjutatakse Meele-keskselt kaht doktoritööd
Avangardiklassikud kohtuvad Tallinnas / Raul Meel ; interv. Harry Liivrand
Meel, Raul, 1941-
2004-01-01
Vene avangardistide Ilja ja Emilia Kabakovi ning Raul Meele (Kirjad lindudelt ja Eesti memoraat) installatsiooninäitusest Tallinna Kunstihoones. Satelliitnäitused Tallinna Linnagaleriis noortelt kunstnikelt Villu Plinkilt ja Janno Bergmannilt
Raul Seixas and the Brazilian music scene in the 1970s
Directory of Open Access Journals (Sweden)
LUCAS MARCELO TOMAZ DE SOUZA
2013-01-01
Full Text Available This paper has two distinct goals, however they complement each other. The first one aims to think the structural organization of the Brazilian phonographic market during the 70s, focusing on the participation of the singer and songwriter Raul Seixas. The second goal is the analysis of Raul Seixas’ LP Krig-ha Bandolo!, released in 1973 by Philips, as a way of understanding the possible existing relations between him and his musical production and the commercial and symbolic demands that he had to deal with.
Raul Meel ja Academia Non Grata Riias / Ants Juske
Juske, Ants, 1956-2016
1999-01-01
Läti Väliskunsti Muuseumis Riias on avatud Raul Meele isiknäitus 'Aknad ja maastikud'. Lisaks näidatakse tuleetenduse 'Arkaadia mäel' dokumentatsiooni. Näituse avamisel Pärnu Academia Non Grata performance
Raul Meel ja Ülo Sooster ajakirjas Zimmerli Journal
2007-01-01
Ajakirjas Zimmerli Journal, Fall, 2006, lk. 88-103 Jeremy Canwelli artikkel "System, Terminus and Time : The Mystical Art of Raul Meel" ja lk. 118-125 Leonid Lammi mälestused "Ülo Sooster : an Artist, a Friend and his Time"
77 FR 61051 - Additional Designations, Foreign Narcotics Kingpin Designation Act
2012-10-05
..., Distrito Federal Codigo Postal 03020, Mexico; Calle Sor Juana Ines de la Cruz No. 144, Departamento 124... (Mexico) (individual) [SDNTK]. 2. FELIX FELIX, Victor Manuel (a.k.a. CASTRO RODRIGUEZ, Raul), Callejon...
15 edukat aastat, kuidas edasi? / Raul Rosenberg, Ardo Nõmm ; interv. Kaja Prügi
Rosenberg, Raul, 1961-
2008-01-01
Maaelu Edendamise Sihtasutuse juhatuse esimees Raul Rosenberg ja finantsjuht Ardo Nõmm vastavad küsimustele, mis puudutavad sihtasutuse missiooni. Vt. samas: Millega MES tegelenud on? MES kronoloogias
SUTD-i koorik = SUTD Gridshell / Andres Sevtšuk, Raul Kalvo
Sevtšuk, Andres, 1981-
2013-01-01
Singapuri Tehnoloogia ja Disaini Ülikooli (SUTD) raamatukogu paviljon. Eskiis valmis esimese aasta üliõpilastele korraldatud töötoas. Algse ideega töötas edasi City Form Lab (arhitektid Andres Sevtšuk, Raul Kalvo). Paviljon pandi kokku ligi saja üliõpilase osalusel. Valmis: mai 2013
Achieving Better Privacy for the 3GPP AKA Protocol
Directory of Open Access Journals (Sweden)
Fouque Pierre-Alain
2016-10-01
Full Text Available Proposed by the 3rd Generation Partnership Project (3GPP as a standard for 3G and 4G mobile-network communications, the AKA protocol is meant to provide a mutually-authenticated key-exchange between clients and associated network servers. As a result AKA must guarantee the indistinguishability from random of the session keys (key-indistinguishability, as well as client- and server-impersonation resistance. A paramount requirement is also that of client privacy, which 3GPP defines in terms of: user identity confidentiality, service untraceability, and location untraceability. Moreover, since servers are sometimes untrusted (in the case of roaming, the AKA protocol must also protect clients with respect to these third parties. Following the description of client-tracking attacks e.g. by using error messages or IMSI catchers, van den Broek et al. and respectively Arapinis et al. each proposed a new variant of AKA, addressing such problems. In this paper we use the approach of provable security to show that these variants still fail to guarantee the privacy of mobile clients. We propose an improvement of AKA, which retains most of its structure and respects practical necessities such as key-management, but which provably attains security with respect to servers and Man-in-the- Middle (MiM adversaries. Moreover, it is impossible to link client sessions in the absence of client-corruptions. Finally, we prove that any variant of AKA retaining its mutual authentication specificities cannot achieve client-unlinkability in the presence of corruptions. In this sense, our proposed variant is optimal.
2011-05-23
... DEPARTMENT OF STATE [Public Notice 7464] In the Matter of the Designation of Army of Islam, aka Jaish al- Islam, aka Jaysh al-Islam, as a Foreign Terrorist Organization Pursuant to Section 219 of the... respect to Army of Islam, also known as Jaish al-Islam, also known as Jaysh al-Islam. Therefore, I hereby...
2011-05-23
... DEPARTMENT OF STATE [Public Notice 7463] In the Matter of the Designation of Army of Islam, aka Jaish al- Islam, aka Jaysh al-Islam; as a Specially Designated Global Terrorist Pursuant to Section 1(b... of Islam, also known as Jaish al-Islam, also known as Jaysh al-Islam, has committed, or poses a...
Minule tähtsatest koordinaatidest = Coordinates that Matter to Me / Raul Meel
Meel, Raul, 1941-
1998-01-01
Sõnavõtus vaidlustab Raul Meel kunstikriitikute seisukohti 1970.-te kunsti, eriti nn. 'tõrjutute' (s.h. tema enda) loomingu ja nende rahvusvahelistel näitustel saadud preemiate väärtuse hindamisel; toob esile tendentslikkust ka kaasaegse kunsti kriitikas ja Eesti kunstnike leksikonis (m.h. norra kunstniku O. Chr. Jensseni 1993 Tallinnas toimunud näituse mahavaikimisest)
Radioactivity level in the Raul Doamnei - Arges (Prundu Dam) ecosystem
International Nuclear Information System (INIS)
Toma, Al.; Pavelescu, M.; Margeanu, S.
1997-01-01
Hydrosphere is an important pathway of dispersion of the radionuclides released in the environment following nuclear activities. In this work the determination of the main pathway of radionuclide migration in the Raul Doamnei - Arges ecosystem (Prundu Dam) was carried out. The region is significant because it is a receptor of the radioactive liquid effluents resulting from Institute for Nuclear Research/Nuclear Fuel Plants compound activities. An evaluation of the source term (liquid effluents, deposition, soil erosion) and of natural and artificial radioactive isotope inventory in different zones of the ecosystem. Finally, the multi-compartmental radio-ecologic model applicable to this case is presented and an evaluation of the inter-compartment transfer parameters is given
2008-01-01
Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Lauri Madise, Heinrich Schneider. Preambul / Raul Narits, Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Oliver Kask, Madis Ernits, Taavi Annus, Peeter Roosma, Rait Maruste, Eerik Kergandberg, Ivo Pilving, Uno Lõhmus, Merilin Kiviorg, Einar Vene, Ülle Madise. III ptk. / Oliver Kask. IV ptk. / Lauri Madise, Aaro Mõttus, Jüri Põld, Tiina Runthal. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Liventaal, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Kristi Land, Heiki Lindpere, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Ülle Madise, Janek Laidvee, Heinrich Schneider. XII ptk. / Berit Aaviksoo, Mihkel Allik, Enn Markvart, Raul Narits, Aare Reenumägi, Peeter Roosma. XIII ptk. / Raul Narits, Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Jüri Liventaal, Ülle Madise. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Oliver Kask, Raul Narits, Peeter Roosma. Eesti Vabariigi põhiseaduse täiendamise seadus / Berit Aaviksoo, Julia Laffranque, Ülle Madise, Jüri Põld. Eesti Vabariigi põhiseadus 1990-2008 : bibliograafia (seisuga september 2008) / koost. Maia Ruttu
As identidades ficcionais de Raul Pompéia
Directory of Open Access Journals (Sweden)
Franco Baptista Sandanello
2014-12-01
Full Text Available A fortuna crítica da obra de Raul Pompéia – especialmente, de seu romance O Ateneu – foi marcada por uma forte aproximação entre a vida do escritor e sua ficção. No entanto, pouco se falou a respeito de um aspecto muito curioso desta relação complexa entre vida e arte: o papel subsequente de Pompéia na literatura brasileira não como escritor, mas como personagem. Curiosamente, o romancista integra a trama de obras ficcionais como, por exemplo, Tentação, de Adolfo Caminha, O canudo, de Afonso Schmidt, e Investigação sobre Ariel, de Sílvio Fiorani. Nesse sentido, a partir de uma comparação entre estas obras, será discutida a possível figuração ficcional de Pompéia, assim como a posição particular de sua subjetividade dentro da mecânica narrativa de cada texto. Do primeiro ao último, há, por assim dizer, um progressivo distanciamento do universo ficcional por ele criado (como o do citado O Ateneu e uma ênfase cada vez maior em suas crises e inquietações pessoais. The critical reception of Raul Pompéia’s work – especially that of O Ateneu – has strongly identified over the years his biography to his fiction. However, very little was said on a very peculiar aspect of this complex link between life and art: the subsequent role of Pompéia in Brazilian literature not as a writer, but as a fictional character. Curiously, the writer integrates the plot of fictional works such as Tentação, by Adolfo Caminha, O canudo, by Afonso Schmidt, and Investigação sobre Ariel, by Sílvio Fiorani. In this regard, from an initial comparison of these texts, this article discusses the fictional figure of Pompéia, as well as the particular standing of his subjectivity in each narrative. So to speak, in these texts there is a gradual detachment of the fictional universe of his own works (as that of O Ateneu and an increasing emphasis on his personal dramas and crisis.
The UMTS-AKA Protocols for Intelligent Transportation Systems
Directory of Open Access Journals (Sweden)
Hwang Min-Shiang
2009-01-01
Full Text Available The integration of communication protocols into transport systems is a much adored research area today. Much of seminal work has been reported on the topic of intelligent transportation systems (ITS in the recent years. Many advanced techniques have been garnered to improve online communication and to promote the security, comfort, and efficiency of ITS. Of primary importance to the effective application of ITS is the communication protocol used. A fascinating development is that the yesterday's Global System for Mobile Communication protocol is being replaced by the Universal Mobile Telecommunication System protocol, which is the third-generation mobile technology. This article attempts to identify a suitable communication system for ITS applications. It is impracticable to substantially modify the original UMTS-IMS-AKA protocol which is in practice because it can disturb the operation of the current system, and thus we explore other possibilities through this research. We investigate a novel protocol to make the original UMTS-IMS-AKA protocol compliant with ITS as well as adaptable into the current UMTS protocol.
2004-01-01
Tartu Ülikooli arstiteaduskonna üliõpilased põhjendavad, miks nad ei soovi Eestis residentuuri astuda, vaid hoopis Soome tööle lähevad. Residentuurisüsteemi prodekaan professor Raul-Allan Kivet selgitab, miks noored arstid peavad pärast ülikooli lõpetamist mitmeid aastaid pisikese palga eest praktiseerima
Järg, Raul, 1973-
2009-01-01
Rakvere linna peaarhitekt, žürii liige Raul Järg rahvusvahelisest arhitektuurivõistlusest, mille ülesandeks oli pakkuda lahendus Rakvere Pauluse kiriku kasutuselevõtmiseks Arvo Pärdi muusikamajana ja kirikuesise väljaku ümberkujundamiseks, auhinnatud töödest. 1. preemia said Kristiina Aasvee, Kristiina Hussar ja Anne Kose (Celander Projekt)
2010-01-01
Sotsiaaalminister Hanno Pevkur, Tartu Ülikooli makroökonoomika õppetooli juhataja Raul Eamets, Avatud Ühiskonna Instituudi juhataja Ivi Proos ja Eesti Rakendusuuringute Keskuse CENTAR vanemanalüütik Sten Anspal arutlevad Eesti tööturu olukorra ja tulevikuperspektiivide üle
International Nuclear Information System (INIS)
Zhao Hongcan; Xiang Guoqian
2005-01-01
Objective; To investigate the clinical usefulness of combined determination of serum rheumatic factor (RF), anti-keratin antibody (AKA) and anti-cyclic citrullinated peptide antibody (anti-CCP antibody) levels for early diagnosis in patients with rheumatoid arthritis (RA). Methods: Serum RF ( with rate-nephelometry), AKA (with indirect immuno-fluorescence) and anti-CCP antibody (with ELISA) levels were determined in 40 patients with RA, 30 patients with SLE and 30 controls. Results: For diagnosis of RA; the sensitivity and specificity of RF was 70.0% and 90.0% respectively, the sensitivity and specificity of AKA was 35.0% and 96.7%, the sensitivity and specificity of anti-CCP-antibody was 85% and 93.3% respectively. With combined determination of RF, AKA and anti-CCP antibody, the sensitivity and specificity would be the highest, being 97.07 and 99.8% respectively. Conclusion: RF, AKA and anti-CCP antibody were useful diagnostic serum markers for rheumatoid arthritis and combined determination of these markers would be very useful for early diagnosis. (authors)
2010-02-09
... Service USA, Inc. a/k/a IFS USA, Inc. d/b/a Global Wine Logistics USA Inc. a/k/a GWL USA, Inc., and Global... Wine Logistics USA Inc. a/k/a GWL USA, Inc. (``GWL USA''); Anita McNeil; International First Service... FEDERAL MARITIME COMMISSION [Docket No. 10-01] AMC USA, Inc. v. International First Service S.A. a...
Notas sobre o percurso receptivo da obra de Raul Brandão
Directory of Open Access Journals (Sweden)
Mágna Tânia Secchi Pierini
2014-03-01
Full Text Available A obra de Raul Brandão foi marcada por um gradativo e crescente reconhecimento estético perante a crítica. Porém, muitas décadas precedentes a essa conquista pontuaram omissões ou posicionamentos unívocos diante de tais produções ficcionais. Elencamos um levantamento e propomos uma reflexão acerca do percurso receptivo realizado pela crítica literária portuguesa e brasileira, com o objetivo de averiguar seu posicionamento junto à recuperação e reconhecimento das obras desse escritor. Para tal, abordamos aspectos da recepção crítica efetuada em alguns dos suportes destinados para esse fim como, por exemplo, em jornais e revistas, em compêndios de periodizações literárias ou em teses acadêmicas publicadas posteriormente, conforme a preponderância em cada época.
Adding Four- Dimensional Data Assimilation (a.k.a. grid nudging) to MPAS
Adding four-dimensional data assimilation (a.k.a. grid nudging) to MPAS.The U.S. Environmental Protection Agency is investigating the use of MPAS as the meteorological driver for its next-generation air quality model. To function as such, MPAS needs to operate in a diagnostic mod...
2002-01-01
Kommentaaride autorid ja sisu: Sissejuhatus / Raul Narits, Heinrich Schneider, Lauri Madise. [Preambul] / Heinrich Schneider. I ptk. / Kalle Merusk, Taavi Annus, Madis Ernits, Heiki Lindpere, Lauri Madise. II ptk. / Uno Lõhmus, Taavi Annus, Madis Ernits, Oliver Kask, Eerik Kergandberg, Rait Maruste, Peeter Roosma. III ptk. / Oliver Kask. IV ptk. / Jüri Põld, Lauri Madise, Aaro Mõttus. V ptk. / Eerik-Juhan Truuväli, Ülle Madise, Jüri Põld, Urmas Reinsalu. VI ptk. / Kalle Merusk, Jüri Põld. VII ptk. / Eerik-Juhan Truuväli, Jüri Põld. VIII ptk. / Lasse Lehis. IX ptk. / Heiki Lindpere, Kristi Land, Lauri Madise, Heiki Pisuke. X ptk. / Oliver Kask, Enn Markvart, Jüri Põld. XI ptk. / Heinrich Schneider. XII ptk. / Raul Narits, Aare Reenumägi, Peeter Roosma, Enn Markvart. XIII ptk. / Uno Lõhmus, Madis Ernits, Jüri Põld. XIV ptk. / Vallo Olle, Arno Almann, Ülle Madise, Jüri Liventaal. XV ptk. / Eerik-Juhan Truuväli, Aaro Mõttus. Eesti Vabariigi põhiseaduse rakendamise seadus / Raul Narits, Peeter Roosma, Oliver Kask. Märksõnastik / koost. Ülle Madise, Peep Pruks. Kasutatud õigusaktide lühendid / koost. Virgo Saarmets. Eesti Vabariigi põhiseadus 1990-2002 : bibliograafia / koost. Maia Ruttu
DEFF Research Database (Denmark)
Boston, Raymond C; Stefanovski, Darko; Henriksen, Jan E
2007-01-01
of technical reasons have deterred researchers from performing TPG analysis. METHODS AND RESULTS: In this paper, we describe AKA-TPG, a new program that combines automatic kinetic analysis of the TPG model data with database technologies. AKA-TPG enables researchers who have no expertise in modeling to quickly...... fit the TPG model to individual FSHGT data sets consisting of plasma concentrations of unlabeled glucose, labeled glucose, and insulin. Most importantly, because the entire process is automated, parameters are almost always identified, and parameter estimates are accurate and reproducible. AKA...
Roulette, Casey J; Kazanji, Mirdad; Breurec, Sébastien; Hagen, Edward H
2016-01-01
Little is known about cannabis use in hunter-gatherers. Therefore, we investigated cannabis use in the Aka, a population of foragers of the Congo Basin. Because cannabis contains anthelminthic compounds, and the Aka have a high prevalence of helminthiasis, we also tested the hypothesis that cannabis use might be an unconscious form of self-medication against helminths. We collected self- and peer-reports of cannabis use from all adult Aka in the Lobaye district of the Central African Republic (n = 379). Because female cannabis use was low, we restricted sample collection to men. Using an immunoassay for Δ9-tetrahydrocannabinol-11-oic acid (THCA), a urinary biomarker of recent cannabis consumption, we validated cannabis use in men currently residing in camps near a logging road (n = 62). We also collected stool samples to assay worm burden. A longitudinal reinfection study was conducted among a subsample of the male participants (n = 23) who had been treated with a commercial anthelmintic 1 year ago. The prevalence of self- and peer-reported cannabis use was 70.9% among men and 6.1% among women, for a total prevalence of 38.6%. Using a 50 ng/ml threshold for THCA, 67.7% of men used cannabis. Cannabis users were significantly younger and had less material wealth than the non-cannabis users. There were significant negative associations between THCA levels and worm burden, and reinfection with helminths 1 year after treatment with a commercial anthelmintic. The prevalence of cannabis use among adult Aka men was high when compared to most global populations. THCA levels were negatively correlated with parasite infection and reinfection, supporting the self-medication hypothesis. © 2015 Wiley Periodicals, Inc.
2013-07-25
... DEPARTMENT OF STATE [Public Notice 8390] Designation of Bulut Yayla, AKA: Samet Ince as a... risk of committing, acts of terrorism that threaten the security of U.S. nationals or the national security, foreign policy, or economy of the United States. Consistent with the determination in Section 10...
Examining short-term nutritional status among BaAka foragers in transitional economies.
Remis, Melissa J; Jost Robinson, Carolyn A
2014-07-01
Foragers in transitioning economies are at an increased risk of negative health outcomes as they undergo changes in subsistence patterns and diet. Here, we provide anthropometric data and examine the nutrition and health of adult BaAka foragers in relationship to declining wildlife and economic change in the Dzanga Sangha Protected Areas (APDS), Central African Republic. From June to August 2012, we collected biological data and dietary recall surveys from individuals in Mossapoula (MS) and Yandoumbé (YDBE) villages using standard anthropometric techniques and a single capillary blood finger prick. In our analysis, we identified variation in anthropometric measurements and hemoglobin levels by village (MS = 66, YDBE = 75) and gender (64 men, 77 women). Immigration, increased gun hunting and wildlife trades have reduced forager reliance on forest resources. These changes are evidenced in the marginal health of contemporary BaAka foragers of APDS. Although anthropometric measures of nutritional status do not significantly differ between communities, hemoglobin data highlight inequities in access to forest products between villages with different proximity to community hunting zones. Further, poor dietary diversity and low frequency of purchased foods in the diet indicate that the transition to a market economy has not been fully realized and diets are impoverished. Economic changes appear to have had the most impact at MS village, where forest use is most restricted and consumption of meat and forest products was reduced. This work highlights the nutritional and health needs of foragers in rapidly transitioning economies; especially those impacted by conservation management and zoning policies. © 2014 Wiley Periodicals, Inc.
SEX AND SEARCHING FOR CHILDREN AMONG AKA FORAGERS AND NGANDU FARMERS OF CENTRAL AFRICA
HEWLETT, Barry S.; HEWLETT, Bonnie L.
2010-01-01
Few systematic studies exist on the sexual behavior of hunter-gatherers and rural central Africans. This study examines the reasons for having sex, the frequency of sex (coitus) per night, sexual practices during the post-partum sex taboo, and beliefs and practices regarding homosexuality, masturbation, the use of sexual stimulants and a variety of other sexual behaviors. Thirty-fi ve Aka and twenty-one Ngandu adults who were or had been married were interviewed. For adults 18–45 years of age...
Vadīšanas funkciju izpildes analīze Viļakas novada pašvaldībā.
Cibule, Rūta
2016-01-01
Bakalaura darba tēma ir “Vadīšanas funkciju izpildes analīze Viļakas novada pašvaldībā”. Darbā ir apskatītas vadīšanas funkcijas – organizēšana, plānošana, motivēšana, koordinēšana un kontrole, fokusējoties uz pirmajām trim minētajām. Bakalaura darba mērķis ir izanalizēt vadīšanas funkciju izpildi Viļakas novada domes administrācijā, pievēršot pastiprinātu uzmanību organizēšanai, motivēšanai un plānošanai. Lai šo mērķi izpildītu, pirmajā daļā autore izpētīja dažādus teorijas avotus, otrajā da...
Autonomy, Equality, and Teaching among Aka Foragers and Ngandu Farmers of the Congo Basin.
Boyette, Adam H; Hewlett, Barry S
2017-09-01
The significance of teaching to the evolution of human culture is under debate. We contribute to the discussion by using a quantitative, cross-cultural comparative approach to investigate the role of teaching in the lives of children in two small-scale societies: Aka foragers and Ngandu farmers of the Central African Republic. Focal follows with behavior coding were used to record social learning experiences of children aged 4 to 16 during daily life. "Teaching" was coded based on a functional definition from evolutionary biology. Frequencies, contexts, and subtypes of teaching as well as the identity of teachers were analyzed. Teaching was rare compared to observational learning, although both forms of social learning were negatively correlated with age. Children received teaching from a variety of individuals, and they also engaged in teaching. Several teaching types were observed, including instruction, negative feedback, and commands. Statistical differences in the distribution of teaching types and the identity of teachers corresponded with contrasting forager vs. farmer foundational cultural schema. For example, Aka children received less instruction, which empirically limits autonomous learning, and were as likely to receive instruction and negative feedback from other children as they were from adults. Commands, however, exhibited a different pattern suggesting a more complex role for this teaching type. Although consistent with claims that teaching is relatively rare in small-scale societies, this evidence supports the conclusion that teaching is a universal, early emerging cognitive ability in humans. However, culture (e.g., values for autonomy and egalitarianism) structures the nature of teaching.
2010-05-24
... DEPARTMENT OF STATE [Public Notice 7026] Review of the Designation of Ansar al-Islam (aka Ansar Al-Sunnah and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review of the Administrative Records assembled in these...
Toompea komandandimaja = The Commandant's House in Toompea / Margit Mutso
Mutso, Margit, 1966-
2010-01-01
Tallinnas Toompea 1 asuva hoone restaureerimisest. Arhitekt Raul Vaiksoo, kaasautor Kristo Vaiksoo (Raul Vaiksoo Arhitektuuribüroo), sisearhitektid Priit Põldme, Rita Rahu (SAB Joonprojekt), Raul Vaiksoo, ajaloolased Raul Vaiksoo, Aleksandr Pantelejev. Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud hoonele
2012-02-09
... Thomas Lim Blk 258A Compassvale Road 07-551 Singapore 541258; Order Denying Export Privileges On October...'') of Singapore, pled guilty to one count of violating the International Emergency Economic Powers Act..., a/k/a Thomas Lim, with the last known address at: Blk 258A,Compassvale Road 07-551, Singapore 541258...
Villa Pirital : turvaliselt lõppenud arhitektuurieksperiment / Alvin Järving
Järving, Alvin, 1986-
2013-01-01
Masinlikuna detailitäpsest ja tehnoloogilisest eramust Pirital. Arhitekt Raul Vaiksoo (Raul Vaiksoo Arhitektuuribüroo). Sisearhitektid Raul Vaiksoo ja Margit Teikari (Stuudio TEMA). Ehitusaeg: 2011-2013. Elamispind: 374 m²
Directory of Open Access Journals (Sweden)
Ferdi Arifin
2017-11-01
Full Text Available Kimcil Kepolen song is a dangdut hiphop and being popular song nowadays. This song is created by NDX a.k.a Familia that inspires people for his long journey as a labor towards a great Indonesian musician that has been loved by widely society. This lyric represents women image from NDX perspective before his successful being a great musician. The study employs qualitative method to look at Kimcil Kepolen lyric as a language fact which is able to be examined by semantic and cognitive linguistics perspective. The results shows us that Kimcil Kepolen lyric represents materialistic women are being hard to get engage and to make a serious relationship for poor men. The facts explain that materialistic women are easily breaking men’s heart and cheating to a man who has a stabble financial support.
Directory of Open Access Journals (Sweden)
Norman Moreno Garcia
2011-12-01
Full Text Available El objetivo de este trabajo es la selección de un modelo para estimación de carbono en Tipo Forestal Roble-Raulí y Coigüe. La recolección de datos se realizo en la Reserva Nacional Malleco. Cada sitio fue representado por un grupo de 5 parcelas (cuadradas, de lado 35m, superficie 1225m2, ubicadas en un transecto según la pendiente más fuerte. Fueron estimados los volúmenes de madera con y sin corteza de la totalidad de los individuos por medio de funciones para cada especie del tipo forestal en estudio. La cantidad de carbono almacenado a nivel de fuste de las parcelas fue estimada aplicando la función universal de carbono. En cada parcela se contabilizaron los árboles por clase diamétrico de DAP, siendo definidas las clases a partir del DAP mínimo de 3 cm y con una amplitud de 5 cm. Fueron ajustados los modelos de Spurr, Meyer, Stoate, Naslund y Schumacher-Hall. El modelo Schumacher-Hall presento el mejor ajuste de acuerdo a los indicadores estadísticos considerados, además de una mejor distribución de residuales.
Remsu, Olev, 1947-
2009-01-01
Raul Tammeti töid sisaldavast DVD-dest "Raul Tammet filmiloomes I, II, II", mis sisaldavad filme "Kiri Giuliale", "Soolo", "Pulmapilt", "Sinise taeva all", "Piim", "Mono", "Tartu maraton 1983" ja "Küljetuul"
Dramaturgia wiersza: „wiersz-płacz”. Płakała w nocy, ale nie jej płacz go zbudził
Directory of Open Access Journals (Sweden)
Anna Krajewska
2016-12-01
Full Text Available The article is an interpretation of the poem “Płakała w nocy, ale nie jej płacz go zbudził” (“She cried at night, but not her cries woke him” written by Stanisław Barańczak. The author focuses on description in this poem – dramatic in shape, philosophical, and according to the narrative of the anthropocentrism crisis. The author considers this poem to be a metaphysical text defining the relationship between the world of human and non-human reality. She compares the poem with those written by Jan Kochanowski (Laments, Cyprian Kamil Norwid (In Verona, Andrew Marvell (Eyes and tears, Szymborska (Apple tree.
LIFT 11 kutsub kogemist väärt kohtadesse / Silvia Pärmann
Pärmann, Silvia
2011-01-01
Installatsioonide festivalist LIFT 11 Tallinnas, kuraator Margit Aule. Margus Tamme ja Argo Peeveri installatsioonist "Face It", Raul Kalvo skulptuurist "Uurijad", Raul Kelleri installatsioonist "Tütarlaps kloaagis", Aet Aderi, Kaarel Künnapi, Grete Soosalu, Flo Kasearu, Andra Aaloe kunstiprojektist "O"
Vene eliidi mõõdupuu : kuidas suhtute Võssotskisse?
1999-01-01
Sisu: Carindowsky, Emilie. [Vladimir Võssotski] ; Võssotski, Nikita. Kuulsa lauliku poeg taunib isa jumaldajaid / üles kirjut. Raul Ratman ; Simagin, Rudolf. Elu lõppes ja laat algas / üles kirjut. Raul Ratman. Tallinlasel Rudolf Simaginil on V. Võssotski materjalide kogu
Lajien synty / Otso Kantokorpi
Kantokorpi, Otso, 1957-
2014-01-01
Soome kunstnikust Lauri Anttilast, eesti kunstnikust Raul Meelest. Nende loomingu võrdlus. Lauri Anttila näitus Helsingis Ama galeriis 27. maist 19. juunini. Raul Meele näitus "Dialoogid lõpmatusega" Kumu Kunstimuuseumis 9. maist 12. oktoobrini 2014
2014-04-01
Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy Conversion Devices (a.k.a. Understanding Photosystem I as...Laboratory Adelphi, MD 20783-1197 ARL-TR-6904 April 2014 Hydrogen Production from Water by Photosynthesis System I for Use as Fuel in Energy...Final 3. DATES COVERED (From - To) 10/1/2010–10/1/2013 4. TITLE AND SUBTITLE Hydrogen Production from Water by Photosynthesis System I for Use as Fuel
Mittedepressiivse Eesti väikelinna vormija / Ago Gashkov
Gashkov, Ago
2008-01-01
Rakvere peaarhitektist Raul Järgist (sünd. 1973), kes on õppinud Eesti Kunstiakadeemias 1993-1997 sisearhitektuuri, 1999-2001 magistrantuuris arhitektuuri, töötanud 2005-2007 internarhitektina Kanada büroos Parkin Architects Limited. Raul Järgi viimaseid projekte
Koordi mõisa peahoone = Koordi manor
2007-01-01
Järvamaa Koordi mõisa muinsuskaitse all oleva peahoone rekonstruktsioon esinduseramuks. Sisearhitekuur: Raul Vaiksoo ja Krista Aren (Raul Vaiksoo AB). R. Vaiksoost ja K. Arenist, nende tähtsamad tööd. 3 korruste plaani, värv. välisvaade, 11 sisevaadet, foto R. Vaiksoost ja K. Arenist
Gudvin Veliki i Uzhasnõi i Zolushka v odnom litse / Galina Balashova
Balashova, Galina
2004-01-01
Vene kunstnikust-kontseptualistist Ilja Kabakovist ja tema loomingust. Ülo Soosteri hea sõber, 1996. a. ilmunud monograafia "Ülo Sooster" autor. Tema tutvuskonda kuulunud eesti kunstnikke. Raul Meele loomingu seotusest Ilja Kabakovi omaga. Ilja ja Emilia Kabakovi projekt "Tühi muuseum" avatakse Tallinna Kunstihoones. Eksponeeritud ka Raul Meele installatsioon "Vita Aboriginum"
Lindpere, Piret, 1963-
2003-01-01
1923. a. valminud koolihoone renoveerimine ja juurdeehitus.Vana ja uut maja ühendab klaaskatusega läbi korruste paiknev aatrium. Projekteerija: Raul Järg, AS Kommunaalprojekt. Autor Raul Järg. Sisekujundaja Toomas Korb (Pink). Konstruktsioonid: AS Kommunaalprojekt, OÜ Civen. Projekt 2002, valmis 2003. Uue osa I ja II korruse plaan, 7 vaadet
Directory of Open Access Journals (Sweden)
José Manuel Fernandes
2016-11-01
Full Text Available El texto hace un análisis comparativo de las obras de Raul Lino (1879-1974, portugués, y Frank Lloyd Wright (1867-1959, de Estados Unidos- dos arquitectos (casi contemporáneos, cada uno exponente de la cultura y la sociedad de su tiempo y de su espacio de vida y de trabajo.El artículo se refiere al contexto histórico y cultural del primer periodo creativo de estos autores. En este contexto trata de las obras de John Ruskin y William Morris, creadores del Arts & Crafts, así como de las características de este movimiento artístico, de las peculiaridades del Deutscher Werkbund y de los trabajos de Sullivan y Berlage. Acerca de Lino y Wright, este artículo presenta la “comprensión del mundo” que tenían: sus temas conceptuales y arquitectónicos, así como los movimientos estéticos y culturales asociados a sus trabajos - “Casa Portuguesa” y “Arquitectura Orgánica”. Se exponen y analizan los “seis principios” de Wright y los “seis principios” de Lino -destacando los aspectos comunes de las concepciones de ambos autores. Se describen y ejemplifican, también, algunos de los temas y materiales arquitectónicos comunes en la primera fase de las obras los arquitectos. Así mismo, se estudia con mayor profundidad el diseño de obras concretas, casas, de su autoría, en sus similitudes y contrastes.
Directory of Open Access Journals (Sweden)
Dragoslav Ugarak
2006-01-01
Full Text Available U radu je opisan matematički model određivanja daljine cilja obradom video snimaka u toku praćenja. Analizirani su doprinosi parametara koji utiču na veličinu grešaka i određene su vrednosti standardnog odstupanja. / This paper presents mathematical model of determining target range by analyzing video frame during the tracking. The contribution of effective parameters to accuracy are analyzed and values of standard deviation are determined.
"Rindemehed" Tallinna Kunstihoones
2004-01-01
7. XI avatakse Tallinna Kunstihoones ja Kunstihoone galeriis Ilya ja Emilia Kabakovi ning Raul Meele näitus, Tallinna Linnagaleriis New Yorgis Kabakovi ateljees töötanud Villu Plingi ja Jan Bergi näitus. 8. XI Eesti Kunstiakadeemias toimuval EKA nõukogu avalikul koosolekul promoveeritakse EKA 85. aastapäeval audoktoriks Ilya Kabakov, kes peab pärast tseremooniat akadeemilise loengu. Repliik Ilya Kabakovilt ja Raul Meelelt
Memory and a Hard Place: Revisiting Central Havana
Directory of Open Access Journals (Sweden)
Marivic Wyndham
2008-02-01
Full Text Available Raul and Manolo are two Cuban men in their late sixties. Manolo left soon after Castro’s triumph to become a television celebrity in Miami. He returned in 1991 to make a clandestine film about the city which once was his. Raul never left his decaying city. He applauded the revolution, but little by little his enthusiasm soured. The paper examines the relationship of the two men to what was once the ultra modern Central Havana of the mid-1950s. Manolo’s froze on the day he left: his filmed city is silent, immobile, full of ghosts, almost empty, ugly, ruined. Manolo’s Central Havana processes and changes, it is noisy, busy, - but also it is ugly and ruined. Both lament the city as it once was. Only Raul sees hope of reconciliation.
76 FR 20450 - Designation of Nine Individuals Pursuant to Executive Order 13566
2011-04-12
..., Safia); DOB 1952; POB Al Bayda, Libya (individual) [LIBYA2] 4. GADDAFI, Hannibal (a.k.a. AL-GADDAFI, Hannibal; a.k.a. AL-QADHAFI, Hannibal; a.k.a. ELKADDAFI, Hannibal; a.k.a. EL-QADDAFI, Hannibal; a.k.a. GADDAFI, Hannibal Muammar; a.k.a. GHADAFFI, Hannibal; a.k.a. GHATHAFI, Hannibal; a.k.a. QADDAFI, Hannibal...
76 FR 34805 - Designation of Three Entities and One Individual Pursuant to Executive Order 13553
2011-06-14
... OF THE GUARDIANS OF THE ISLAMIC REVOLUTION; a.k.a. THE IRANIAN REVOLUTIONARY GUARDS), Tehran, Iran... (individual) [IRAN-HR] Entities ISLAMIC REVOLUTIONARY GUARD CORPS (a.k.a. AGIR; a.k.a. IRANIAN REVOLUTIONARY GUARD CORPS; a.k.a. IRG; a.k.a. IRGC; a.k.a. ISLAMIC REVOLUTIONARY CORPS; a.k.a. PASDARAN; a.k.a...
76 FR 40772 - Additional Designation of Entities Pursuant to Executive Order 13382
2011-07-11
... designees is as follows: Entities: 1. IRAN AIR (a.k.a. AIRLINE OF THE ISLAMIC REPUBLIC OF IRAN (HOMA); a.k.a. HAVAPEYMA MELI IRAN HOMA; a.k.a. HOMA; a.k.a. IRAN AIR CARGO; a.k.a. IRAN AIR P J S C; a.k.a. IRANAIR; a.k.a. IRANAIR CARGO; a.k.a. NATIONAL IRANIAN AIRLINES (HOMA); f.k.a. SHERKAT SAHAMI AAM HAVOPAYMAIE JOMHOURI...
Ranne, Raul
2004-01-01
Heliplaatidest: Genialistid "Genialistid", Roy Ayers "Mahogany Vibe", John Tejada "Logic Memory Center", Joss Stone "Mind, Body & Soul", Fatboy Slim "Palookaville", Soulwax "Any Minute Now", Erinevad esitajad "Super Discount 2"
2013-08-26
... (Pakistan); alt. National ID No. 42201-015024707-7 (individual) [SDGT]. Entity 1. JAMIA TALEEM-UL-QURAN-WAL...; a.k.a. MADRASA TALEEMUL QURAN WAL HADITH; a.k.a. MADRASA TALEEMUL QURAN WAL SUNNAH; a.k.a. MAWIYA MADRASSA; a.k.a. MOW-YA MADRASSA; a.k.a. TALALIM QURAN MADRASSA; a.k.a. TALEEM UL-QURAN MADRASSA; a.k.a...
2011-05-05
... SOCIAL DEVELOPMENT FUND COMPANY (a.k.a. ECONOMIC SOCIAL AND DEVELOPMENT FUND; a.k.a. SOCIAL AND ECONOMIC...://www.lap.ly [LIBYA2] 7. LIBYAN AFRICAN INVESTMENT COMPANY (a.k.a. LAAICO; a.k.a. LAICO; a.k.a. LIBYAN ARAB AFRICAN INVESTMENT COMPANY; a.k.a. THE LAICO GROUP), Janzoor (neighborhood), Tripoli, Libya; P.O...
2013-05-24
... TELEVISION (a.k.a. ADDOUNIA TV; a.k.a. AL DOUNIA; a.k.a. AL-DONYA TELEVISION CHANNEL; a.k.a. DUNIA LIMITED LIABILITY COMPANY FOR INFORMATION; a.k.a. DUNIA TELEVISION), Information Free Zone, Damascus, Syria [SYRIA...
77 FR 27280 - Actions Taken Pursuant to Executive Order 13382
2012-05-09
..., Shahrake-E-Quds, Tehran, Iran [IRGC] [NPWMD]. 4. IRAN MARINE INDUSTRIAL COMPANY, SADRA (a.k.a. IRAN MARINE INDUSTRIAL COMPANY SSA; a.k.a. IRAN SADRA; a.k.a. IRAN SHIP BUILDING CO.; a.k.a. SADRA; a.k.a. SHERKATE...
2009-01-01
Sisu: Programm. Õigusteaduse rollist Eesti Vabariigi põhiseaduse aluspõhimõtete sisustamisel / Raul Narits. Keskkonnaõiguse kodifitseerimise teaduslikud alused / Hannes Veinla. "Kord Vestmann peal ja Piibeleht all, siis jälle..." : praktika ja õigusteaduse vahekord õiguse kujundamisel 19. sajandi Läänemereprovintsides / Marju Luts-Sootak. Teaduslik analüüs tsiviilõigusloomes / Paul Varul. Õiguslaenud ja võrdlev õigusteadus Eesti eraõiguse süsteemi kujundamisel / Irene Kull. Professor Meruski juubeliks / Märt Rask. Kolleegi kiituseks / Raul Narits. Professor Kalle Merusk : õpetaja ja inimene / Ivo Pilving. Kalle Merusk : valikbibliograafia 1990-2009 / koost. Maia Ruttu
2012-11-26
... follows: Individual 1. AL-MUSAWI, Ali Mussa Daqduq (a.k.a. 'ABD AL-YUNIS, Hamid Majid; a.k.a. AL-LAMI.... AL-MUSAWI, Hamid Muhammad Jabur; a.k.a. AL-MUSUI, Hamid Muhammad Jabur; a.k.a. DAQDUQ, Ali Mussa; a.k...
Konkursi "Parim puitehitis 2007" võitjad
2007-01-01
Parim puitehitis 2007 - eramu Kiili vallas (arhitekt ja tellija Karmo Tõra, projekteerijad K. Tõra, Andres Sokk, Tõnu Peipmam). Äramärgitud - eramu Mähel (arhitekt Raul Vaiksoo, projekteerija Raul Vaiksoo Arhitektuuribüroo), Eesti Kunstiakadeemia üliõpilaste ehitised Pedaspeal (juhendajad Andres Alver ja Jaan Tiidemann, üliõpilased Anu Arm, 2006 ja Ivan Sergejev, 2007). Liimpuidu kasutamise eriauhind - AS Palmako tootmishoone Kavastus Tartumaal (projekteerija AS Resand, Villu Leppik ja Alar Just, arhitektuuriprojekt: Tartu Arhitektuuribüroo, Roman Smushkin). Voodrilaua kasutamise eriauhind - Tammeõue kortermajad Viimsis (arhitekt: Agabus, Endjärv, Truverk Arhitektid, Mattias Agabus, Eero Endjärv, Illimat Truverk, Priit Pent, projekteerimine: Pikoprojekt OÜ, ehitaja: AS NCC Ehitus). Žürii koosseis
Na pjatom konkurse derevjannoi arhitekturõ pobedili individualnõje zhilõje doma / Märt Riistop
Riistop, Märt
2008-01-01
Konkursist "Eesti parim puitehitis 2007", premeeritud töödest. Parim puitehitis 2007 - eramu Kiili vallas (arhitekt ja tellija Karmo Tõra, projekteerijad K. Tõra, Andres Sokk, Tõnu Peipmam). Äramärgitud - eramu Mähel (arhitekt Raul Vaiksoo, projekteerija Raul Vaiksoo Arhitektuuribüroo), Eesti Kunstiakadeemia üliõpilaste ehitised Pedaspeal (juhendajad Andres Alver ja Jaan Tiidemann, üliõpilased Anu Arm, 2006 ja Ivan Sergejev, 2007). Liimpuidu kasutamise eriauhind - AS Palmako tootmishoone Tartumaal Kavastus (projekteerija AS Resand, Villu Leppik ja Alar Just, arhitektuuriprojekt: Tartu Arhitektuuribüroo, Roman Smushkin). Voodrilaua kasutamise eriauhind - Tammeõue kortermajad Viimsis (arhitekt: Agabus, Endjärv, Truverk Arhitektid, projekteerimine: Pikoprojekt OÜ, ehitaja: AS NCC Ehitus). Žürii koosseis
African Journals Online (AJOL)
Ariwaodongo
Maps. Mapping activities are often used as introductory activities. They allow the community to show and talk about how they see the area where they live, the resources/ ... Brain Storming. Here the member of the community is asked to think of any idea that comes to mind and list all the ideas without evaluation or judgment.
2003-01-01
Rekonstrueeriti Tallinna 21. keskkooli ajalooline koolihoone. Lühidalt kooli ehitus- ja ümberehitusloost ning rekonstrueerimiskonkursist. Ehitati 1922-1923, arhitekt A. Perna; rekonstrueerimisprojekti autorid on Raul Järg ja Toomas Korb
Rahvuse sünd, identiteet ja surm Kumus / Janar Ala
Ala, Janar, 1979-
2010-01-01
Näitus "Räägime rahvuslusest! Ideoloogia ja identiteedi vahel" Kumu Kunstimuuseumis 25. aprillini, kuraator Rael Artel. Lähemalt Raul Kelleri installatsioonist "Pikk silm" ja Tõnu Virve maalist "Eesti naine"
Üle linna Vinskid / Timo Tarve
Tarve, Timo
2005-01-01
2004. aasta märtsis ja aprillis Merimetsa ning Pirita Selverites toimepandud varguste lahendamisest. Kurjategijatele Raul Traublumile, Nail Lapõtovile ja Andrei Plakanile mõistis kohus mitme aasta pikkuse vanglakaristuse
Tavasti stipendium = Tavast scholarship
2014-01-01
Ennesõjaaegse Eesti tuntuima juveelitöösturi Roman Tavasti poja Raul-Roman Tavasti 1998. aastal asutatud stipendium professionaalse ehtekunsti järelkasvu toetamiseks EKA ehtekunsti eriala üliõpilastele
Lihakombinaadi müük ajas söödatehase grupi lõhki / Mehis Tulk
Tulk, Mehis, 1967-
2007-01-01
Erinev arusaam Saaremaa lihatootmise ja -töötlemise tulevikust viis pikaajalised äripartnerid Raul Maripuu ja Prits Libliku lepitamatu erimeelsuseni, mis päädis viimase lahkumisega loomakasvatusärist
Mirovaja kultura s dostavkoi na dom / Ilja Sundelevitsh
Sundelevitsh, Ilja
2003-01-01
Kunstinäitustest Tallinnas. Raul Meele käsikirjaliste tekstide (konkreetne luule) näitus "Kirjutatud lugu/kiri" Kastellaanimaja galeriis ja Jaak Arro segatehnikas inglipildid näitusel "Linnud" Kunstihoone galeriis
Kallinenud kütus seiskab lisarahata kiirabibrigaadid / Sigrid Laev
Laev, Sigrid
2004-01-01
Kui kiirabi lisaeelarvest taotletud 10 miljonit krooni ei saa, võidakse ajutiselt sulgeda 10-18 kiirabibrigaadi. Tallinna kiirabi peaarsti Raul Adlase sõnul eraldab riik vaid 80% vajalikest summadest. Kommenteerib Heidi Gil
Märketeatesuusatamine uues kuues Mammastes / Nikolai Järveoja
Järveoja, Nikolai, 1950-
2010-01-01
Märkeorienteerumise ajaloost ning 27. veebruaril 2010 Mammastes uute reeglite alusel toimunud Eesti meistrivõistlustest suusaorienteerumise märketeates. Ajalugu meenutab Arne Kivistik ning võistlust kommenteerivad Tõnis Erm ja Raul Kudre
Tallinna Loomeinkubaator = Tallinn Creative Incubator
2010-01-01
Tallinnas Veerenni 24C asuva Tallinna Loomeinkubaatori sisekujundusest. Sisearhitektid: Raul Tiitus ja Tarmo Piirmets (Pink OÜ). Sisegraafika: Kaarel Vahtramäe (Velvet). Pink OÜ tähtsamate tööde loetelu
Laenumiljonid tuulte meelevallas / Toomas Mattson
Mattson, Toomas, 1970-
2005-01-01
Ilmunud ka: Põhjarannik 4. märts lk. 2, Severnoje Poberezhje 4. märts, lk. 2. Ülevaade Riigikontrolli auditist Maaelu Edendamise Sihtasutuse tegevuse kohta. Kommenteerivad Ester Tuiksoo ja Raul Rosenberg
Tallink jättis eilsel börsipäeval väikeaktsionärid infosulgu / Annika Matson
Matson, Annika, 1976-
2006-01-01
Tallink ei andnud erinevalt Viking Line'ist oma väikeaktsionäridele teada, kas osaleb Silja Line'i ostupakkumisel. Kommenteerib Raul Malmstein. Vt. samas: Lauri Matsulevitsh. Citigroup soovitab Tallinki aktsiat osta
Maksuvõlglaste arv kahanes aastaga protsendi võrra
2004-01-01
Maksu- ja tolliameti maksuvõlgade sissenõudmise osakonna juht Raul Siem teeb ülevaate eraisikutest maksumaksjate ja ettevõtete maksuvõlgadest 2004. aastal ning selgitab maksuvõlgade ennetamise ja sissenõudmise protseduuri
Одногазовый недорынок / Михаил Колосок
Колосок, Михаил
2010-01-01
Valitsuse kavatsusest eraldada Eesti Gaasist ülekandevõrk ehk suurem torustik. Balti Gaasi juhatuse liikme Urmo Männi, EG Võrguteenused tegevdirektori Sergei Jefimovi, Eesti Gaasi juhatuse liikme Raul Koitovi arvamusi ja hinnanguid
Plaadid / Kaur Garshnek, Ave Randviir, Priit Pruul...[jt.
2007-01-01
Uutest heliplaatidest Jaak Sooäär, Raul Vaigla, Tanel Ruben "No99 Jazzklubis", Black Strobe "Burn Your Own Church", The Quantic Soul Orchestra "Tropidelico", Uni "Kosmikud II", Bugge Wesseltoft "IM", Gabrielle "Always"
Tallinna Loomeinkubaator = Creative Incubator in Tallinn / Margit Mutso
Mutso, Margit, 1966-
2010-01-01
Tallinnas Veerenni 24C asuva Tallinna Loomeinkubaatori sisekujundusest. Sisearhitektid Raul Tiitus, Tarmo Piirmets (Pink OÜ), graafiline kujundus: Kaarel Vahtramäe (Velvet Studio). Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud sisekujundusele
Kassikullatud mausoleum kadunud aja ideoloogiale / Johannes Saar
Saar, Johannes, 1965-
2004-01-01
Ilja ja Emilia Kabakovi ning Raul Meel'i ühisnäitus Tallinna Kunstihoones. Kabakovid on toonud Kunstihoone suurde saali korduse 1993. a. Frankfurdis esmaesitatud installatsiooniideest "Tühi muuseum". Totaalse installatsiooni meistrist Ilja Kabakovist
12. I kell 14 avatakse Pärnu Linnagaleriis...
2006-01-01
Eesti graafika kuldsete aastakümnete dokumentatsiooni näitus: väljas on Vive Tolli, Evi Tihemetsa, Mare Vindi, Raul Meele, Leonhard Lapini jt. lehtede tolleaegsed originaaltõmmised, Jaan Klõsheiko fotod jpm. Taastatakse 1975. a. Harku mõisas TA eksperimentaalbioloogia instituudis toimunud näitusega kaasnenud konverents, esinevad L. Lapin, Mart Helme, R. Meel, Tiit Kändler. TÜ Pärnu kolledzhis Aivar Kurvitsa näitus "Egiptus 2006", Endla teatris Raul Meele näitus "ii-jäähäh" ja Anonymous Bohi näitus "M.A.N.", Cafes Toomas Kuusingu näitus "Kes teisele ütleb, see ise on", toimuvad Ernest Truely, Lexxxa, Rodrig Kokla, Eva Ikarti, Liivi Tantaali etteasted. IN Graafika festivali raames Tallinnas galeriis Cnopt rühmituse Vedelik väljapanek
2009-01-01
Tutv. rmt.: Alekand, Anneli. Proportsionaalsuse printsiip põhiõiguste riive mõõdupuuna täitemenetluses : [doktoritöö] / juhendaja: Raul Narits. - Tartu : Tartu Ülikooli Kirjastus, 2009. - 176 lk. - (Dissertationes iuridicae Universitatis Tartuensis ; 24)
Hiiumaa kalatööstus vaagub hinge tasemel tehasest hoolimata / Anneli Ammas
Ammas, Anneli, 1962-
2004-01-01
Hiiu Kalur on Kõrgessaare kalatööstusesse investeerinud 20 miljonit krooni, riigile ollakse võlgu 26 miljonit. Vald valmistab ette negatiivset lisaeelarvet. Lisa: Inimene peab ju kuskil töötama; kommenteerib: Raul Siem
Yeast Interacting Proteins Database: YGL061C, YDR016C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...6C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...it description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force p... Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT
Yeast Interacting Proteins Database: YKR037C, YGL061C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ion Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by
Yeast Interacting Proteins Database: YGR113W, YDR016C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...DR016C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced
Yeast Interacting Proteins Database: YGR113W, YKR037C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...KR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...escription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produ
Yeast Interacting Proteins Database: YKR037C, YDR016C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...016C DAD1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ion Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by
Yeast Interacting Proteins Database: YGR113W, YGL061C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...GL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...scription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produc
Yeast Interacting Proteins Database: YKR083C, YDR201W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...1W SPC19 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force ...on Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by M
Lua, Pei Lin; Neni, Widiasmoro Selamat
2011-07-01
The influence of awareness, knowledge, and attitudes (AKA) on the health-related quality of life (HRQoL) of patients with epilepsy has not been widely established. The aims of this preliminary study were to (1) assess general AKA and HRQoL levels, (2) correlate AKA and HRQoL levels, and (3) compare the HRQoL of patients with epilepsy with different AKA levels. A cross-sectional sample of outpatients with epilepsy were recruited from the Neurology Clinic, Hospital Sultanah Nur Zahirah, Kuala Terengganu, Malaysia. Data analysis was carried out using the Statistical Package for Social Sciences Version 15 employing descriptive and nonparametric statistics. On written consent, included patients completed the Malay AKA Epilepsy and the Malay Quality of Life in Epilepsy-30 (MQOLIE-30) instruments. Across all patients, both AKA levels (median: 80.0, range: 0-170) and overall HRQoL (median 51.5; range 15-97) were moderate. Awareness was significantly correlated only with Seizure Worry (r(s)=+0.29, p<0.05), whereas Knowledge was not significantly linked to any domain. However, Attitudes was significantly correlated with all domains (r(s)=+0.35 to +0.47, p<0.01) except Medication Effects and Seizure Worry. Patients with good AKA levels (Total Score ≥ median) experienced significantly better Overall Quality of Life and Cognitive Functioning (p<0.05). Findings showed that AKA may play an important role in influencing patients' HRQoL, suggesting that epilepsy treatment efforts should also focus on enhancing AKA through epilepsy awareness to improve health outcomes. Copyright © 2011 Elsevier Inc. All rights reserved.
Vennalik abi / Raul-Levroit Kivi
Kivi, Raul-Levroit, 1920-2009
1999-01-01
Vabariikliku projekteerimisinstituudi "Estonprojekt" Tartu filiaali juhataja Kuno Tiku väljavahetamisest Venemaalt tulnud Nikolai Toomega. Arhitektide vastuhakust. Lk. 83-84 1954. a. 24. detsembri "Edasis" pseudonüümi E. Saar all ilmunud Olaf Uti kollektiivi toetav artikkel "Ühe kollektiivi mured"
Eesti Rahvuskultuuri Fond / Raul Pettai
Pettai, Raul, 1928-
2009-01-01
allfonde on loodud ka väliseestlaste poolt: Abel-Mirka fond majandusteaduse üliõpilaste koolituse toetamiseks USA-s ja Edmund Valtmani fond Eesti Kunstiakadeemia üliõpilase toetamiseks või akadeemia vilistlasele parima graafilise teose eest
Raul Meele ropud lipud Rootsis
2000-01-01
Rootsis Sollentunas Edsviki kunstikeskuses J. Backsteini kureeritud rahvusvaheline kaasaegse kunsti näitus "Inverse Perspective". Eestit esindavad E.-L. Semper, J. Toomik, A. Keskküla ja R. Meel. Rootsi ajakirjanduses avaldatud intervjuust R. Meelega
Salumäe, Raul
2003-01-01
Kuressaare linnuse keldrisaalis poola kunstniku Magdalena Schmidt-Gora näitus-installatsioon "Genesis I, II", 3. korruse väikeses saalis läti fotograafi Astra Tomsone fotonäitus "Loojang minu akna taga"
Mesopotaamia ehituskunsti tagasitulek / Raul Veede
Veede, Raul
2007-01-01
Mitmed eestlastele tuntud ehitised, kujud ja tornid (Tartu Tigutorn, Eesti Rahvusraamatukogu, Tallinna Linnahall, kruvitornid Triumph Plaza katusel) võivad olla inspireeritud praeguse Iraagi kunagisest ehituskunstist
Yeast Interacting Proteins Database: YKR083C, YKL052C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YKR083C DAD2 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...2C ASK1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...e name DAD2 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ey description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force p
Laimre, Marco, 1968-
2007-01-01
Tallinnas Kultuurikatlas Põhja pst. 35 avati Eesti Kaasaegse Kunsti Muuseum. Hetkel kuuluvad muuseumi kogusse kaks tööd: Raul Kelleri tänavavaljuhäälditega elektripost ja Kiwa installatsioon "Teile Esineb Ansambel Mootortüdrukud"
Piirivalve orkestri 11 unustamatut päeva Austraalias / Tanel Saarmann
Saarmann, Tanel
2008-01-01
Oma reisist Piirivalve Orkestriga Austraaliasse räägivad Arvi Miido, Raul Mäe ja Jüri Kalve. Lisa: Väljavõtted artiklist Adelaide'i kohalikus väliseesti ajalehes Virgats, 5. mai 2008 ; Mis on tattoo?
2001-01-01
4. rahvusvaheline "In Graafika" festival. Workshop'ist Academia Non Gratas võtavad osa tudengid Helsingi, Vilniuse ja Läti kunstiakadeemiast ning Academia Non Gratast, kunstnikest Raul Meel, Vive Tolli, Nele Zirnite, Roi Vaara. Näitustel osalejad loetletud
Effects of niacin supplementation (40 weeks) and two dietary levels ...
African Journals Online (AJOL)
Meyer, Ulrich
2006-05-18
May 18, 2006 ... on performance, blood and fatty acid profiles of dairy cattle. C. Rauls1, U. ... included 40 treatment comparisons with niacin supplementation, and, in most cases, found positive ...... Effects of feeding heat-treated soybeans and.
International Nuclear Information System (INIS)
Garita Cordero, Andrea
2014-01-01
The elderly adult patient is characterized in the Unidad de Incontinencia Urinaria of the Hospital Nacional de Geriatria 'Dr. Raul Blanco Cervantes', during the period between January 1, 2012 and June 30, 2013. The total revision was 513 clinical records of patients treated for the first time in the Urinary Incontinence Unit in the established period. 228 of the cases were excluded. A final sample of 285 patients aged 76 years on average is studied, the predominance is the female sex and the state is widowhood, schooling is Aged 6 and residing in San Jose. In addition, partial dependent patients BLFA (Basic Life Activities) and IALF (Instrumental Activities of Life) are included, in normal cognitive condition according to schooling by MMSE (Mini Mental State Examination) and with risk of depression. As comorbidity they have presented mainly AHT (Arterial hypertension), DM (Diabetes Mellitus) and depression with associated obesity. The patients studied have consumed at least 2 medications simultaneously and usually have had a previous surgical history. Women who have had gynecological obstetric records of pregnancies and births were found to be unrelated to some type of incontinence. Patients have presented defects of the pelvic floor, such as cystocele and rectocele, in men increased prostate size. The most prevalent urinary incontinence has been the mixed, finding association by gender, in women is given more mixed urinary incontinence, followed by stress urinary incontinence; In men, urgent urinary incontinence and urinary incontinence due to overflow. Patients are sent to treatment with electrostimulation of pelvic floor and completed sessions, have shown an improvement in incontinence and quality of life. A more detailed evaluation of the older adult and to evaluate urinary incontinence could give greater results of the capture of patients with positive repercussion in the patient's quality of life. (author) [es
Carrott, Anthony; Siegel, Edward Carl-Ludwig; Hoover, John-Edgar; Ness, Elliott
2013-03-01
Terrorism/Criminalogy//Sociology : non-Linear applied-mathematician (``nose-to-the grindstone / ``gearheadism'') ''modelers'': Worden,, Short, ...criminologists/counter-terrorists/sociologists confront [SIAM Conf. on Nonlinearity, Seattle(12); Canadian Sociology Conf,. Burnaby(12)]. ``The `Sins' of the Fathers Visited Upon the Sons'': Zeno vs Ising vs Heisenberg vs Stoner vs Hubbard vs Siegel ''SODHM''(But NO Y!!!) vs ...??? Magntism and it turn are themselves confronted BY MAGNETISM,via relatively magnetism/metal-insulator conductivity / percolation-phase-transitions critical-phenomena -illiterate non-linear applied-mathematician (nose-to-the-grindstone/ ``gearheadism'')''modelers''. What Secrets Lie Buried in Magnetism?; ``Magnetism Will Conquer the Universe!!!''[Charles Middleton, aka ``His Imperial Majesty The Emperior Ming `The Merciless!!!']'' magnetism-Hamiltonian phase-transitions percolation-``models''!: Zeno(~2350 BCE) to Peter the Pilgrim(1150) to Gilbert(1600) to Faraday(1815-1820) to Tate (1870-1880) to Ewing(1882) hysteresis to Barkhausen(1885) to Curie(1895)-Weiss(1895) to Ising-Lenz(r-space/Localized-Scalar/ Discrete/1911) to Heisenberg(r-space/localized-vector/discrete/1927) to Priesich(1935) to Stoner (electron/k-space/ itinerant-vector/discrete/39) to Stoner-Wohlfarth (technical-magnetism hysteresis /r-space/ itinerant-vector/ discrete/48) to Hubbard-Longuet-Higgins (k-space versus r-space/
Considerations on the extreme flood produced in Ral Mare Basin (Retezat Mountains, Romania)
International Nuclear Information System (INIS)
Barbuc, Mihai
2004-01-01
The aim of this paper is to illustrate the major impact of an extreme flood on the landscape, on the upper basin of Raul Mare, from Retezat Mountains, Romania, and what means 'hazardous phenomenon'. Romania is one of the European countries most severely affected by natural hazards, which have a big social and economic impact. Between them, floods are the very frequent and have one of the most important effects on settlements, agriculture and communications. Raul mare has three main sources: Lapusnicul Mare, Lapusnicul Mic and Raul Ses. Its springs from glacier lakes, at high altitude, over 2000 m, and have torrential and narrow valleys. In present, their conflence, at Gura Apelor, is covered by an anthropic lake, formed behind of a great dam, 173 m high. This dam had a major role to attenuate and to fail to control the extreme flood from July 1990 and, at the same time, to reduce significantly, the damages in Hateg depression, a low area with many settlements and economic objectives. Behind of the Gura Apelor kake, the Lapusnicul Mare and Mic valleys, the flush flood covered the whole channel, the effects on the landscape-devastating, and the flood probability, between 0,1 -0,1 %. The maps, graphics and pictures presented in this paper will emphasize the situation before and after the event. Furthermore, some standard forms used to be filled in by authorities for immediate and unitary recording of extreme phenomena are presented.(Author)
Näost näkku / Maaretta Jaukkuri ; ülevaate koostas Tõnu Tammets
Jaukkuri, Maaretta
1992-01-01
Programmi "Ars Baltica" raames toimunud Läänemeremaade kujutava kunsti näitus "Näost näkku" ("Face to face") Kieli Kunstihallis 6. okt. - 10. nov. 1991. Eestit esindas Raul Rajangu. Mõtteid näitusekataloogi eessõnast
Eesti ajalehefoto 2004 : kuhu kadusid aasta tipphetked? / Väino Koorberg
Koorberg, Väino, 1969-
2005-01-01
Kokkuvõte žürii tööst. Parim uudisfoto Raul Mee töö "Eesti-Rootsi 1:O", maakonnalehtede parim Margus Ansu foto Laine Jänesest, parim olemusfoto Erik Prozese "Peremudel muutuvas ühiskonnas". 8 fotot
75 FR 47899 - Designation of Two Entities and Seven Individuals Pursuant to Executive Order 13224
2010-08-09
..., or economy of the United States; (3) persons determined by the Director of OFAC, in consultation with... RECONSTRUCTION IN LEBANON; a.k.a. IRAN'S HEADQUARTERS FOR THE RECONSTRUCTION OF LEBANON), Near Iranian Embassy....k.a. KHOSHNEVIS, Hussam; a.k.a. KHOSHNVIS, Hassan; a.k.a. KHOUCHNOYESS, Hussam); nationality Iran...
"In-graafika" kümnendal festivalil ei olnud pidupäevahõngu / Elnara Maarin
Elnara Maarin, pseud.
2006-01-01
Näitus "Eesti graafika kuldsed aastakümned" Pärnu Linnagaleriis kuni 4. II; Aivar Kurvitsa näitus "Vaaraode elust" TÜ Pärnu kolledzhi raamatukogus kuni 7. II; Raul Meele näitus "ii-jääh-äh" Endla Küüni trepigalerii II korrusel kuni 7. II; Anonymous Bohi näitus "M.A.N" Endla Küüni trepigalerii III korrusel kuni 7. II; Toomas Kuusingu näitus "Kes teisele ütleb, see ise on" Endla teatri kohvikus kuni 7. II; Jaak Visnapi näitus "Disainitud kunst" Eesti Litograafiakeskuses. Konverents. Peapreemia: Toomas Kuusing, kolm võrdset preemiat: Jaan Klõsheiko (esinemine põhinäitusel), rühmitus Vedelik (näitus "International" Cnopti galeriis), Raul Meel, eripreemia: Ernest Truelyle (USA) & Lexxxale (Holland) inim- ja kõrvetusgraafikatehnikas trüki-performance'ite eest
Kullassepatöösturi poeg taastab isa pärandit / Anneli Ammas
Ammas, Anneli, 1962-
2004-01-01
Roman Tavasti kullassepatööstusest ja tema poja Raul Roman Tavasti tegevusest märgitööstuse ja Juveeli kullassepatehase juhina. Näitus Roman Tavasti kaubamärki kandvast kogust ja hilisema juveelitehase toodetest Rahvusraamatukogu harulduste saalis
Väikeste sammudega saab jõudsamalt edasi liikuda / Liisi Seil
Seil, Liisi, 1971-
2009-01-01
Täiskasvanud õppija nädala raames tunnustati Viljandimaa aasta parimaid. Aasta õppija tiitli pälvis OÜ Sveba-Dahlen tootmistehnik Raul Järve, aasta koolitaja on vabakutseline õpetaja Enn Onni ning aasta koolitussõbralikemaks omavalitsuseks tunnistati Tarvastu Vallavalitsus
Kas vangide ennetähtaegne vabastamine tõstab kuritegevust?
1998-01-01
Eesti Päevalehe küsitlusele vastavad Tartu Ülikooli kriminaalõiguse professor Jaan Sootak, vanglate ameti peadirektor Olavi Israel, kinnipeetav Raul Kaasik, Pärnu maakohtu kriminaalhooldusosakonna juhataja Priit Sutt ja politseiameti peadirektori asetäitja Jüri Kasesalu
Taas teadmusühiskonna infopoliitikast / Silvi Metsar
Metsar, Silvi
2004-01-01
RRis toimunud II infopoliitika foorumil "Riiklik infopoliitika - müüt või tegelikkus" arutleti, kas Eestis on infoühiskond, milline on riiklik infopoliitika jne. Teiste seas osalesid Anu Toots, Tiiu Valm, Peeter Tulviste, Jaak Aaviksoo, Raul Malmstein
Dantistõ iz PLOM zavlekajut ujutom / Urmas Oja
Oja, Urmas, 1981-2012
2004-01-01
Hambaravikabineti Plom kujundusest. Sisearhitekt Raul Tiitus büroost Pink on kavandanud ka osa mööblist. Sissepääsu kõrvale tuleb Ivari Männi riiul FlixFlax. Seintel ja laes Martin Pedaniku pildid. 3 ill
30. IX kuni 31. XII 2000 toimus Makedoonia Vabariigis...
2001-01-01
III rahvusvaheline graafikatriennaal "Bitola 2000" teemadel "2000 aastat kristlust" ja "Metamorfoos". Eestist osalesid Peeter Allik, Sirje Eelma, Kelli Kagovere, Avo Keerend, Ilmar Kruusamäe, Raul Meel, Benjamin Vasserman. Peapreemia - poola graafiku Mira Boczniowiczi töö "Empire Sign".
2013-09-25
.... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... MADJID, Afif; a.k.a. BIN ABDUL MAJID, Afif); DOB 01 Jan 1955; POB Pacitan, East Java, Indonesia; nationality Indonesia (individual) [SDGT]. 2. SUNGKAR, Said Ahmad (a.k.a. SUNGKAR, Sahid Ahmad; a.k.a. SUNGKAR...
77 FR 10807 - Designation of One Entity Pursuant to Executive Order 13553
2012-02-23
... International Emergency Economic Powers Act (50 U.S.C. 1701-06) (``IEEPA'') and the Comprehensive Iran Sanctions... INTELLIGENCE AND SECURITY (a.k.a. VEZARAT-E ETTELA'AT VA AMNIAT-E KESHVAR; a.k.a. ``MOIS''; a.k.a. ``VEVAK..., Tehran, Iran; Ministry of Intelligence, Second Negarestan Street, Pasdaran Avenue, Tehran, Iran [SDGT...
'Of peasants, peacocks and priests; a Portuguese village'
Iturra, Raul
2009-01-01
Made on very early equipment, silent 8mm film and tape recorder. Narration by Sarah Harrison. An early product of the Rivers Video Project. A film about a north Portuguese village in 1985, based on the fieldwork of Raul Iturra
Leading daily slammed for political bias / Aleksei Gunter
Gunter, Aleksei, 1979-
2005-01-01
Poliitikute väitel mõjutab ajalehe Postimees tegevust Reformierakond. Ajaleht Postimees süüdistab Hans H. Luike seotuses ajalehe mustamisega, et saavutada parem äriline positsioon. Meediaeksperdi Raul Rebase selgitus. Tabel: Eesti meediagrupid ; Päevalehtede tiraazh Jaanuaris 2005
Hinnad jätkavad tõusu / Kenneth Rogoff
Rogoff, Kenneth
2005-01-01
Argentiina majandusteadlase Raul Prebischi sõltuvusteooria kinnitas, et kui vaesed riigid sõltuvad liigselt kaupade ekspordist, ei saavuta nad iial tööstuslikku taset, mida on vaja kiire kasvu säilitamiseks. Vt. samas: Vajadus nafta järele kasvab
Ilmus teadusajakirja Rechtstheorie Eesti erinumber
2008-01-01
Tutvustus väljaandele: Multiple Modernität, Globalisierung der Rechtsordnung und Kommunikationsstruktur der Rechtssysteme : Internationales Symposium zur Theorie der Rechtskommunikation an der Universität Tartu im April 2006 / herausgegeben von Werner Krawietz und Raul Narits. Berlin : Duncker & Humblot, 2007
Kas "Medium is the message?" / Riin Kübarsepp
Kübarsepp, Riin, 1978-
2005-01-01
Eesti Päevalehe 100. sünnipäevale pühendatud rändnäitusest "Ajaleht kunstis" Rakvere Linnagaleriis. Eksponeeritakse Oskar Hoffmann, Jaan Elkeni, Raul Rajangu, Agur Kruusingu, Endel Kõksi, Valeri Vinogradovi, Jüri Ojaveri jt töid
18. XII kell 12 kaitstakse EKA E-meedia keskuses 4 magistritööd...
2002-01-01
Kristel Sibul "Kehatud kehad - kehad ja identiteet internetis" (juh. Katrin Kivimaa), Ivika Kivi "Virtuaalsed õpitarkvarad" (juh. Mare Emmott Tralla), Maris Lindoja "Digitaalne ruum" (juh. Andres Kurg), Raul Keller "Corporate Consulting in the Digital Age - Jamming vith the Culture" (juh. Richard Barbrook)
Naissoo ja Agan - 2 in 1 / Igor Garšnek
Garšnek, Igor, 1958-
2011-01-01
15. mail Tallinnas Mustpeade majas toimunud kontserdist "Naissoo ja Agan 111", kus esinesid Tõnu Naissoo, Ain Agan, Teemu Viinikainen, Raul Sööt, Daniel Aljo, Joel-Rasmus Remmel, Mihkel Mälgand, Toomas Rull ja Tallinna Kammerorkester Jüri-Ruut Kanguri juhatusel
78 FR 41995 - Actions Taken Pursuant to Executive Order 13382
2013-07-12
...-hour fax-on-demand service, Tel.: 202/622-0077. Background On June 28, 2005, the President, invoking... Executive Order 13382. The list of additional designees is as follows: 1. DAEDONG CREDIT BANK (a.k.a. DAE-DONG CREDIT BANK; a.k.a. DCB; a.k.a. TAEDONG CREDIT BANK), Suite 401, Potonggang Hotel, Ansan-Dong...
78 FR 2721 - Designation of Entities Pursuant to Executive Order 13413
2013-01-14
... Economic Powers Act (50 U.S.C. 1701 et seq.) (IEEPA) and section 5 of the United Nations Participation Act... listing of the blocked entities appears as follows: 1. FORCES DEMOCRATIQUES DE LIBERATION DU RWANDA (a.k.a. COMBATANT FORCE FOR THE LIBERATION OF RWANDA; a.k.a. DEMOCRATIC FORCES FOR THE LIBERATION OF RWANDA; a.k.a...
International Nuclear Information System (INIS)
Clarencon, Frederic; Maria, Federico di; Cormier, Evelyne; Sourour, Nader; Gabrieli, Joseph; Iosif, Christina; Chiras, Jacques; Gaudric, Julien; Koskas, Fabien; Jenny, Catherine
2013-01-01
The aim of this study was to compare the sensitivity of intra-aortic computed tomography angiography (IA-CTA) to that of regular spinal digital subtraction angiography for the presurgical location of the Adamkiewicz artery (AKA). Thirty patients (21 males, 9 females; mean age 64 years) had an IA-CTA for the location of the AKA before surgery of aneurysm (n = 24) or dissection (n = 6) of the thoracoabdominal aorta. After femoral artery puncture, a pigtail catheter was positioned at the origin of the descending aorta. CT acquisition was performed with an intra-aortic iodinated contrast media injection (15 mL/s, 120 mL). The visualization of the AKA and the location of the feeder(s) to the AKA were independently evaluated by two observers. Interrater agreement was calculated using a kappa test. Spinal angiogram by selective catheterization was systematically performed to confirm the results of the IA-CTA. The AKA was visualized by the IA-CTA in 27/30 cases (90 %); in 26/31 (84 %) cases, the continuity with the aorta was satisfactorily seen. Interrater agreement was good for the visualization of the AKA and its feeder(s): 0.625 and 0.87, respectively. In 75 % of the cases for which the AKA was visualized, the selective catheterization confirmed the results of the IA-CTA. In the remaining 25 % of the cases, the selective catheterization could not be performed due to marked vessels' tortuosity or ostium stenosis. IA-CTA is a feasible technique in a daily practice that presents a good sensitivity for the location of the AKA. (orig.)
Eesti tööjõuturg: paindlik või turvaline ? / Mikk Salu ; kommenteerinud Katrin Jaaksoo
Salu, Mikk, 1975-
2010-01-01
Tartu Ülikooli sotsiaalteaduslike rakendusuuringute keskuse RAKE (töögrupi juht Raul Eamets) ja Poliitikauuringute Keskuse Praxis (töögrupi juht Andres Võrk) poolt läbi viidud tööjõu turvalise paindlikkuse (ingl. k. flexicurity) uuringust. Taani mudel
1998-09-01
GARBO*, R. BALOCCHIt and S. CHILLEMI* *Istituto di Biofisica CNR, Via S. Lorenzo 26, 56127 Pisa, Italy tIstituto di Fisiologia Clinica CNR, Via...Publishing Company DIFFUSION PARAMETER CONTROL OF SPATIOTEMPORAL CHAOS RAUL MONTAGNE* Instituto de Fisica, Facultad de Ciencias & Facultad de Ingenieria
Kaubanduse tagasihoidlik valitseja / Väinu Rozental
Rozental, Väinu, 1957-
2007-01-01
Tallinna Kaubamaja juht Raul Puusepp on äärmiselt järjekindel ja töökas. CV. Vt. samas: Kaubamaja eduloo taga on õiged otsused ja investeeringud. Diagramm; Kutse Lumumba ülikooli. Kommenteerivad: Enn Parel, Tarmo Punger, Tenno Tiits ja Jaan Kallas
"Päikeseratas" - Viimsi uus keskkool
2003-01-01
I preemia saanud projektist. Kolmekorruselise hoone põhistruktuuri moodustavad neli omaette plokki, mida ühendab siseaatrium. Autorid Illimar Truverk, Raul Järg, Priit Pent, kaasa töötasid Eero Endjärv, Kristi Lents, Kristjan Reidi (Agabush, Endjärv & Truverk Arhitektid)
Academia Non Grata Pärnus / Heie Treier
Treier, Heie, 1963-
1999-01-01
1998. a. oktoobris Pärnus tegevust alustanud alternatiivsest kunstikoolist Academia Non Grata, mille asutasid Al Paldrok, Reiu Tüür ja Margus Tiitsmaa, toetajaiks Ülo Vooglaid, Leonhard Lapin, Raul Meel. Koolimajast, õpetajaskonna koosseisust, õppekavast, Pärnu performance'i koolkonnast. Loetletud kooli esinemised.
Õlitootja Werol veab halduriga vägikaigast / Toivo Tänavsuu
Tänavsuu, Toivo
2005-01-01
Werol Tehaste ajutisel pankrotihalduril Olev Kuklasel on tekkinud menetluse käigus mitmeid tõsiseid küsimusi. Weroli nõukogu esimehe Raul Rosenbergi etteheiteid ajutisele pankrotihaldurile. Lisad: Werol: ajutine haldur tekitab kahju; Advokaat Mägi: Biodiesel on müügis
Paulus, Karin, 1975-
2016-01-01
Valik disainiauhinnale Bruno 2016 kandideerivatest esemetest (Gerda Retter "Jääkideta nahadisain", Raul Abner "Kummut Mix", Argo Ader ja Rain Aduson "Fitbi - spordi mugavalt!", Merili Sulg "Seinašabloon Kasemets", Rita Assor "Lugemispesa-mänguala Aas", Mare Kelpman "Terra pleedid", Henri Viljarand "Vineervalamu Gniss")
2008-01-01
President Raul Alfonsin did not retaliate against the military. Nor did President Carlos Menem in the 1990s. There was no question in either of these...1 Herbert C. Huser, Argentine Civil-Military Relations: From Alfonsin to Menem (Washington, DC: National Defense University Press, 2002
Vulgarismid nii ja naa / Enn Sarv
Sarv, Enn, 1921-2008
1998-01-01
Meenutus Aleksander Solženitsõni "Üks päev Ivan Denissovitši elus" tõlkimisest (eesti keeles 1963, tõlkijad Lennart Meri ja Enn Sarv). Peeter Sauteri poolt kirjutatud tekstist Raul Meele näituse 'Aborigeenide elu' jaoks (vt. Looming nr. 3)
22. X avati Tallinna Linnagaleriis...
2003-01-01
Kosmoseteemalisel grupinäitusel "Hallo, Kosmos, siin Maa!" osalevad tekstiilikunstnikud Keret Altpere, Raul Erdel, Monika Järg, Liisa Kallam, Eva-Liisa Kriis, Annike Laigo, Tarmo Mäesalu, Ülle Saatmäe, Liisa Tomasberg, fotograaf Pelle Kalmo, graafik Mari-Liis Laanemaa, muusik Taavi Laatsit
Palkadel küllaga ruumi kerkida / Kaspar Oja
Oja, Kaspar
2007-01-01
Kuigi statistikaameti avaldatud info kohaselt tõusis 2007. aasta esimeses kvartalis brutokuupalk võrreldes eelmise aasta sama perioodiga 20 protsenti, jätkub mitmetes ettevõtetes kiire palgatõus ka järgmisel aastal. Kommenteerib Raul Eamets. Diagramm: Keskmine palk kasvanud kahe aastaga ligi 40%. Lisa: Number
Tee bändi nagu kunstiteost, tee kunsti nagu jam session'it / Hanno Soans
Soans, Hanno, 1974-
2009-01-01
3. "NU Performance'i" festival "Recycle Pop" Kanuti gildis 11.-14. novembrini 2009. Kuraatorid Anders Härm ja Priit Raud. Norra Baktruppeni, rootslanna Catti Brandeliuse, prantslanna Carole Douillard'i, Andres Lõo, Maria Arusoo & Maria Juure, Erkki Luugi, Marco Laimre, Raul Kelleri, Kati Ilvese ja Killu Sukmiti esinemisest
Koolid saavad tagasi algusaegade väärikuse / Mari Rebane
Rebane, Mari
2003-01-01
Artur Perna projekteeritud Tallinna 21. keskkooli hoone renoveerimisprojekti autor on Raul Järg, sisekujundaja Toomas Korb, lühtrite disainer Tõnis Vellama. Edgar Johan Kuusiku projekteeritud Lenderi tütarlastegümnaasiumi (Tallinna kesklinna vene gümnaasium) renoveerimisprojekti autor on Andres Põime, sisekujundaja Tiiu Truus
Fidel Castro annab teatepulga üle / Krister Paris
Paris, Krister, 1977-
2008-01-01
Kuuba riigipea Fidel Castro teatas, et ei taotle riiginõukogu ega vägede ülemjuhataja ametikohta. F. Castro järglane on tõenäoliselt tema vend Raul Castro. Lisad: Riik pole muutusteks valmis; Võimuletõus ja tuumasõja lävele jõudmine
NU Performance/NO Performance? / Keiu Virro
Virro, Keiu, 1987-
2009-01-01
3. "NU Performance'i" festivalist "Recycle Pop" Kanuti gildis 11.-14. novembrini 2009. Kuraatorid Anders Härm ja Priit Raud. Erkki Luugi, Lotte Jürjendali ja Katrin Ratte, Kiwa, Andres Lõo ning ExTRAfINE ehk Marko Laimre, Kati Ilvese, Killu Sukmiti ja Raul Kelleri esinemisest
78 FR 48179 - National Institute of Neurological Disorders and Stroke; Notice of Closed Meeting
2013-08-07
... Disorders and Stroke Special Emphasis Panel; Review Career Development Awards. Date: August 14, 2013. Time: 2:00 p.m. to 3:00 p.m. Agenda: To review and evaluate grant applications. Place: National Institutes...). Contact Person: Raul A. Saavedra, Ph.D., Scientific Review Officer, Scientific Review Branch, Division of...
Plan X dlja "skoroi" / Irina Kablukova
Kablukova, Irina
2007-01-01
Kiirabi juhid peavad välja töötama plaani juhuks, kui toimub meditsiinitöötajate streik, kuid mitmed tähtsad küsimused, näiteks kiirabiarstile haiguslehe väljaandmise õiguse andmine, pole veel leidnud lahendust. Tallinna kiirabi peaarsti Raul Adlase selgitusi ja arvamusi
Kak zhurnalistõ vidjat Estoniju / Anna Litvinjuk
Litvinjuk, Anna
2006-01-01
2005. aasta parimate pressifotode näitusest Vaal-galeriis Tallinnas. Parima uudisfoto autor on üleriiklikus kategoorias Andras Kralla ja parima olemusfoto autor Raul Mee. Maakonnalehtede parimad on vastavalt Margus Ansu ja Sille Annuk. Kujundusauhinnad said suures kategoorias SL Õhtuleht ja väikeses kategoorias Järva Teataja
IV rahvusvaheline turismikonverents "Ma armastan Eestimaad!"
2009-01-01
25. septembril Meriton Conference&Spa Hotellis toimunud turismikonverentsist Lühiülevaade Juhan Partsi, Maria Alajõe, Paul Flattersi, Gerald Broddelezi, Raul Rebase, Raivo Vare, Birgit Prikki, Mikko Fritze, Andres Toode, Merle Adamsi ja Helen Mahmastoli ettekannetest, konverentsi moderaator oli Eesti Kaubandus- ja Tööstuskoja peadirektor Siim Raie
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Fernando Cunha1 Sohel Rana1 Raul Fangueiro1 2 Graça Vasconcelos2. Fibrous Materials Research Group (FMRG), School of Engineering, University of Minho, Guimarães 4800-058, Portugal; Department of Civil Engineering, University of Minho, Guimarães 4800-058, Portugal ...
Translations on Narcotics and Dangerous Drugs, Number 283
1977-02-03
Quiroz Carrillo, 20; Virginia Mora Alejo; Elida Alcorta de Torres, wife of Torres Solis, alias "El Pajaro;" Virginia Mora; Alicia and Dora Mora...INMATES-Raul Mendoza Diaz and the director of Federal Health, Dr Fernando Herrera Negrete, will engage in a campaign to detect drug addiction among
Rahvusvaheline raamat Saaremaa vallutamisest / Raul Sulbi
Sulbi, Raul
2007-01-01
Arvustus: Toman, Marek. Saaremaad vallutamas : [lühijutud = The conquest of Saaremaa Island] / [illustreerinud] Jan Ungrád ; tšehhi keelest tõlkinud Leo Metsar ; ingliskeelne tekst: Mimi Rogers. Tallinn : Tiritamm, 2007
Admiral Pitka - Isamaa eest / Raul Vinni
Vinni, Raul
2007-01-01
Eesti mereväe lipulaeva Admiral Pitka tutvustus. Sõjalaeva ülesandeks on olla staabi- ja toetuslaev miinilaevadele, mis rahuajal tegelevad miinitõrjega, lisaks osaletakse mitmesugustel õppustel ja missioonidel. Lisa: EML Admiral Pitka A230
Krediidipanga suur kosilane Moskvast / Raul Ranne
Ranne, Raul
2005-01-01
Krediidipanga hiljemalt juunis toimuval aktsiaemissioonil antakse uute aktsiate märkimise eesõigus Latvian Business Bankile, millest lõviosa kuulub Venemaa suurpangale Bank of Moscow. Lisa: Krediidipanga suurimad aktsionärid täna
Eesti Filharmoonia Kammerkoori kontsert / Raul Pettai
Pettai, Raul, 1928-
2006-01-01
19. märtsil St. Ignatius Loyola kirikus New Yorgis, kaastegev inglise organist ja helilooja Christopher Bowers-Broadbent, dirigent Paul Hillier. Esitati Arvo Pärdi, Cyrillus Kreegi ja Sergei Rahmaninovi kooriloomingut
Õhuloss kuristiku kohal / Raul Sulbi
Sulbi, Raul
2002-01-01
Arvustus: Pelevin, Viktor. Sinine latern / vene keelest tõlkinud Vladimir Indrikson. Tallinn : Atlantis, 2002 ; Pelevin, Viktor. Omon Ra ; Generation "P" / vene keelest tõlkinud Maiga Varik. Tallinn : Varrak, 2002
Izvinite, jeshtsho raz izvinite / Raul Kalev
Kalev, Raul
2007-01-01
Autor selgitab eestlaste ja venelaste erinevat suhtumist Teise maailmasõja tulemustesse ning valitsuse käitumist pronkssõduri probleemi lahendamisel ja leiab, et eestlased ja venelased peavad proovima mõista teineteist, soovima tundma õppida kõrvuti elavate rahvaste ajalugu, kombeid ja pühadusi
Raul Reemet : Jaapanis äritegemine on üldse kõige raskem asi / Raul Reemet ; interv. Mikk Salu
Reemet, Raul
2005-01-01
Mööbliärimees ja jaapani restorani Sushi House omanik selgitab, miks on ettevõtjal keeruline siseneda Jaapani turule. Kvaliteedi tähtsustamisest Jaapanis, jaapanlaste ärietikett. Diagrammid: Jaapani peamised majandusnäitajad
Valdes, Osvaldo Alfonso
2008-01-01
Kirjaniku ja endise poliitvangi sõnul pole võimu üleandmine Fidel Castrolt Raul Castrole Kuuba ühiskonnas midagi muutnud. Kuuba-vastaste diplomaatiliste sanktsioonide tühistamine oleks kirjaniku hinnangul väga negatiivne samm. Kuubas on majanduslik ja sotsiaalpoliitiline olukord end ammendanud, inimesed võtavad üha rohkem sõna
Nafta hind neelas aastaga miljardeid / Kadri Bank
Bank, Kadri
2008-01-01
Ilmunud ka: Delovõje Vedomosti 30. juuli lk. 6-7. Kütuse hinnatõusust põhjustatud majanduskulud Eestis. Eesti energiakulu võrreldavalt 26 Euroopa riigi energiamahukusega. Kommenteerivad Eesti Gaasi juhatuse liige Raul Kotov, Leiburi juht Ants Promann ja LHV analüütik Madis Toomsalu. Tabel: Eesti kulutab palju energiat
Polümeerne kultuuritegemine = Polymeric Culture-making / Karin Laansoo
Laansoo, Karin, 1976-
2005-01-01
Endises "Polümeeri" tehases Tallinnas 2002. aastast tegutsevast kultuuritehasest "Polymer". Hoones on töökojad, kunstistuudiod (Mare Raidma, Neeme Külm, Raul Keller), kultuuritrükikoda, tegutsevad klubid, toimuvad peod jm. 2005. a. juulist peab kultuuritehas pinnad vabastama, sest kinnisvarafirma Brem lõpetas 21. IV ühepoolselt rendilepingu
Eesti kunstnikud pidid teosed hõlma all Moskvasse toimetama / Vahur Koorits, Ksenia Repson
Koorits, Vahur, 1981-
2008-01-01
Eesti kunstnike näitus "Paradise is not lost" Moskvas Zurab Tsereteli galeriis, kuraator Eha Komissarov. Vene tolliametnikud ei tahtnud lubada üle piiri Raul Meele ja Villem Jahu teoseid, kuna pidasid neid poliitiliselt sobimatuteks. Kommenteerib Eha Komissarov. Samal teemal ka Ksenia Repsoni repliik "Näitus kogub külastajaid"
Rural Agroindustry in Latin America : An Evaluation of the PRODAR ...
International Development Research Centre (IDRC) Digital Library (Canada)
Rural Agroindustry in Latin America : An Evaluation of the PRODAR Network. Couverture du livre Rural Agroindustry in Latin America : An Evaluation of the PRODAR Network. Auteur(s) : Ed Weber (CRDI), Bernard Bridier (CIRAD) et Raul Fiorentino (IFAD). Maison(s) d'édition : CRDI. 1 janvier 1997. ISBN : Épuisé.
2011-06-15
... Transportation Network Group, Inc., and Premier Wealth Management, Inc. (a/k/a Premiere Wealth Management, Inc... concerning the securities of Premier Wealth Management, Inc. (a/k/a Premiere Wealth Management, Inc.) because...
Villa Viimsis : Palumetsa tee 9 = Villa, Viimsi : Palumetsa tee 9 / Epp Lankots
Lankots, Epp, 1976-
2005-01-01
Hoone välisilme ning kuju määrab majasisene piki välisseina teisele korrusele tõusev trepp, mille kallet ning suunda markeerib fassaadil jooksev puitsõrestik. Maapinna-korruse ulatuses on fassaadil terasvõrku pakitud graniitkivid. Arhitektid: Andri Kirsima, Hannes Niineväli. Sisearhitekt: Raul Tiitus. Ill.: 3 välisvaadet
21. IV tähistasid Eesti Rahvusraamatukogus...
2004-01-01
Konverentsi ja näitusega tähistasid oma 80. aastapäeva Väärismetallasjade ja Märkide Tehas Roman Tavast OÜ ning OÜ Juveel. Konverentsil esinesid Raul-Roman Tavast, Kalev Uustalu, Vilius Kavaliauskas, Kaalu Kirme jt. Harulduste osakonna näitusesaalis kuni 21. V väljapanek tehases 80 aastal toodetust
Search Results | Page 817 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 8161 - 8170 of 8494 ... Final report / Project "Raul Prebisch and XXIst century challenges" ... of the state and have had little or no say in decisions that matt ... Research findings show there is limited opportunity for female ... Copyright · Open access policy · Privacy policy · Research ethics · Transparency · Website usage.
Kummaline maag / Roger Pierre Turine
Turine, Roger Pierre
1998-01-01
Peeter Mudistist ja tema loomingust 1990. a. kunstniku ja tema loominguga esmakohtumise ja nüüd Tallinna Kunstihoones avatud Peeter Mudisti näituse 'Valguses on kood' põhjal. Näitusele kaasatud : Jaan Koorti 'Abikaasa portree' (1916), Raul Meel, kes koos Ly Lestbergi ja Jaan Toomikuga esitab video ja fotoseeria. Kunstniku arkaadiaotsinguist
Eesti graafika Rio de Janeiros / Jüri Kass
Kass, Jüri
1999-01-01
15. sept.-st Krakovi graafikatriennaali valiknäitusel Rio de Janeiro kaasaegse kunsti muuseumis esinevad Eestist Peeter Allik, Inga Heamägi, Eve Kask, Avo Keerend, Malle Leis, Ülle Marks, Raul Meel. 1997. a. Krakovi triennaalil ning sellele järgnenud sateliit- ja jätkunäitustel Eestist osalenud kunstnike loetelu.
PADF RF Localization Criteria for Multi-Model Scattering Environments
2011-04-01
Raul Ordonez b, Atindra Mitra c aDepartment of Electrical Engineering, Louisiana Tech University, Ruston, LA 71272 bDepartment of Electrical and...21] April Johnson, Cara Rupp, Brad Wolf, Lang Hong, Atindra Mitra, “Collision-Avoidance Radar for Bicyclist and Runners,” 2010 IEEE National Aerospace and Electronics Conference, 14-16 July 2010, Dayton, Ohio
2011-01-01
Arhitektuuriaastast 2010. Eesti Kultuurkapitali aastapreemia - Maarja Kask, Karli Luik, Ralf Lõoke, Kristiina Arusoo, Margit Argus, Pelle-Sten Viiburg (Sõmeru keskusehoone, maanteemuuseumi välialad). Arhitektuuri sihtkapitali arhitektuuripreemia - Hannes Koppel (Kuressaare rannahoone), Raul Vaiksoo (eramu), restaureerimispreemia - Jaan Jõgi (Laupa mõis), sisearhitektuuri preemia - Leila Pärtelpoeg (Röa mõis), tegevuspreemia - Karin Hallas-Murula, Eesti Arhitektuurikeskus
Pidupäevaüritused olid Eestile ilus kingitus / Andris Tammela, Eno-Gerrit Link
Tammela, Andris
2008-01-01
Ülevaade EV 90. aastapäeva juubeliüritusest Pärnus. Vt. samas: Vabariigi juubel värvis Pärnu sinimustvalgeks; Head emotsioonid Eesti aastapäevalt: Are vallavanem Jaanus Männik, Euroopa Parlamendi liige Marianne Mikko, Pärnu linnavolikogu liikmed Valter Parve ja Raul Sarandi ja Pärnu maavanem Toomas Kivimägi
1993-04-01
through his brother Raul for the past 30 years. The Spanish heritage and machismo tradition of the Cuban male is strong: the long struggle the Cubans...himself on the air in an attempt to change the course of Cuban history. " (Oppenheimer 132). None of this machismo tradition has been lost on Fidel Castro
15. juunini on tarbekunstimuuseumi galeriis...
2003-01-01
Ühisnäitusel "Ruum ei ole tühi" osalevad tekstiilikunstnikud Eva-Liisa Kriis, Monika Järg, Liisa Kallam, Liisa Tomasberg, Tarmo Mäesalu, Keret Altpere, Ülle Saatmäe, Annike Laigo, tootedisainerid Raul Erdel, Kelly Kert, arhitekt Urmas Luure, sisearhitekt Terje Kallast, fotograaf Pelle Kalmo, graafik Mari-Liis Laanemaa, muusik Taavi Laatsit
A randomised controlled trial of an SMS-based mobile epilepsy education system.
Lua, Pei Lin; Neni, Widiasmoro Selamat
2013-01-01
We evaluated an epilepsy education programme based on text messaging (SMS). Epilepsy outpatients from three hospitals in Malaysia were randomised into two groups: intervention and control. Patients in the control group were supplied with printed epilepsy educational material while those in the intervention group also received text messages from the Mobile Epilepsy Educational System (MEES). A total of 136 patients completed the study (mean age 31 years; 91% Malay; 51% with an illness duration of more than 5 years). A between-group analysis showed that the awareness, knowledge and attitudes (AKA) about epilepsy did not significantly differ between the groups at baseline (P > 0.05). The intervention patients reported better AKA levels during follow-up compared to the control patients (P < 0.05). A within-group analysis showed that in intervention patients, there were significant improvements in all AKA domains with larger effect sizes (P < 0.01) while control patients also exhibited significant improvement in most domains except for Awareness but with smaller effect sizes. After controlling for possible confounding variables (age, gender, educational qualification, monthly income and baseline mean for each domain), the intervention group still reported significantly higher AKA than the control group particularly in Awareness (P < 0.001) and Total AKA (P = 0.003). There was also significantly better medication adherence and clinic attendance in the intervention group (P < 0.05). The results suggest that the addition of the MEES to conventional epilepsy education is effective in improving AKA.
Yeast Interacting Proteins Database: YGL061C, YER016W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aidin
77 FR 44715 - Additional Designations, Foreign Narcotics Kingpin Designation Act
2012-07-30
..., S.A. DE C.V. (a.k.a. LA TIJERA PARQUE INDUSTRIAL; a.k.a. PROVENZA CENTER), Av. Adolfo Lopez Mateos... (Mexico) [SDNTK]. 8. PETROBARRANCOS, S.A. DE C.V., Av. Benjamin Hill No. 5602, Col. Industrial el Palmito...
2012-01-18
..., S.A. DE C.V. (a.k.a. MEDIC EXPRESS, S.A. DE C.V.; a.k.a. GRUPO LOMEDIC), Av. del Parque 489, Col. San Andres, Guadalajara, Jalisco 44810, Mexico; Calle Chicle 234, Colonia El Colli Industrial, Zapopan...
Yeast Interacting Proteins Database: YKR037C, YLR423C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force... subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymeri
Pärnu linnavalitsuse hinnang esimesele valitsemisaastale / Eno-Gerrit Link
Link, Eno-Gerrit
2006-01-01
Ajaleht esitas Pärnu linnajuhtidele kolm küsimust. Vastasid linnapea Mart Viisitamm, abilinnapea majanduse valdkonnas Raul Sarandi, abilinnapea arengu ja planeerimise valdkonnas Mart Alliku, abilinnapea kultuuri, spordi ja sotsiaalvaldkonnas Margus Tammekivi ja linnavalitsuse liige turvalisuse valdkonnas Simmo Saar. Arvamust avaldavad Reformierakonna Pärnu piirkonna esimees Väino Hallik ja SDE esindaja Pärnu linnavolikogus Valter Parve
Kartinõ pribõli v Moskvu taikom / Vahur Koorits
Koorits, Vahur, 1981-
2008-01-01
9. detsembril avati Moskvas Zurab Tsereteli galeriis eesti kunstnike näitus ±Paradise is not lost¬. Kuraator Eha Komissarov. Vene tolliametnikud ei lubanud üle piiri Raul Meele ja Villem Jahu teoseid, sest pidasid neid poliitiliselt sobimatuks. Kunstnikud viisid oma tööd Moskvasse isikliku pagasi hulgas. Kommenteerinud Ksenia Repson "Moskvitshi poznakomjatsja s estonskimi hudozhnikami"
München ei ole ainult Oktoberfest / Albert Trapeezh
Trapeež, Albert, pseud., 1947-
2005-01-01
Eesti nüüdiskunsti näitusest Müncheni kunstikeskuses Aktionsforum. Osalesid Siim-Tanel Annus, Jaan Elken, Jüri Kass, Ülle Marks, Eve Kask, Lennart Mänd, Tiiu Kirsipuu, Leonhard Lapin, Raul Meel, Liina Siib, Andres Tolts ja Urmas Viik. Näituse kataloogi eestipoolsed tekstid kirjutas Harry Liivrand. Müncheni moodsaimast kunstikeskusest Pinakothek der Moderne'ist
A Strategy for Dealing with Cuba in the 1980s.
1982-09-01
many ideas as well as a supportive colleague in the writing of earlier drafts. Paul Davis and Harry Gelman were intellectually demanding but constructive...Raul Castro (2nd Sec.) M-26-7:Rg 1st V. Pres., Councils of Min.b & State; Minister, MINFAR (c) Juan Almeida (Hem.) M-26-7:Fg. V. Pros., Councils of Min.b
Uued koolid 2006 / Karen Jagodin
Jagodin, Karen, 1982-
2006-01-01
Viimsi kool (arhitektid Illimar Truverk, Raul Järg, Priit Pent, Eero Endjärv; sisearhitektid Kristi Lents, Hannelore Pihlak), Rakvere eragümnaasiumi algklasside maja (arhitektid Laur Pihel, Tauno Aadma), Tallinna Rahumäe põhikool (arhitektid Maaja Nummert, Triinu Nurmik), Tabasalu Ühisgümnaasium (arhitekt Veljo Kaasik), Jüri gümnaasium (arhitekt Katrin Tomberg Tohter)
English for lawyers / Liina Soobik ; [preface: Peep Pruks
Soobik, Liina, 1955-
2001-01-01
Kasutatud tekstide autorid: Peep Pruks, Merit-Ene Ilja, Ilona Nurmela, Kristi Raba, Andreas Kangur, Raul Narits, Peeter Roosma, Kalle Merusk, Maret Altnurme, Jaan Ginter, Aare Tark, Norman Aas, Lasse Lehis, Hannes Veinla, Jaan Sootak, Eerik Kergandberg, Paul Varul, Jaanus Ots, Urve Liin, Irene Kull, Merle Muda, Gaabriel Tavits, Andres Vutt, Kadri Siibak, Ellen Ridaste, Heiki Pisuke, Andrus Siibak
Rotermanni vana ja uus jahuladu = The Rotermann Old and New Flour Storage / Margit Mutso
Mutso, Margit, 1966-
2010-01-01
Tallinna Rotermanni 8 asuvast Rotermanni uuest ja vanast jahulaost, mis pälvis 2009. a. EK arhitektuuri sihtkapitali arhitektuuripreemia linnaruumi tunnetava, uut ja vana tervikuks siduva arhitektuuri eest. Arhitektid: Hanno Grossschmidt, Tomomi Hayashi, Yoko Azukawa (HG Arhitektuur). Büroode üldkujundus: Tarmo Piirmets, Raul Tiitus (OÜ Pink). Žürii liige Kalle Komissarov žürii hinnangust hoonele
Yeast Interacting Proteins Database: YGR113W, YGL079W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ntial subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depol
1982-08-25
hoth real and complex; and () compute the propagation speed in the acoustic cal Ibr:ator. (continued on reverse) DD IARM3 1473 EDITION OF I NOVSSIS...FORMAT (3F15.0) 0131 GO TO 230 0132 690 CONTINUE 0133 END 50 *> SUBROUTINES SUBROUTINE: DET C C SUBROUTINE DET C DECEMBER, 1980 C EDITED BY TINA RUGGIERO...33 AISA =AKDA/BAMS 0008 02A=AKA**’-AKDA**2 0009 S2A=AKA**2-AKSA**2 0010 IF (RHM) 65P65P40 0011 40 AKFA-AKDA/COCD 0012 OF2A-AKA**2-AKFA**2 0013 IF (OF2A
Son, Min-Sun; Lau, Edmund; Parvizi, Javad; Mont, Michael A; Bozic, Kevin J; Kurtz, Steven
2017-12-01
For patients with failed surgical treatment of an infected TKA, salvage operations such as arthrodesis or above-knee amputation (AKA) may be considered. Clinical and institutional factors associated with AKA and arthrodesis after a failed TKA have not been investigated in a large-scale population, and the utilization rate and trend of these measures are not well known. (1) How has the frequency of arthrodesis and AKA after infected TKA changed over the last 10 years? (2) What clinical or institutional factors are associated with patients undergoing arthrodesis or AKA? (3) What is the risk of mortality after arthrodesis or AKA? The Medicare 100% National Inpatient Claims Database was used to identify 44,466 patients 65 years of age or older who were diagnosed with an infected TKA and who underwent revision between 2005 and 2014 based on International Classification of Diseases, 9 th Revision, Clinical Modification codes. Overall, 1182 knee arthrodeses and 1864 AKAs were identified among the study population. One year of data before the index infection-related knee revision were used to examine patient demographic, institutional, and clinical factors, including comorbidities, hospital volumes, and surgeon volumes. We developed Cox regression models to investigate the risk of arthrodesis, AKA, and death as outcomes. In addition, the year of the index revision was included as a covariate to determine if the risk of subsequent surgical interventions was changing over time. The risk of mortality was also assessed as the event of interest using a similar multivariate Cox model for each patient group (arthrodesis, AKA) in addition to those who underwent additional revisions but who did not undergo either of the salvage procedures. The number of arthrodesis (hazard ratio [HR], 0.90, p death increased with amputation after adjusting for age, comorbidities, and other factors (HR, 1.28 [1.20-1.37], p < 0.001), but patients who received arthrodesis did not show a change in
2013-10-02
... Furniture Co., Ltd. Dorbest Ltd., Rui Feng Woodwork Co., Ltd. Aka Rui Feng Woodwork (Dongguan) Co., Ltd., Rui Feng Lumber Development Co., Ltd. Aka Rui Feng Lumber Development (Shenzhen) Co., Ltd., Fine... Fung Wooden Factory, Sun Fung Co., Shin Feng Furniture Co., Ltd., Stupendous International Co., Ltd...
Yeast Interacting Proteins Database: YGR113W, YLR424W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...13W Bait gene name DAM1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force
Kirjanduslik orgia?! Tänan, ei! / Raul Sulbi
Sulbi, Raul
2002-01-01
Arkaadia järjejutt (juuni - august 2002, autorid Wimberg, Veiko Märka, Urmas Vadi, Jürgen Rooste, Aapo Ilves, Aarne Ruben, Matt Barker, Hedda Maurer, Ivar Sild, Karen Orlau, Indrek Hargla, Jan Kaus, Mehis Heinsaar)
Admiral Cowan saab selga troopikavormid / Raul Vinni
Vinni, Raul
2008-01-01
Vahemerele suunduva miinijahtija "Admiral Cowan" meeskond saab esmakordselt Eestis valge troopikavormi. Miinijahtija osaleb NATO kiirreageerimisüksuse NRF-11 mereväekomponendis ja kuulub NATO miinitõrjeeskaadri SNMCMG1 koosseisu. 25. juulist kuni novembrini on miinijahtija Põhja regioonide miinitõrjeüksuse koosseisus
Kuidas tuua Eestisse Tiger Woods / Raul Ranne
Ranne, Raul
2008-01-01
Reaalselt arvestades on tõenäosus, et Eestit väisab golfistaar Tiger Woods, muidugi olematu. Teoreetiliselt on see siiski võimalik. Vestlusest Jõelähtme golfiväljakut opereeriv Estonian Golf Country Clubi presidendi Mait Schmidtiga
Vene kriis kukutas Norma juhid / Raul Ranne
Ranne, Raul
1998-01-01
AS Norma vallandas ettevõtte tegevjuhi Peep Aaviksoo, sest ei olnud rahul ettevõtte tegevusega Venemaal. Tabelid: Norma aktsia on kukkunud, Norma kuukasum miinuses. Ilmunud ka: Delovõje Vedomosti, 9. sept. 1998, lk. 10
Independence Day 2004 (ID04) / Raul Hindov
Hindov, Raul
2004-01-01
Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist
Viljasaar, Regina
2006-01-01
Projekteerija: Agabus, Endjärv, Truverk Arhitektid OÜ. Arhitektid: Raul Järg, Illimar Truverk, Priit Pent, Eero Endjärv. Konstruktor: Civen OÜ. Sisekujundus: Kristi Lents, Hannelore Pihlak (Agabus, Endjärv, Truverk Arhitektid OÜ). Maastikuprojekt: Ülle Grishakov. Akustiline projekt: Malle Jaanisoo. Projekt ja valmis 2006. Ill.: II korruse plaan, 3 värv. välis- ja 4 sisevaadet
Ammende pakub suvemuusikat / Silja Joon
Joon, Silja, 1966-
2007-01-01
Kontsertidest Pärnus Ammende villas: 5. juulil "Mõeldes Sinule" (Laura Põldvere, Jorma Toots, Marti Tärn, Ahto Abner), 12. juulil Kadri Voorand, Jürmo Eespere, Mihkel Mälgand ja Tanel Ruben, 19. juulil Tõnu Naissoo, Raul Vaigla ja Marko Naissoo kontserdiga "Tõnu Naissoo Eclectic Electric Trio", 26. juulil Holger Marjamaa kvartett (Holger Marjamaa, Mairo Marjamaa, Peedu Kass ja Dmitri Nikolajevski)
Kulinaarne palverännak piki Telliskivi tänavat / Martin Hanson, Ines Haak
Hanson, Martin, 1984-
2013-01-01
Toidukriitik Martin Hanson ja sisearhitekt Ines Haak Tallinna Telliskivi tänavat palistavatest söögipaikadest: restoran Kolm Sibulat (sisearhitektuur: Aivar Mühlbach, omanikud, 2012-2013), bistroo Kukeke (Anni Arro, Riina Eerik, 2011-2012), kohvik Reval (Ville Lausmäe, Kadi Karmann, Peeter Klaas, 2013), restoran F-Hoone (Ville Jehe, Steve Heinlo, 2010), baar Pudel (Raul Tiitus, Tarmo Piirmets, 2012-2013)
Nongratalased Turus, Vilniuses, Riias
2000-01-01
Academia Non Grata osales Turu Hyräryllista galeriis David Crawforthi kureeritud rahvusvahelisel festivalil "Realm of the senses - a city wide experiment", Leedus Vilniuse Draamateatris performancei-festivalil "Laboratoorium". 8. XI Riias Matti Milius ja Raul Meel pidasid loenguid akadeemias, ANG esitles installatsiooni "Kreee", R. Meel ja Leonhard Lapin avasid personaalnäituse Reuters House'is. Valgas esitas ANG performance'i "SoftPower".
Rituaalide suurmeister / Irena Buzinska
Buzinska, Irena
1999-01-01
Läti väliskunsti muuseumis olid eksponeeritud Raul Meele graafika ning tuleetenduste foto- ja videdokumentatsioon. Näituse ئ deviis "Tuli ja rituaalid" ئ vastukajadest läti ajakirjanduses ja televisioonis. Kunstiajakirjas "Studija" ilmub Meele loominguline portree. Näiteid näituse kuraatori I. Buzinska tehtud kokkuvõttest näituse retseptsioonist, s.h. Academia Non Grata performance'ist. Reet Varblase kommentaar.
2011-07-11
... INVESTMENT COMPANY; a.k.a. MEHR IRANIAN ECONOMY COMPANY; a.k.a. MEHR IRANIAN ECONOMY INVESTMENTS; f.k.a... Square, Tehran, Iran; No. 48, 14th Alley, Ahmad Qassir Street, Argentina Square, Tehran, Iran; Business Registration Document 103222 (Iran); Web site http://www.mebank.ir ; Telephone: 982188526300; Alt. Telephone...
76 FR 38279 - Designation of One Individual and One Entity Pursuant to Executive Order 13224
2011-06-29
... policy, or economy of the United States; (3) persons determined by the Director of OFAC, in consultation.... SHAHRIYARI, Behnam (a.k.a. SHAHRIARI, Behnam; a.k.a. SHAHRYARI, Behnam); DOB 1968; nationality Iran..., Tehran, Iran [SDGT]. Dated: June 23, 2011. Adam J. Szubin, Director, Office of Foreign Assets Control...
2011-11-23
.... Box 15715, Az Zawiyah, Libya [LIBYA2] 7. BREGA PETROLEUM MARKETING COMPANY (a.k.a. BPMC; a.k.a. BREGA... Montplaisir (Bourjel), 1002, Tunis, Tunisia; Avenue Kheireddine Pacha, Cite Ennasim Montplaisir, 1002, Tunis, Tunisia; P.O. Box 485, 1080, Tunis Cedex, Tunisia; Bizerte Centre, 7000, Bizerte, Tunisia; Ennasim Mont...
2010-03-03
... worldwide basis. It provides a statutory framework for the President to impose sanctions against significant... identified by the President. In addition, the Secretary of the Treasury consults with the Attorney General...; a.k.a. MENDEZ VARGAS, Jesus; a.k.a. MENDEZ, Jesus), Tazumbos, Jalisco, Mexico; Calle Dr. Lose Luis...
2011-08-15
... Physics and Chemistry (a.k.a., China Academy of Engineering Physics (CAEP)'s 902 Institute); --Southwest... as one of nineteen individual aliases for the listed person the ``Chinese Academy of Engineering... described above, to read as follows: China (1) Chinese Academy of Engineering Physics, a.k.a., the following...
Olufemi, Adejoke Christianah; Mji, Andile; Mukhola, Murembiwa S.
2016-01-01
In this paper, we compared the levels of awareness, knowledge and attitudes (AKA) about environmental pollution of secondary school students from two South African provinces. The purpose was to determine the levels of AKA between students living under different environmental conditions. These two groups were students from a coal-mining province…
2011-11-21
... Kabul, Afghanistan, and A2 Ground Floor, City Computer Plaza, Shar-e-Naw, Kabul, Afghanistan; (3) Fazal..., Peshawar, Pakistan; (3) Fazal Rahim Farid, a.k.a., the following three aliases: --Fazel Rahim Farid... Afghanistan EAR). Fazal Rahim Farid, a.k.a., the For all items Presumption of denial........ 76 FR [INSERT FR...
Self-employment and quasi self-employment: a challenge for labour law
Westerveld, M.; Zaal, I.
2015-01-01
Over the years the (Dutch) labour market has witnessed a growing number of workers outside the realm of the employment contract. At the end of the past century the number of (in Dutch) ‘self-employed without personnel’ (a.k.a. independent contractor, a.k.a. sole trader) was around one in seventeen
2311-IJBCS-Article-Aka Marcel Kouassi
African Journals Online (AJOL)
hp
Chem. Sci. 9(2): 1120-1129, April 2015. ISSN 1997-342X (Online), ISSN ... clear dominance of high molecular weight (HMW) PAHs (pyrene, Benzo (k) ... the organic matter accumulated in deep ... hydrophobic nature, PAHs are mostly.
President Ilves sattus YouTube'i tarkust jagama / Tõnu Lilleorg
Lilleorg, Tõnu
2008-01-01
President Toomas Hendrik Ilvese majandusteemalisest videoläkitusest portaalis YouTube. Arvamust avaldavad Balti meedia- ja filmikooli õppedirektor Hagi Šein, Riigikogu liige Vilja Savisaar ja kommunikatsioonikonsultant Raul Rebane. Vt. ka juhtkiri lk. 12: Kes tegi? Ilves ise tegi! Õhtulehe arvates vastutab majanduskriisi eest ka president ise. Lisatud karikatuur. Juhtkiri ilmunud ka: Molodjož Estonii 11. dets. 2008, lk. 4, pealk.: Kto vinovat?
Noored etlejad võistlesid Jüris / Kristina Amor
Amor, Kristina
2008-01-01
Jüri Gümnaasiumis toimunud Eesti VIII õpilasetlejate konkursi Harjumaa voorust. Žüriisse kuulusid: Maret Oomer, Lilian Urba, Ingrid Pukk. 4.-6. klasside arvestuses sai I koha Kenneth Norden, II koha Merilin Mölder ja III koha Loora-Eliisabet Lomp. 7.-9. klasside arvestuses sai I koha Indrek Jõe, II koha Raul Kuldvee, III koha Birgit Luht. 10.-12. klasside arvestues sai I koha Ilja Massalov
Aia alt pilvekatusega kunstisaali / Meeli Müüripeal
Müüripeal, Meeli, 1963-
2006-01-01
Sabile restaureeritud sünagoog-kunstisaalist (1890).1993. a. läti skulptori Ojars Arvids Feldbergsi (sünd. 1947) poolt avatud Pedvale keskkonnakunsti keskusest, sealsetest Brinkpedvale (18. sajand) ja Frikspedvale mõisahoonetest. 1999. a. pälvis Pedvale vabaõhu kunstisaal UNESCO Melina Mercouri auhinna. Pedvales on tuleetendusega esinenud Raul Meel, eesti kunstnike töödest nimetatud Villu Jaanisoo töö "Tugitool". 16 ill
Kaliningradi biennaal / Sandra Jõgeva
Jõgeva, Sandra, 1976-
2008-01-01
IX rahvusvaheline graafikabiennaal "Kaliningrad-Königsberg 2008" Kaliningradi kunstigaleriis 15. IX-15. XI. Eesti väljapanek (kuraator Eha Komissarov, kujundaja Marko Nautras, osalejad: Jaanika Okk, Kaarel Kütas, Lauri Koppel, Gerda Märtens, Raul Meel, Lembe Ruben, HULA, Villem Jahu, Tiiu Pirsko, Mati Veermets, Sandra Jõgeva) sai ekspositsioonipreemia. Grand prix - Paulis Liepa, I preemia - Olrik Kohlhoff, II - Dominica Sadowska, III - Raffael Rheinsberg, eripreemia - Markus Lampinen
Kremlis pannakse paika maagaasi hinnatõus Eestis / Vallo Toomet
Toomet, Vallo, 1960-
2005-01-01
Vene riigiduuma esitas 8. juulil peaminister Mihhail Fradkovile pöördumise, milles palutakse vaadata üle Eestisse, Lätisse, Leedusse, Ukrainasse ja Moldovasse tarnitava gaasi hind. Lisa: Eesti Gaasil on üle 120 000 kliendi. Vt. samas: Gaasitrass Saksamaale. Kaart: Gazprom osaleb uue gaasitoru rajamisel; Gazprom - Vene riigi rahasalv. Vt. samas lühiintervjuud Eesti Gaasi müügiteenuste ettevõtte direktori Raul Kotoviga
Aasta puitehitis 2013 on suvemaja Laulasmaal
2013-01-01
Konkursi "Aasta puitehitis 2013" võidutöö: Öö-Öö Arhitektide (Ülo-Tarmo Stöör, Lembit-Kaur Stöör, Kätlin Ölluk) projekteeritud rannamaja Laulasmaal. Liimpuidu eripreemia: Kadarik Tüür Arhitektide projekteeritud jalgrattahoidla Rakveres. Fassaadipreemia: Tarmo Piirmetsa projekteeritud suveköök Hiiumaal. Vineeri eripreemia: Andres Sevtšuki ja Raul Kalvo projekteeritud vineerist paviljon Singapuris
Eesti tooraine: ebakvaliteetne või ülehinnatud? / Martin Hoffmann
Hoffmann, Martin
2010-01-01
Eesti müüdava liha, kala, köögivilja päritolust, kodumaise toodangu kvaliteedist. Asjatundjate hinnangul on Eestis küll väga head liha ja juurvilja, kuid nende kvaliteet kõigub ja tarnestabiilsus on halb. LM Keskuse müügijuhi Helgor Markovi, Horeca Sevice'i juhatuse liikme Raul Vaeti ja restoran Gloria peakoka Dmitri Demjanovi arvamusi ja hinnanguid
Eesti Päevaleht korjas kolm pressipreemiat / Mari Rebane
Rebane, Mari
2006-01-01
Eile jagas Eesti Ajalehtede Liit 2005. aasta ajakirjandussaavutuste eest preemiaid. Eesti Päevaleht sai kujundusauhinna esikaane ja uudiskülgede eest ning arvamusloo preemia. Esikülje kujundusauhinna sai "Eesti Päevalehe" peakunstnik Merike Pinn. Parimateks uudisfoto autoriteks tunnistati Andras Kralla "Äripäevast" ja Margus Ansu "Tartu Postimehest", parimateks olemusfoto autoriteks Raul Mee "Äripäevast" ja Sille Annuk "Tartu Postimehest"
Eksperimendid ruumis / Toomas Tammis
Tammis, Toomas, 1969-
2014-01-01
EKA arhitektuuriteaduskonnas tehakse erialaprojekti kõrval väga erinevaid ruumilisi harjutusi. Esitletud on valik väiksemate töötubade ja kursuste töid: Kineetilise arhitektuuri töötuba "Volditav, klapitav, rullitav, pakitav", 2014 (juhendaja Renee Puusepp); Parameetrilise disaini valikaine, 2011 (juhendaja Raul Kalvo, assistent Kristjan Männigo); Maketistuudio, 2014 (juhendaja Paco Ulman); Eksperimentaalse arhitektuuri problemaatika, 2014 (juhendajad Martin Melioranski ja Paco Ulman)
Be a Mentor and Experience the Excitement of Rediscovery | Poster
You don’t really know something until you can teach it to someone. Raul Cachau said he believes this is not only true in academia, but in research laboratories as well. He said that being a mentor means rediscovering things long taken for granted. “It really forces you to rethink some of the things you do,” said Cachau, Ph.D., principal scientist, Advanced Biomedical Computing
International Nuclear Information System (INIS)
Nakamura, Yodai; Asahara, Yoshihiro; Ozawa, Tomowo; Kameo, Koji
1999-01-01
The Neogene Shimajiri Group is distributed sporadically in the Ryukyu islands. This study focuses on the Shimajiri Group in Kumejima Island, central Ryukyu, and clarifies its stratigraphy and geologic age on the basis of 1) lithostratigraphy, 2) calcareous nannofossil biostratigraphy, and 3) strontium isotope stratigraphy. The Shimajiri Group in Kumejima Island unconformably overlies the middle Miocene Aradake Formation, and is overlain by the Pleistocene Ryukyu Group. The group is divided into three formations, namely the Maja, the Aka and the Uegusukudake Formations in ascending order, and the first two are redefined in this paper based on the new geologic evidence. The Maja Formation consists mainly of fine-grained sandstone, sandy siltstone and alternating beds of them. The Aka Formation is mainly composed of cross-stratified sandstone, pumiceous sandstone and tuffaceous siltstone, and unconformably overlies the Maja Formation. The Uegusukudake Formation, conformably overlying the Aka Formation, consists of basaltic lava, tuff breccia and andesite. On the basis of calcareous nannofossil biostratigraphy, the Maja and Aka Formations can be assigned to Zone CN9 and Zone CN12b of Okada and Bukry (1980) respectively. Strontium isotope ages of the molluscan fossil specimens obtained from the Maja and Aka Formations revealed that the Maja Formation is assigned to the late Miocene (ca. 7.8-7.2 Ma) and the Aka Formation is assigned to the late Pliocene (ca. 3.2-3.1 Ma). These ages are concordant with the nannofossil biostratigraphy. The upper Miocene Maja Formation yields many molluscan fossils in which the characteristic species of the Kakegawa Fauna, such as Amussiopecten praesignis and Mimachlamys satoi are contained. The molluscan fauna of the Maja Formation is significant in understanding the origin of the Kakegawa Fauna, as the characteristic species of the Plio-Pleistocene Kakegawa Fauna already appeared in the Ryukyu Islands in the late Miocene. (author)
2010-06-28
... reasons. OnTime Electronics Technology Company and Tam Wai Tak, a.k.a., Thomsom Tam, are being added due... June 5, 2008, OnTime Electronics Technology Company and Tam Wai Tak were indicted in the Southern... Commercial Center, 28 Ferry Street, Jordon, Kowloon, Hong Kong; and (2) Tam Wai Tak, a.k.a., Thomsom Tam...
2012-04-17
... Gatewick Freight & Cargo Services, a/k/a/ Gatewick Aviation Services, G 22 Dubai Airport Free Zone, P.O... Airport Free Zone, P.O. Box 393754, Dubai, United Arab Emirates; and P.O. Box 52404, Dubai, United Arab.... Kerman Aviation, a/k/a GIE Kerman Aviation, 42 Avenue Montaigne 75008, Paris, France. Sirjanco Trading, P...
2011-11-14
... LTD; a.k.a. PETROCHEMICAL TRADING COMPANY LIMITED; a.k.a. ``PCCI''), P.O. Box 261539, Jebel Ali, Dubai... Group, ROG Corporate Office, Royal Oyster General Trading LLC, P.O. Box 34299, Dubai, United Arab..., Building W5B, Dubai Airport Free Zone, P.O. Box 54916, Dubai, United Arab Emirates: The Director of OFAC...
Yeast Interacting Proteins Database: YDR034C, YGR113W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aidin...Rows with this bait as prey (0) YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), coupl...es kinetochores to the force produced by MT depolymerization thereby aiding in ch
Directory of Open Access Journals (Sweden)
Maria Stella Brandão Goulart
2010-04-01
Full Text Available Esta pesquisa investigou como o processo de Reforma da Política de saúde mental repercutiu no mais antigo hospital psiquiátrico público de Belo Horizonte, o Instituto Raul Soares, resultando em iniciativas institucionais que procuravam responder à crítica aos asilos e à cultura manicomial que emergiu desde os anos 60 (século XX, em Minas Gerais. Trata-se de um esforço historiográfico, realizado em 2007, que trabalhou com fontes documentais e orais (entrevistas com psiquiatras, psicólogos, enfermeiros e outros, recuperando informações sobre as décadas de 60, 70 e 80. O referencial teórico foi o da Análise Institucional. Foram enfocadas iniciativas instituintes que tomaram a forma de projetos assistenciais e de formação que objetivavam a reestruturação do hospital: o Ambulatório Central Roberto Resende; a Residência em Psiquiatria, o Projeto Guimarães Rosa e o Hospital Dia. São evidenciados os paradigmas de referência e o contraditório processo de desinstitucionalização.The aim of the present research is to determine how the mental health Policy Reform affected the Raul Soares Institute, the first public psychiatric hospital (asylum in Belo Horizonte, tracing institutional initiatives that aimed to respond to criticisms on the mental houses and their set of procedures in usage since the 1960s, in the state of Minas Gerais. The research became a historiographic effort, carried out in 2007, dealing with oral and documental sources (interviews with psychiatrists, psychologists, nurses and others and collecting information about facts that occurred in the 1960s, 1970s and 1980s. Institutional analysis was taken as the theoretical support. The present study focused on initiatives that assumed the format of assisting and constitutional projects that aimed to remodel the Raul Soares Institute. In addition, paradigms of references and the contradiction-marked process of deinstitutionalization were made evident.
Klasični (ekstenzivni) voćnjaci u Hrvatskoj
Čmelik, Zlatko
2011-01-01
Hrvatska ima vrlo povoljne pomoekološke uvjete za uzgoj voćaka. Tradicija uzgoja voćaka duga je više stoljeća, a voćke su se uzgajale na gotovo svim seoskim gospodarstvima, te dijelom i u urbanim sredinama. Intenzivan uzgoj voćaka počeo se značajnije širiti polovinom prošlog stoljeća. Intenzivan uzgoj je u određenoj mjeri potisnuo interes za klasičnim, ali se postojeći voćnjaci visokostablašica uglavnom nisu krčili već su u većoj mjeri bili zapušteni. U novije vrijeme klasični voćnjaci pon...
2010-07-01
...; all offices worldwide [IRAN] BANK REFAH KARGARAN (a.k.a. BANK REFAH; a.k.a. WORKERS' WELFARE BANK (OF...., Vanak Sq., Tehran, Iran; 99-A, Maker Tower F, 9th Floor, Cuffe Parade, Colabe, Mumbai 400 005, India; No... Arab Emirates; Office No. 99-A, Maker Tower “F” 9th Floor Cutte Pavade, Colabe, Bumbai 700005, India...
African Journals Online (AJOL)
User
okada na obere jenareto ai passi mai nebo·. 17 ... Oluchukwu Micro-Finance Bank gbasara aka inyere ndi 10. Mmadu aka n'uzo di .... Nigeria· This in no small measure has been helping unemployed people, graduates ... Even in the transport sector people have been empowered to be self reliant· This could be seen in the ...
Inimesed linnas = People in the city / Kaja Pae
Pae, Kaja
2006-01-01
Eesti näitus "Joint Space" Veneetsia 10. arhitektuuribiennaalil. AB Urban Mark: Ülar Mark, Indrek Tiigi, Kaja Pae, Yoko Alender, Raul Kalvo, Tartu Ülikooli Geograafiainstituut: Rein Ahas, Anto Aasa, Siiri Silm, Positium ICT: Margus Tiru, Erki Saluveer. Näitusel oli eksponeeritud kolm mobiilpositsioneerimisega läbi viidud case study (EKA liikmete liikumisuuring, Eestit külastanud turistide uuring, Tallinna regiooni pendelrändajate uuring). Bibliograafia lk. 33
Tallinn nimetas Poska stipendiumi saajad
2006-01-01
Tallinna linnavalitsus nimetas 10. mai istungil Jaan Poska stipendiumi saajad. Stipendium määrati kümnele Tallinna Tehnikaülikooli üliõpilasele : Eve Eenmaa, Andrus Räämet, Jelena Hartšenko, Andres Viia, Maksim Jenihhin, Raul Naadel, Martins Sarkans, Dmitri Šumigin, Külliki Tafel, Minna Varikmaa. Jaan Poska stipendium määratakse üliõpilasele silmapaistva ühiskondliku tegevuse eest Eesti ja Tallinna arengu heaks
DEFF Research Database (Denmark)
Schierup, M.H.; Mailund, T.; Li, H.
2009-01-01
Background: A small region of about 70 kb on human chromosome 19q13.3 encompasses 4 genes of which 3, ERCC1, ERCC2, and PPP1R13L (aka RAI) are related to DNA repair and cell survival, and one, CD3EAP, aka ASE1, may be related to cell proliferation. The whole region seems related to the cellular...
Grymes, Rosalind A.; Martin, Rodney Alexander; Dianati, Soheila
2016-01-01
These files contain more precise and accurate representations of the architectural, mechanical, electrical, plumbing, and site information pertaining to Sustainability Base, aka Collaborative Support Facility, aka N232. These supersede the 'bid' drawings released in STI 8112 previously. They are useful for NASA researchers and collaborators in modeling the performance characteristics of the facility. Otherwise, they do not contain new data.
Experiment list: SRX188969 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available lastoma (aka D721), surgical resection from a patient with medulloblastoma as descr...ion=fseq v 1.84 || cell=Medullo || cell organism=human || cell description=medulloblastoma (aka D721), surgi...cal resection from a patient with medulloblastoma as described by Darrell Bigner ...SRX188969 hg19 Input control Input control Neural Medullo Tissue=brain|Lineage=ectoderm|Description=medullob
Ayurvĕda gleaned through Buddhism.
Narayana, Ala; Lavekar, G S
2005-01-01
The Păli canon consists of three Pitakas (baskets), which replete the Buddhism and is known as Tripiţaka, viz, Vinaya, Sutta and Abhidhamma Piţakas. The original phase of Tripiţaka (Buddhisim started in 544 B.C. and lastly systematized up to 29 B.C. The Buddhist literature also possesses the esoteric material of Medical Science, which is practiced and conserved in India since centuries. It refers to the fundamentals of medicine, rules of good living, which lay considerable emphasis on the hygiene of body, mind. Internal Medicine, curative medicine including symptoms, methods of diagnosis, theories of causation, materia-medica, therapeutics and treatment and skills of Jivaka. Some famous and popular prescriptions are also dealt with.
DEFF Research Database (Denmark)
Schierup, M.H.; Mailund, T.; Li, H.
2009-01-01
Background: A small region of about 70 kb on human chromosome 19q13.3 encompasses 4 genes of which 3, ERCC1, ERCC2, and PPP1R13L (aka RAI) are related to DNA repair and cell survival, and one, CD3EAP, aka ASE1, may be related to cell proliferation. The whole region seems related to the cellular r...
Olend väljastpoolt meie maailma / Raul Sulbi
Sulbi, Raul
1995-01-01
Arvustus: Olend väljastpoolt meie maailma : [Ulmelood] / Koost. Jüri Kallas; Tlk. Jüri Kallas, Sander Kingsepp, Marek Laane, Leo Metsar; Ill. Ants Jaanimägi ja Christina Kuhi; Kujund. Juhan Enniko. Trt.: Elmatar, 1995. (Öölane; 1001).
PõlluMAJAndus versus metsaMAJAndus / Raul Järg
Järg, Raul, 1973-
2011-01-01
Rakveres toimunud noortele arhitektidele ja arhitektuurieriala tudengitele suunatud planeerimise ideevõistlusest, mille ülesandeks oli leida ideelahendus Linnametsa elamurajoonile. Konkursi võitis taani arhitekt Peter Sand tööga "Where City and Forest Merge Together". Teise koha said Sille Pihlak ja Alvin Järving tööga "Mets maja sees", kolmanda koha Martin Noorväli tööga "Iva"
Pommery kogemus # 5 / Raul Keller ; intervjueerinud Heie Treier
Keller, Raul, 1973-
2008-01-01
Muljeid Prantsusmaal Reimsis Pommery šampanjamõisas toimunud installatsioonide näituselt "L`Art Contemporain en Europe. Expérience Pommery # 5", kus ta esines kahe kohaspetsiifilise heliinstallatsiooniga. Näitus toimus 24 Euroopa kunstiajakirja koostööna, Eestist osales projektis ajakiri Kunst.ee
Häda oskustöölistega / Raul Rosenberg
Rosenberg, Raul, 1961-
2004-01-01
Maaelu Edendamise Sihtasutuse juhatuse liige räägib maaelu arengust 2004. a. Diagrammid: Keskmine bruto-kuupalk III kvartalis; Keskmine palk III kvartalis 2003-2004. Tabel: Registreeritud töötud 2003-2004
2018-04-19
facto changes in customary international law.5 The U.S. FON Program consists of a dual approach to asserting U.S. interests at sea with operational... School , Belfer Center for Science and International Affairs, Special Report (June 2017), 27. 15 Raul Pedrozo and James Kraska, “Can’t Anybody Play This... School , Belfer Center for Science and International Affairs, Special Report (June 2017), 38. USS DECATUR in the Paracel Islands – Excessive
Kultuuritehas : masinad, naised, muusika / Rednar Annus
Annus, Rednar, 1970-
2006-01-01
Kultuuritehase festival 18.-27.augustini 2006 a. Kultuuritehases Polymer. Lähemalt Erik Alalooga tööst "Väga mõnusad masinad", Inna Joosti töödest "Orkaan Katrina" ja "Maakera", Taavi Piibemanni fotoseeriast "Morbiid lendas üle", Kadri Metstaki, Edith Karlsoni, Marje Mee ja Delina Reissi kipsskulptuurist "Linda", Raul Viitungi fotonäitusest "Aborigeenid", Maiu Kurvitsa fotoseeriast "Kollanemees - kangelane, kes võidab naeratusega maailma", Ed Labetski ja Agu Visaku installatsioonist "Korrektne?"
Loengud seaduseelnõude koostajaile / Margit Kikas
Kikas, Margit
2004-01-01
Eesti Juristide Liidu poolt koostöös Riigikantselei ja Justiitsministeeriumiga korraldatud loengusarjast: Õigusloome ja normitehnika: areng ja probleemid. Sõnavõtjad loengutel: Raul Narits, Katre Kont-Kontson, Lauri Mälksoo, Raigo Sõlg, Jüri Heinla, Anno Aedmaa, Aare Kasemets, Juhani Lemmik, Ülo Siivelt, Külli Koit, Aare Reenumägi, Mall Gramberg, Toomas Sepp, Julia Laffranque, Kristel Aguraiuja, Aime Vettik, Hille Saluäär, Hiie Tamm, Kristina Nõgols, Eve Randvere
JPRS Report, Science & Technology, Europe & Latin America
1988-04-05
the context of the architecture, which will use the Elsa 5000 control system at the unit level, will be carried out with the standard MAP and TOP...are scheduled for early next year. The compact synchrotron source is expected in 1989. Too slow and too expensive, electron beam lithography no...are Elsa Segura, Raul Trucco, and Enrique Rotstein (of Argentina), and Luis Barreto Castro, Isaias Raw, and Carlos Diniz (of Brazil). 2909 This is a
Eesti tööstus tõuseb jalgadele
2008-01-01
Artiklis tutvustatakse Arengufondi "Tööstusvedurid 2018" projekti ja Eesti Tööandjate Keskliidu ettepanekuid tööstuse arendamiseks ning Saku Õlletehase ja tõstuksetootja Kinema OÜ kogemusi tootlikkuse tõstmisel. Selgitusi jagavad Arengufondi arenguseire juht Kitty Kubo, Arengufondi majandusekspert Siim Sikkut, majandus- ja kommunikatsiooniministeeriumi majanduspoliitika talituse juhataja Raul Allikivi, Eesti Tööandjate Keskliidu juhataja Tarmo Kriis, Saku Õlletehase tootmisdirektor Martin Paukson ja Kinema OÜ tegevjuht Andrus Allikoja
2001-01-01
Algus: 6. jaanuar 2000. Järg Jan/12;16;26;30/Feb/9;13;22/Mar/6;13;16;27Apr/6;20;27/May/15;31/Jun/12;22/Jul/6;13;27Aug/1;3 Sep/11/Oct/9;16/Nov/6;9/Dec/11. Artiklite autorid: Külli Rikas, Helju Pärt, Garel Püüa, Endel Prooses, Raul Salumäe, Sirje Azarov, Endel Püüa, Maret Soorsk, Aare Laine
Patterns of Global Terrorism 2002
2003-04-01
Lebanon. On 25 July, SEPRINTE raided the Ciudad del Este office and apartment of alleged money launderer Fajkumar Naraindas Sabnani, who is allegedly...Saint-Jean-De- Luz , unidentified persons threw gasoline bombs at a police headquarters, causing material damage to police barracks and three parked...sustaining. 121 Revolutionary Organization 17 November a.k.a. 17 November Revolutionary People’s Liberation Party/Front (DHKP/C) a.k.a. Devrimci Sol
Neni, Selamat Widiasmoro; Latif, Ahmad Zubaidi Abdul; Wong, Sok Yee; Lua, Pei Lin
2010-06-01
This study was carried out to gauge the preliminary insight regarding epilepsy among the rural society. The purposes of this study were: (1) to determine general level of awareness, knowledge and attitudes (AKA) towards epilepsy among rural communities, (2) to compare the AKA level based on socio-demographic characteristics and (3) to investigate rural cohort's perception of the best epilepsy treatment, preference for epilepsy information delivery and preference for mode of transportation to seek medical treatment. This prospective, cross sectional study included a sample of 615 rural residents enrolled via cluster sampling in East Coast region of Peninsular Malaysia (mean age=41.6+/-18.02, female=56.6%, married=65.5%, Malay=94.0%, monthly income 0.05). However, respondents with higher education significantly possessed better attitudes and higher Total AKA level compared to those with lower education level (p<0.001). Employed respondents reported significantly more favourable attitudes than unemployed respondents (p=0.011). Additionally, higher income rural cohorts possessed both significantly better attitudes and better AKA. These rural communities perceived modern medicine as the best epilepsy treatment (56.60%), preferred to obtain direct epilepsy-related information from health personnel (60.4%) and chose to use their own car to seek medical treatment in hospital (76.30%). The outcomes of this preliminary study signified the need to devise a dedicated epilepsy education program for implementation among rural residents. Increased AKA level in the society could enhance the people's acceptance, reduce stigmatisation and improve health-related quality of life (HRQoL) for epilepsy patients and their family. Copyright 2010 British Epilepsy Association. Published by Elsevier Ltd. All rights reserved.
Tüüakas briti intellektuaal / Sirje Rank
Rank, Sirje, 1966-
2007-01-01
Suurbritannia praegusest rahandusministrist Gordon Brownist võib saada Tony Blairi järel järgmine peaminister. CV: Gordon Brown. Vt. samas: Kuningas Midase maagia hajub: Browni puudutus ei muuda kullaks
Minne de Boer
2015-01-01
Recensione di: Ilaria Marzia Orsini, Donne in giallo: la detective story tra genere e gender, Milano/Udine, Mimesis/DeGenere – USB Ultra Slim Books, 2014, 128 p., ISBN: 97888575245680, € 11,00. Bruna Durante, Specchio delle mie trame: la vita secondo dieci scrittori italiani. Con interviste a Eraldo Baldini, Gianni Biondillo, Giancarlo De Cataldo, Giorgio Faletti, Marcello Fois, Carlo Lucarelli, Raul Montanari, Santo Piazzese, Andrea G. Pinketts, Gaetano Savatteri, Milano/Udine, Mimesis/DeGen...
22. IV avati Berliini Kunstiülikooli galeriis näitus "Alle Gegen Alles"
2004-01-01
Osalevad Avangard, Raul Meel, Puhas Rõõm, Mare Tralla, Non Grata, Jaan Toomik, FLY, Erki Kasemets, Marliis Newsome, Tuupolev, Bille Neeve, Tuuliki Avango, Pink Punk, Egle Vesk, Raoul Kurvitz, Gert Hatsukov, Minna Hint ja Enn Tegova. Mari Sobolev pidas loengu eesti performance'i ajaloost ning Non Grata esitles oma töid. Valmistatakse ette Eesti Kunstiakadeemia ja Berliini Kunstiülikooli koostöö lepingut. 23. IV Open Space'i galeriis Taje Trossi kureeritud "Live Performance Nacht"
Kommunikatsioon eeldab keeleoskust / Reet Varblane
Varblane, Reet, 1952-
2008-01-01
Religiooni ja demokraatia suhteid käsitlevast rahvusvahelisest näitusest "Obscurum per obscurius" Tallinna Kunstihoones. Avatud kuni 06.07.2008. Kuraatorid Ilja Sundelevitsh ja Reet Varblane, kujundaja Liina Siib. 28 osalejat loetletud. Eestist osalevad: Anu Juurak, Leonhard Lapin, Peeter Laurits, Raul Meel, Tatjana Muravskaja, Jüri Ojaver, Terje Ojaver, Anne-Daniela Rodgers & Paul Rodgers, Liina Siib, Jaan Toomik. 28. V toimunud seminarist, kus pikemate ettekannetega esinesid Toomas Paul ja Linnar Priimägi, ning ümarlaua arutelust
Eesti estamp sisepaguluses : graafikatriennaal / Jüri Hain
Hain, Jüri, 1941-
2004-01-01
Graafikute grupinäitused G-galeriis (kuraator Loit Jõekalda, osalevad Vive Tolli, Vello Vinn, Silvi Liiva, Raul Meel, Mare Vint, Jüri Kass, Ülle Marks, Maria-Kristiina Ulas) kuni 25. IX, Aatriumi galeriis kuni 23. IX, Soome Instituudis kuni 30. IX, Vappu Thurlowi kureeritud näitus "Lähenemised" Estonia kontserdisaalis kuni 15. X, Virge Jõekalda näitus "Vaikus" Ungari Instituudis kuni 27. IX, Loit Jõekalda näitus "Must ja valge" galeriis 36 kuni 19. IX
An Analysis of the FARC in Colombia: Breaking the Frame of FM 3-24
2009-05-21
heart complications in the mountains and left an intellectual, political, and ideological savvy that has yet to be replaced. Guillermo Leon Saenz ...blows to the FARC came in March 2008 when Marulanda died of a heart attack, secretariat member Raul Reyes died in a camp in Ecuador after an attack...farc19- 2009jan19,0,5274066.story (accessed January 20, 2009). Longhurst, Ricky M, and Jesus K Lopez . The Forgotten Insurgency: Is There Hope for
Ma tean, mida sa näitad end olevat teinud läinud suvel / Laura Kuusk
Kuusk, Laura, 1982-
2006-01-01
Kuraator Marco Laimre juhendamisel valminud Eesti Kunstiakadeemia III kursuse fotograafiaüliõpilaste suvepraktika tööde näitus "Ma tean, mida sa tegid läinud suvel / I know what you did last summer" Eesti Kunstiakadeemia galeriis kuni 3. X. Helina Kõrmi, Dmitri Gerassimovi, Kristjan-Jaak Tammiksaare, Anne-Mai Pällo, Tuuli Antsovi, Terje Ugandi, Ivar Veermäe, Riika Tauriaineni, Kätly Kaibaldi, Raul Viitungi ja Andrus Kaursoni töödest
Directory of Open Access Journals (Sweden)
Ania Mercedes Silva Contreras
2012-10-01
Full Text Available Introducción: la estomatitis subprótesis es una de las alteraciones que con más frecuencia se diagnostica dentro de las patologías bucales, y se define como una alteración de tipo inflamatoria, que puede degenerar en una lesión hiperplásica si no se trata oportunamente. Objetivo: caracterizar el comportamiento de la estomatitis subprótesis en esa población. Material y método: se realizó un estudio observacional, descriptivo y transversal en la población de 15 años y más portadores de prótesis dental parcial o total del Policlínico "Raúl Sánchez" en el municipio Pinar del Río, durante el período comprendido desde febrero del 2008 a febrero del 2010. La muestra quedó constituida por 232 pacientes seleccionados mediante un muestreo por conglomerado trietápico. Para el análisis estadístico de los datos se emplearon medidas de resúmenes para variables cualitativas (porcentaje puntuales y por intervalos de confianza y se implementó, en los casos necesarios, la prueba no paramétrica ji cuadrado con el propósito de determinar se existe correlación entre algunas de las variables. Y se obtuvo un nivel de significación de pIntroduction: denture-induced stomatitis is one of the most frequent alterations diagnosed among the oral-cavity pathologies; it is defined as an inflammatory-type state that can lead to a hyperplastic lesion if it is not properly treated. Objective: to characterize the behavior of denture-induced stomatitis in this population. Material and method: an observational, descriptive and cross-sectional study was conducted in partial and total denture-wearing patients older than 15 years old belonging to "Raul Sanchez" outpatient clinic in Pinar del Rio during February 2008 to February 2010. The sample was comprised of 232 patients chosen by means of three-state conglomeration. To the statistical analysis of data, measures to sum up the qualitative variables (punctual percentage and confidence interval were used
Experiment list: SRX100894 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available SRX100894 hg19 DNase-seq DNase-Seq Neural Medullo Tissue=brain|Lineage=ectoderm|Description=medulloblastoma... (aka D721), surgical resection from a patient with medulloblastoma as described by ...seSeq || datatype description=DNaseI HS Sequencing || cell description=medulloblastoma (aka D721), surgical ...resection from a patient with medulloblastoma as described by Darrell Bigner (1997) || controlid=generic_fem...section from a patient with medulloblastoma as described by Darrell Bigner (1997) || cell karyotype=cancer |
Eesti läheb Pekingisse / Karin Hallas-Murula
Hallas-Murula, Karin, 1957-
2008-01-01
Pekingi Eesti saatkonnahoone konkursist žüriiliikme pilguga. Premeeritud ja esiletõstetud töödest. Võidutöö autorid - Lauri Vaimel, Andres Põime, Liisa Põime; II koht - Erik Nobel ja Nobel Arkitekten, Taani-Eesti; III koht - Kalle Vellevoog, Velle Kadalipp, Tiiu Truus, Martin Prommik; ostudega esiletõstetud tööde autorid - Priit Pent ja Raul Järg Bucoma OÜ-st ning Jan Skolimowski, Peeter Loo, Kaspar Kruuse ja Li Vene KAMP Arhitektide OÜ-st. Hiina ja Pekingi uusehitistest, arhitektidest
Pärnus on uus nüüdiskunsti galerii!
2004-01-01
17. VI Pärnus Lõuna t. 20 avatud eksperimentaalne Rael Artel Gallery keskendub esimesel hooajal eelkõige foto ja sound art'i eksponeerimisele. Kuraatorid: Anu Allas, Andreas W, EKA kunstiteaduse üliõpilased Marion Tupits, Aleksander Tsapov, Urmas Oja. Galeristi Rael Arteli kureeritud avanäitusel "Jagatud kehad" on väljas Eveli Variku, Tanja Muravskaja, Imre Malva, Andreas W ja Haide Rannakivi tööd. Galerii audiogalerii avatakse Projekt Unisoni (Hello Upan, Raul Keller, Heikki Tikas) mürateosega "DOHC"
Directory of Open Access Journals (Sweden)
Jay Patel
2013-01-01
Full Text Available Background. Neurofibromatosis Type 1 (NF-1 has a variety of associated orthopaedic manifestations that have been previously reported. We report a case of severe, grade 4 knee osteoarthritis (OA with recurrent subluxation and joint laxity due to multiple extra-articular neurofibromas ultimately treated with Above the Knee Amputation (AKA. Case Description. A 39-year-old man presented with multiple neurofibromas and lymphedema leading to degenerative changes of the knee. Conservative treatment failed due to the severity of the knee degeneration and patient discomfort. Likewise, arthroplasty was not possible due to poor bone quality and joint instability. Therefore, AKA was selected to relieve symptoms and provide functional improvement. six months after the procedure the patient has increased functional capacity for ambulation and activities of daily living, as well as significant decrease in pain and discomfort. Clinical Relevance. Extra-articular neurofibromas causing severe secondary OA in relatively young patients can be functionally improved with AKA and prosthetic device use.
Putini lemmikud noolivad E.O.S-i / Raul Ranne
Ranne, Raul
2004-01-01
Transiidifirma E.O.S (Estonian Oil Service) võimalikust omanikuvahetusest, kus ostjateks võivad osutuda Venemaa uued oligarhid. Aleksei Mordashovi juhitav Severstaltrans. Tabel: E.O.S-i majandustulemused
Maaelu Edendamise Sihtasutuse tööd / Raul Rosenberg
Rosenberg, Raul, 1961-
2005-01-01
Vastukaja Toomas Mattsoni artiklile "Laenumiljonid tuulte meelevallas" 3. märtsi Maalehes lk. 10, kus räägiti Riigikontrolli aruandest Maaelu Edendamise Sihtasutuse kaudu maaelu ja ettevõtluse edendamiseks antud laenude kohta. Sihtasutuse tegevusest maapiirkondade majandusliku arengu toetamisel
Sea King SHOL Support for Post-HCM/FELEX HALIFAX Class Ships
2014-05-01
modernisation de mi-durée. Les modifica- tions techniques apportées aux navires pendant le radoub ont entraïné des changements im- portants à la...classe Halifax connaissent une modernisation (MCH) de mi-durée. Les modifications techniques apportées aux navires pendant le radoub ont entraïné des...ship DAQ components were distributed about the ship at the bow, mast, port bridge wing, port breezeway, howdah (a.k.a. LSO compartment), Flyco (a.k.a
Neil Young - også kendt som Bernard Shakey
DEFF Research Database (Denmark)
Pedersen, Peter Ole
2016-01-01
A chronological analysis of the films made by the musician Neil Young. The article takes a closer look at the criticism of society and the portrayal of America and it's music culture in the works of Bernard Shakey a.k.a. Neil Young......A chronological analysis of the films made by the musician Neil Young. The article takes a closer look at the criticism of society and the portrayal of America and it's music culture in the works of Bernard Shakey a.k.a. Neil Young...
Produção e conservação escolar da masculinidade no romance O Ateneu
MARCHI,RITA DE CÁSSIA; SANTOS,TIAGO RIBEIRO
2017-01-01
El ensayo analiza la producción y conservación de la masculinidad en el romance O Ateneu (Raul Pompeia) que retrata la vida escolar en un internado de elite del siglo XIX. El ensayo discute principalmente la trayectoria del niño Sérgio, narrador y protagonista del romance. Él sufre experiencias disciplinares destinadas a transformar sus marcas infantiles y femeninas en características adultas y masculinas. La producción y conservación de la masculinidad aparecen principalmente implicadas en e...
Directory of Open Access Journals (Sweden)
Priscila Cartes R
2009-03-01
Full Text Available Somatic and zygotic embryos from mature seeds of rauli-beech, Nothofagus alpina (Poepp. & Endl. Oerst., were encapsulated in different artificial endosperms in order to generate a cover that fulfills the function of nourishment and protection of the embryos, facilitating their later germination. The content of sodium alginate varied by 4%, 3%, and 2%, as did the immersion time in calcium chloride (CaCl2, which acts as complexing agent. The artificial endosperm components of the Murashige and Skoog medium (MS were added, supplemented with 0.5 mg L-1 indolacetic acid (IAA, 0.5 mg L-1 naphthaleneacetic acid (NAA, 2 mg L-1 6-benzylaminopurine (BAP and 30 g L-1 sucrose. The germinative behaviors of encapsulated somatic and zygotic embryos were evaluated after 4 wk. Comparing the percentages of germination reached by encapsulated somatic and zygotic embryos it was observed that they had similar germinative behavior according to the type of encapsulation applied. However, zygotic embryos substantially exceeded the germination levels reached by somatic embryos, 100% vs. 45% respectively.Embriones somáticos y cigóticos provenientes de semillas maduras de raulí, Nothofagus alpina (Poepp. & Endl. Oerst., se encapsularon en diferentes endospermas sintéticos con el fin de generar una cubierta que cumpla la función de nutrir y proteger al embrión para facilitar su posterior germinación. Se varió el contenido de alginato de sodio al 4%, 3% y 2% y el tiempo de inmersión en cloruro de calcio (CaCl2, el que actúa como agente acomplejante. Además, a la matriz artificial se adicionaron componentes del medio Murashige y Skoog (MS suplementado con: 0,5 mg L-1 de indolacetic acid (IAA, 0,5 mg L-1 de ácido naftalenacético (NAA, 2 mg L-1 de 6-bencilaminopurina (BAP y 30 gL-1 de sacarosa. Al cabo de 4 semanas el porcentaje de germinación de los embriones somáticos y cigóticos encapsulados tuvieron similar comportamiento germinativo según el tipo de
Finite element approximations of the stokes flow problem based upon various variational principles
International Nuclear Information System (INIS)
Franca, L.P.; Hughers, T.J.R.; Stenberg, R.
1989-05-01
Finite element methods are constructed by adding to the usual Galerkin method terms that are mesh-dependent least-squares forms of the Euler-Lagrange equations. The methods are consistent and possess additional stability compared to the Galerkin method. Finite element interpolations, which are unstable in the Galerkin approach, are now convergent. The methodology is applied to the velocity-pressure formulation, a.k.a., Herrmann's formulation, to the stress-velocity formulation, a.k.a., Hellinger-Reissner's formulation and to a new formulation based on augmented stress, pressure and velocity [pt
Object-oriented analysis and design for information systems Modeling with UML, OCL, IFML
Wazlawick, Raul Sidnei
2014-01-01
Object-Oriented Analysis and Design for Information Systems clearly explains real object-oriented programming in practice. Expert author Raul Sidnei Wazlawick explains concepts such as object responsibility, visibility and the real need for delegation in detail. The object-oriented code generated by using these concepts in a systematic way is concise, organized and reusable. The patterns and solutions presented in this book are based in research and industrial applications. You will come away with clarity regarding processes and use cases and a clear understand of how to expand a use case.
Kas Eesti avastamine algab Põhja-Eestist? : Põhja-Eesti V turismikonverents
2010-01-01
17. novembril Jõhvi Kontserdimajas toimunud Põhja-Eesti V turismikonverentsist “Kas Eesti avastamine algab Põhja- Eestist?", mille avas Ida-Virumaa maavalitsuse Arengu- ja planeeringuosakonna juhataja Urmas Majaääs. Ülevaade SA Ida-Virumaa Ettevõtluskeskuse turismikoordinaatori Sigrid Karoni, Estonian Airi asepresidendi kommertsalal Rauno Parrase, EASi koordinaatori turismiuuringute alal Piret Kallase, kommunikatsioonikonsultandi Raul Rebase, SA Põhja-Eesti Turism projektijuhi Erika Pääbuse ja nõukogu liikme Moonika Sooneste, CityBike OÜ tegevjuhi Toomas Lelovi, Narva-Jõesuu linnapea Andres Noormägi, Loodusturismi arendaja ja koolitaja Rein Kuresoo ettekannetest
15 tähtteost Eesti kunsti 15 aastast / Harry Liivrand
Liivrand, Harry, 1961-
2006-01-01
Kunstiteosed, mis on märgilise tähendusega nii nende loojate loomingus kui eesti kunstiajaloo kontekstis: Raoul Kurvitz "Ararat", Jaan Toomik "...16. mai-31. mai 1992", Jüri Ojaver "Nišš. Image", Raul Rajangu "Playboy House", Jaan Toomik "Tantsides koju", Ado Lill "Nimetu 55", Kai Kaljo "Luuser", Mark Raidpere sari "Io", Ene-Liis Semper "FF/Rew", Laurentsius & AD "Roos XXII", Mare Tralla "Sing with me!", Peeter Allik"Ma nägin seda", Kaido Ole "Tüdruk ja poiss", Jaan Elken "Video Kills a Radio Star", Andres Tali "Pastoraalne pastishsh"
Salajased seitsmekümnendad = Secret Seventies / Leonhard Lapin
Lapin, Leonhard, 1947-
1998-01-01
L. Lapini nägemus 1970.-test, mis algasid tema jaoks 1970. aastal Pegasuse kohviku näitusega 'Eesti edumeelne taie', jätkusid armeeaastatega Riias; näitustest SAKU 1973 ja HARKU 1975; 1979. a. toimunud Raul Meele, Jüri Okase ja Tõnis Vindi grupinäitusest Riia Planetaariumis, sama aasta septembris toimunud kallaletungist L. Lapinile; eesti ja vene avangardkunsti seostest ning muudest sündmustest; ametlikult soositud slaidimaalijate ja abstraktset kunsti viljelenud avangardistide vastasseisust. Ilmunud ka kogumikus "Dokument ja loovus". - Tallinn : Sirp, 2005, lk. 138-144
Diagnostic and prognostic values of antikeratin antibodies (AKA ...
African Journals Online (AJOL)
Egyptian Journal of Pediatric Allergy and Immunology (The). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 1, No 1 (2003) >. Log in or Register to get access to full text downloads.
Dance: A Psychosocial Tool for Child's Development | Akas ...
African Journals Online (AJOL)
Creative Artist: A Journal of Theatre and Media Studies. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 4, No 1 (2010) >. Log in or Register to get access to full text downloads.
HUMAN PARAGONIMIASIS IN AFRICA | Aka | Annals of African ...
African Journals Online (AJOL)
Annals of African Medicine. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 7, No 4 (2008) >. Log in or Register to get access to full text downloads.
HUMAN PARAGONIMIASIS IN AFRICA | Aka | Annals of African ...
African Journals Online (AJOL)
An up-to-date review on human paragonimiasis in Africa was carried out to determine the current geographical distribution of human cases and analyze the animal reservoir, snails and crustaceans which intervene in the local life cycle of Paragonimus species. Two countries, i.e., Cameroon and Nigeria, were mainly ...
Lu, Yanrong; Li, Lixiang; Peng, Haipeng; Yang, Yixian
2016-01-01
WSNs (Wireless sensor networks) are nowadays viewed as a vital portion of the IoTs (Internet of Things). Security is a significant issue in WSNs, especially in resource-constrained environments. AKA (Authentication and key agreement) enhances the security of WSNs against adversaries attempting to get sensitive sensor data. Various AKA schemes have been developed for verifying the legitimate users of a WSN. Firstly, we scrutinize Amin-Biswas’s currently scheme and demonstrate the major security loopholes in their works. Next, we propose a lightweight AKA scheme, using symmetric key cryptography based on smart card, which is resilient against all well known security attacks. Furthermore, we prove the scheme accomplishes mutual handshake and session key agreement property securely between the participates involved under BAN (Burrows, Abadi and Needham) logic. Moreover, formal security analysis and simulations are also conducted using AVISPA(Automated Validation of Internet Security Protocols and Applications) to show that our scheme is secure against active and passive attacks. Additionally, performance analysis shows that our proposed scheme is secure and efficient to apply for resource-constrained WSNs. PMID:27338382
Lu, Yanrong; Li, Lixiang; Peng, Haipeng; Yang, Yixian
2016-06-08
WSNs (Wireless sensor networks) are nowadays viewed as a vital portion of the IoTs (Internet of Things). Security is a significant issue in WSNs, especially in resource-constrained environments. AKA (Authentication and key agreement) enhances the security of WSNs against adversaries attempting to get sensitive sensor data. Various AKA schemes have been developed for verifying the legitimate users of a WSN. Firstly, we scrutinize Amin-Biswas's currently scheme and demonstrate the major security loopholes in their works. Next, we propose a lightweight AKA scheme, using symmetric key cryptography based on smart card, which is resilient against all well known security attacks. Furthermore, we prove the scheme accomplishes mutual handshake and session key agreement property securely between the participates involved under BAN (Burrows, Abadi and Needham) logic. Moreover, formal security analysis and simulations are also conducted using AVISPA(Automated Validation of Internet Security Protocols and Applications) to show that our scheme is secure against active and passive attacks. Additionally, performance analysis shows that our proposed scheme is secure and efficient to apply for resource-constrained WSNs.
Directory of Open Access Journals (Sweden)
Yanrong Lu
2016-06-01
Full Text Available WSNs (Wireless sensor networks are nowadays viewed as a vital portion of the IoTs (Internet of Things. Security is a significant issue in WSNs, especially in resource-constrained environments. AKA (Authentication and key agreement enhances the security of WSNs against adversaries attempting to get sensitive sensor data. Various AKA schemes have been developed for verifying the legitimate users of a WSN. Firstly, we scrutinize Amin-Biswas’s currently scheme and demonstrate the major security loopholes in their works. Next, we propose a lightweight AKA scheme, using symmetric key cryptography based on smart card, which is resilient against all well known security attacks. Furthermore, we prove the scheme accomplishes mutual handshake and session key agreement property securely between the participates involved under BAN (Burrows, Abadi and Needham logic. Moreover, formal security analysis and simulations are also conducted using AVISPA(Automated Validation of Internet Security Protocols and Applications to show that our scheme is secure against active and passive attacks. Additionally, performance analysis shows that our proposed scheme is secure and efficient to apply for resource-constrained WSNs.
2011-09-29
...-installation and removal of the equipment from the U.S. hospital and the export of the equipment from the...). Maghazehe had knowledge that a U.S. hospital was discarding the oncology system and that a company in Iran... States. For purposes of this paragraph, servicing means installation, maintenance, repair, modification...
2010-11-29
..., Falah Insania, Welfare of Humanity, Humaniatarian Welfare Foundation, Human Welfare Foundation...-i-Insaniyat, Falah Insania, Welfare of Humanity, Humaniatarian Welfare Foundation, Human Welfare...
Miners' dictionary: English/Fanakalo
CSIR Research Space (South Africa)
Chamber of Mines, South Africa
1978-01-01
Full Text Available -beh-Iow Sunday Sonta Sawn-tah week wik week this week: lo wik law week next weelk lo wik yena fika law week yhe-nah fee-kah last week: lo wik yena dlulile; law week yhe-nah dIoo- lo wik yena pelile lee-Ieh; law week yhe-nah peh-Iee-Ieh month nyanga... adapta adaptor ah-dahp-tah Agas August Ah-gahs aka erect v. ah-kah aka build v. ah-kah hlanganisa gather (bring together) shlahng-gah-nee-sah Alimak AIimak Ah-lee-maIk ampur almost ahm-pur aptitude test mlabalab mlah-bah-Iab aseyi otis assay...
Kozić, Ružica; Meštrić, Lucija
2013-01-01
Projekt studentske radionice bio je kontrola DOF-a u mjerilu 1:2000 na području općine Đurđevac. Proveden je terenski dio kontrole točnosti DMR-a, DOF-a, izvedene signalizacije te načina signalizacije. Mjerenja su obavljena 19.travnja 2013. godine. Obavljena je ponovna izmjera GPS točaka homogenog polja Đurđevac RTK metodom u sustavu CROPOS s ciljem kontrole tih točaka, čije su koordinate već određene u sklopu izrade DOF2. Uz trajno stabilizirane točke homogenog polja, RTK metodom snimane su ...
"Lootust ei tohiks siiski kaotada" / Sergei Loznitsa ; intervjueerinud Raul Ranne
Loznitsa, Sergei, 1964-
2010-01-01
Sergei Loznitsa mängufilm „Minu õnn”, (Ukraina-Holland-Saksamaa-Prantsusmaa 2010) võitis Pimedate Ööde filmifestivali grand prix. Intervjuu režissööriga filmist, lumest, kurjusest ja ebaõiglusest
Social history of Capoeira through images. The Raul Pederneiras’ "silhouettes"
Directory of Open Access Journals (Sweden)
Paulo Coelho Araújo
2017-12-01
Full Text Available The study of Capoeira through the interpretation of images is characterized by being practically non-existent, and contains superficial and scarcely informed interpretations of its presence in Brazil. This study is based on the historical method and also is supported by the principles of the Historical Archaeology (Orser Jr., 1992 and those developed by Panofsky (1986 on the interpretation of images. For this study, we selected an iconography- "Silhouette" - by Pederneiras (1926. From this artist’s work and the accompanying text it is highlighted the apology of Brazilian's fight and its supremacy over other self-defense expressions known at the time in Brazil, the recognition of the potential of Capoeira as a physical exercise, and Pederneira’s comments on some contextual facts, highlighting the interference of its practitioners in Brazilian politics and their role as bodyguards recruited by politicians. He also referred its most famous practitioners, the gangs of Capoeira and their typical language and costumes in the Carioca society of the late 19th and early 20th century. This information, and specially the strokes depicted in the image, allows us to reconstruct the history of Capoeira movements, given the scarcity of historical sources in this field. Through this silhouette, Pederneiras sought to raise awareness among government authorities to adopt the Brazilian fight as a national identity element and recognize it as the National Gymnastics.
Kuressaare linna uueks vapilaevaks saab miinijahtija Admiral Cowan / Raul Vinni
Vinni, Raul
2008-01-01
Eesti mereväe uusim alus, miinijahtija Admiral Cowan, hakkab Kuressaare sõpruslaevana kandma linna vappi. Juuresoleval fotol kuninganna Elizabeth II ja president Toomas Hendrik Ilves 20. oktoobril 2006 avamas Eesti uue miinijahtija Admiral Cowani vappi
LHV kinnitab Soome laenuturul kanda / Silvia Kruusmaa ; kommenteerinud Raul Malmstein
Kruusmaa, Silvia
2010-01-01
LHV sai Soome finantsinspektsioonilt loa hakata osutama piiriüleseid teenuseid Soomes, pank sõlmis Luottotalo Fenno Oy-ga laenuportfelli ostulepingu, omandades ligikaudu 12 500 eraisiku laenulepingud
Eesti põhiseaduse aluspõhimõtted omariikluse garantiina / Raul Narits
Narits, Raul, 1952-
2011-01-01
Ettekanded 10. märtsil 2009 Tallinnas Eesti Juristide Liidu XX aastapäeval ("Eesti omariiklus : kogemused ja perspektiiv") ja 1. dets. 2010 Tartu Ülikooli 91. aastapäeval ("Rahvusülikool ja põhiseaduse aluspõhimõtted")
Acervos bibliográficos do fim do século XIX: contribuições da Literatura Brasileira
Directory of Open Access Journals (Sweden)
Magali Lippert da S. Almeida
2015-12-01
Full Text Available São poucos os estudos sobre a formação do leitor brasileiro tendo em vista a utilização dos acervos disponíveis no país no fim do século XIX. Um dos motivos aparentes é a dificuldade dos estudiosos em rastrear quais obras estavam presentes nas bibliotecas brasileiras da época. Este estudo visa demonstrar que é possível preencher esta lacuna através da leitura e rastreamento das obras citadas nos romances e demais textos dos principais autores da Literatura Brasileira do fim do século XIX e início do século XX. O estudo aqui apresentado traz o levantamento dos textos citados pelo personagem/narrador Sérgio, do romance O Ateneu, de Raul Pompéia. Foi efetuada a leitura da obra, colhidas todas as menções literárias, bem como a autores e textos, após foi feita uma lista das obras e do procedimento de citação do narrador/autor demonstrando que as obras e autores citados haviam sido lidos por ele no Brasil do fim do século XIX. É o início de um grande rastreamento que visa compor através da leitura dos livros de Raul Pompéia, Machado de Assis, Aluísio Azevedo, Lima Barreto e Euclides da Cunha os acervos literários brasileiros do fim do século XIX e início do século XX.
Jia, Ying-bin; Li, Jian; Su, Yong-hui; Ma, Jie-fei; Guan, Xiao-dong; Zhang, Bai-meng
2012-10-23
To evaluate the effects of using longer xenografts in conjunctions with the location of Adamkiewicz artery (AKA) on midterm outcomes of endovascular treatment for thoracic aortic dissection. From March 2005 to September 2011, 217 patients with type B dissection were recruited. There were 143 males and 74 females with a mean age of 65 ± 11 years. Among them, 43 patients were from Fifth Affiliated Hospital of Sun Yat-Sen University while another 174 patients from Affiliated Zhongshan Hospital of Fudan University. They were divided into 2 groups according to whether AKA was identified or not pre-operatively. Endovascular repairs were performed for all patients. Distal landing levels of xenografts were recorded. The thrombosis of false lumen and the complications of spinal cord injury and endoleak were analyzed. AKA was detected in 121 (55.8%) patients (group A) but not in 96 (44.2%) patients (group B). According to the levels of AKA, the patients of group A obtained the stabilization of affected thoracic aorta over a longer distance. And the ratio of patients with distal landing levels at T8-T10 was significantly higher than in group B (59.5% vs 12.5%, χ² = 49.85, P < 0.01). Also, during the follow-up period of 7.3 months, the ratio of patients with total thrombosis of false lumen in group A was significantly higher than that in group B (32.1% vs 19.1%, χ² = 4.34, P < 0.05). During the endovascular repair of thoracic aortic dissection, selecting a longer device may provide a better structural stability of affected aorta and promote false lumen thrombosis.
Internationality meets locality - ART IST KUKU NU UT festival in Tartu / Tanel Rander
Rander, Tanel, 1980-
2012-01-01
Kunstifestivalist ART IST KUKU NU UT. Näitusest "Möh? Fui! Öäk! Ossa! Vau! Eesti kaasaegse kunsti klassika" (06.09.-18.11.2012) Tartu Kunstimuuseumis. Festivali projektijuht Kaisa Eiche, kunstiline juht ja näituse kuraator Rael Artel. Näitusel osalesid Jaan Toomik, Raul Meel, Kai Kaljo, Johnson & Johnson, Anna-Stina Treumund ja Flo Kasearu. Chris Fitzpatrick'u kureeritud näitusest "Sõida tasa üle silla" (07.-30.09.2012) galeriis Noorus. Kuku Nunnu stipendiaadi Eike Epliku isikunäitusest "Tüdruk, kes kõike arnastas" (07.09.-28.10.2012) Y-galeriis
The Anthropological Cinema and Approach the Health of Indigenous Folk
Directory of Open Access Journals (Sweden)
Diana Milena BERRÍO CUARTAS
2017-03-01
Full Text Available The article aims to address the concept of anthropological or ethnographic cinema and its relevance in Latin America. As an example of anthropological cinema has been chosen Gerónima, Argentina film, directed by Raul Tosso, released in 1986 and based on the book by psychiatrist Jorge Luis Pellegrini. Gerónima relate the story of an Indian family intervened by a team of public health. The objectives are to present some ways of exploring cultural diversity in the film industry and analyze how health and preventive and curative interventions in different socio?cultural contexts values.
THEORETICAL CONCEPTIONS OF GEOGRAPHY TEACHERS
Directory of Open Access Journals (Sweden)
Eloy Montes Galbán
2007-11-01
Full Text Available The main goal of this research was to determine the current theoretical concepts handled by third stage basic education geography teachers. A non experimental descriptive study was made. Data was collected through a semi structured questionnaire. The population was conformed by the teachers who work at the National schools placed in the parishes Raul Leoni and Cacique Mara of Maracaibo city, Zulia State. There is not clarity in regard to the correct handling of the different geographic currents, and the slight notion teachers have leans towards a traditional, descriptive, retrospective memory based conception.
2000-01-01
Järg Jan/8;11;15;20;27 Feb/1;10;12;17;19;29 Mar/4;7;11;14;21;25;29;30 Apr/1;8;12;27 May/3;6;11;19;26;30 Jun/3;6;16;21;22 Jul/25 Aug/4;11;18;26 Sep/9;16;22;29 Oct/6;10;21;27 Nov/7;11;17;22 Dec/12 Sündmustest Saaremaal. Artiklite autorid: Raul Salumäe, Marko Püüa, Endel Püüa, Külli Rikas, Maret Soorsk, Olavi Pesti, Bruno Pao, Sirje Azarov, Tõnu Talvi
Longitudinalna analiza razvoja eugnatija i disgnatija od mliječne do trajne denticije
Legović, Mario; Cehić, Aldo
1986-01-01
Autori su kod 366 ispitanika (190 dječaka i 176 djevojčica) sa teritorija općine Poreč promatrali razvoj eugnatija i disgnatija od perioda mliječne do perioda trajne denticije. Djeca su prvi put pregledana u godini 4,5 — do 5,5 godina, a drugi put kod 12,5 — 13,5 godina. U navedenom intervalu kod ispitanika nisu vršeni nikakvi ortodontski zahvati. U mliječnoj denticijii ortodontske anomalije pronađene su kod 43,7% ispitanika (39,5% kod dječaka i 48,3% kod djevojčica), a u trajnoj denticiji ko...
Red Plague Control Plan (RPCP)
Cooke, Robert W.
2010-01-01
SCOPE: Prescribes the minimum requirements for the control of cuprous / cupric oxide corrosion (a.k.a. Red Plague) of silver-coated copper wire, cable, and harness assemblies. PURPOSE: Targeted for applications where exposure to assembly processes, environmental conditions, and contamination may promote the development of cuprous / cupric oxide corrosion (a.k.a. Red Plague) in silver-coated copper wire, cable, and harness assemblies. Does not exclude any alternate or contractor-proprietary documents or processes that meet or exceed the baseline of requirements established by this document. Use of alternate or contractor-proprietary documents or processes shall require review and prior approval of the procuring NASA activity.
FY-2001 Accomplishments in Off-gas Treatment Technology Development
Energy Technology Data Exchange (ETDEWEB)
Marshall, Douglas William
2001-09-01
This report summarizes the efforts funded by the Tank Focus Area to investigate nitrogen oxide (NOx) destruction (a.k.a. deNOx) technologies and off-gas scrubber system designs. The primary deNOx technologies that were considered are staged combustion (a.k.a. NOx reburning), selective catalytic reduction, selective non-catalytic reduction, and steam reformation. After engineering studies and a team evaluation were completed, selective catalytic reduction and staged combustion were considered the most likely candidate technologies to be deployed in a sodium-bearing waste vitrification facility. The outcome of the team evaluation factored heavily in the establishing a baseline configuration for off-gas and secondary waste treatment systems.
Amato, Alexandre Campos Moraes; Parga, José Rodrigues; Stolf, Noedir Antônio Groppo
2018-01-01
Resumo Contexto Diferenças morfológicas da artéria de Adamkiewicz (AKA) entre a população portadora e não portadora de doença aórtica têm importância clínica, influenciando as complicações neuroisquêmicas da medula espinhal em procedimentos operatórios. Ainda não é conhecida a correlação entre parâmetros clínicos e a previsibilidade da identificação dessa artéria pela angiotomografia. Objetivo Desenvolver um modelo matemático que, através de parâmetros clínicos correlacionados com aterosclerose, possa prever a probabilidade de identificação da AKA em pacientes submetidos a angiotomografias. Método Estudo observacional transversal utilizando banco de imagens e dados de pacientes. Foi feita análise estatística multivariada e criado modelo matemático logit de predição para identificação da AKA. Variáveis significativas foram utilizadas na montagem da fórmula para cálculo da probabilidade de identificação. O modelo foi calibrado, e a discriminação foi avaliada pela curva receiver operating characteristic (ROC). A seleção das variáveis explanatórias foi guiada pela maior área na curva ROC (p = 0,041) e pela significância combinada das variáveis. Resultados Foram avaliados 110 casos (54,5% do sexo masculino, com idade média de 60,97 anos e etnia com coeficiente B -2,471, M -1,297, N -0,971), com AKA identificada em 60,9%. Índice de massa corporal: 27,06 ± 0,98 (coef. -0,101); fumantes: 55,5% (coef. -1,614/-1,439); diabéticos: 13,6%; hipertensos: 65,5% (coef. -1,469); dislipidêmicos: 58,2%; aneurisma aórtico: 38,2%; dissecção aórtica: 12,7%; e trombo mural: 24,5%. Constante de 6,262. Fórmula para cálculo da probabilidade de detecção: (e−(Coef. Etnia+(Coef. IMC×IMC)+Coef.fumante+Coef.HAS+Coef.dislip+Constante)+1)−1 . O modelo de predição foi criado e disponibilizado no link https://vascular.pro/aka-model . Conclusão Com as covariáveis etnia, índice de massa corporal, tabagismo, hipertens
Turkmenoglu, Osman N; Kanat, Ayhan; Yolas, Coskun; Aydin, Mehmet Dumlu; Ezirmik, Naci; Gundogdu, Cemal
2017-01-01
The blood supply of the lower spinal cord is heavily dependent on the artery of Adamkiewicz. The goal of this study was to elucidate the effects of lumbar subarachnoid hemorrhage (SAH) on the lumbar 4 dorsal root ganglion (L4DRG) cells secondary to Adamkiewicz artery (AKA) vasospasm. This study was conducted on 20 rabbits, which were randomly divided into three groups: Spinal SAH ( n = 8), serum saline (SS) (SS; n = 6) and control ( n = 6) groups. Experimental spinal SAH was performed. After 20 days, volume values of AKA and neuron density of L4DRG were analyzed. The mean alive neuron density of the L4DRG was 15420 ± 1240/mm 3 and degenerated neuron density was 1045 ± 260/mm 3 in the control group. Whereas, the density of living and degenerated neurons density were 12930 ± 1060/mm 3 and 1365 ± 480/mm 3 in serum saline (SS), 9845 ± 1028/mm 3 and 4560 ± 1340/mm 3 in the SAH group. The mean volume of imaginary AKAs was estimated as 1,250 ± 0,310 mm 3 in the control group and 1,030 ± 0,240 mm 3 in the SF group and 0,910 ± 0,170 mm 3 in SAH group. Volume reduction of the AKAs and neuron density L4DRG were significantly different between the SAH and other two groups ( P < 0.05). Decreased volume of the lumen of the artery of Adamkiewicz was observed in animals with SAH compared with controls. Increased degeneration the L4 dorsal root ganglion in animals with SAH was also noted. Our findings will aid in the planning of future experimental studies and determining the clinical relevance on such studies.
Scieszka's Subversive Little Red Hen: AKA "One Annoying Chicken"
Pantaleo, Sylvia
2007-01-01
During the past three years, the author has been exploring Grade 5 students' processes of reading and understanding contemporary picturebooks with Radical Change characteristics and metafictive devices, and examining how students use their knowledge of these characteristics and devices to create their own texts. "The Stinky Cheese Man and Other…
Directory of Open Access Journals (Sweden)
Churmatin Nasoichah
2017-06-01
Full Text Available The purpose of this paper is to know the exact age for Sirah Kĕting Inscription and its relation with Śrī Jayawarsa Digwijaya Śastraprabhu. The assessment was done by using inductive-deductive reasoning which moves from the facts on the field and then ends with a conclusion. In reading the Sirah Kĕting Inscription were found in the Ponorogo area, East Java, there are two different opinions in chanting year number. According to J.L.A. Brandes and W.F. Stutterheim readings, Sirah Kĕting Inscription was built on 1026 Śaka, while according to the Louis-Charles Damais readings, Sirah Kĕting Inscription was built on 1126 Śaka. From some of the results of the comparison can be concluded that the date Sirah Kĕting Inscription was built in 1126 Saka (1204 AD, the reading means agree with Louis-Charles Damais. Related to the Śrī Jayawarsa Digwijaya Śastraprabhu figure, is a king who has an autonomous kingdom (power located in the region of Madiun and Ponorogo, East Java and is the grandson of Dharmmawangsa Tguh. Keywords: Sirah Kĕting Inscription, date built, Śrī Jayawarsa Digwijaya Śastraprabhu, Mṛwak Inscription Tujuan penulisan makalah ini adalah untuk mengetahui secara pasti angka tahun Prasasti Sirah Kĕting dan kaitannya dengan tokoh Śrī Jayawarsa Digwijaya Śastraprabhu. Pengkajian dilakukan dengan menggunakan penalaran induktif-deduktif yang bergerak dari fakta-fakta di lapangan yang kemudian diakhiri dengan sebuah simpulan. Dalam pembacaan Prasasti Sirah Kĕting yang ditemukan di daerah Ponorogo, Jawa Timur terdapat dua pendapat yang berbeda dalam penyebutan angka tahunnya. Menurut pembacaan J.L.A. Brandes dan W.F. Stutterheim, Prasasti Sirah Kĕting berangka tahun 1026 Śaka, sedangkan menurut hasil pembacaan Louis-Charles Damais, Prasasti Sirah Kĕting berangka tahun 1126 Śaka. Berdasarkan beberapa hasil perbandingan dapat ditarik simpulan bahwa angka tahun pada Prasasti Sirah Kĕting adalah 1126 Śaka (1204 Masehi
United Nations Climate Change Bulletin
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
The journal has printed a collection of five articles published just before the July 1996 second Conference of the Parties (COP-2) where some 160 countries were to meet to work on the UN Framework Convention on Climate Change. Raul Estrado-Oyuela discusses the progress of the Ad Hoc Group on the Berlin Mandate (AGBM) now half-way through its two-year task of preparing a protocol or other legal instrument to further the goals of the Convention and recommends directions for further effort. Vitaly Matsarki reviews national efforts to implement the Convention. Dr. Angela Merkel, presents her views on the lines that ministers should take at COP-2.
COPI: transgressão e escrita transformista
Teixeira, Renata Pimentel
2007-01-01
Copi é o pseudônimo sob o qual foi assinada a obra de Raul Damonte Botana, nascido em Buenos Aires, em 1939, e morto em Paris (de Aids), em 1987. Egresso de uma família vinculada à cultura e à política (neto de Natálio Botana, fundador do diário Crítica), que se opôs à ditadura peronista, por isso acabou por exilar-se no Uruguai e, depois, em Paris; onde se instalou definitivamente, em 1962. Toda sua obra é marcada por humor e grande violência transgressora, além de uma crítica...
5. IX avati Pärnus paralleelselt Eesti Litograafiakeskuse korraldatud litograafiasümpoosioniga...
2003-01-01
Litograafiakeskuses litograafia ajalugu tutvustav näitus. Pärnu kontserdimajas noorte - Jaak Visnap, Inga Heamägi, Kadri Alesmaa, Marko Mäetamm, Viljar Kõiv, Lembe Ruben - litograafianäitus "New generation". Endla teatri näitusesaalides näitus "Old Stars" - esinevad Evi Tihemets, Marje Üksine, Raul Meel, Leonhard Lapin, Tiia Külv, Urmas Vaino, Herald Eelma. Teatri Küüni ja kohviku seintel noorte soome ja rootsi litograafide tööd. Pärnu mudaravilas ülevaade litokeskuse kursustel valminud töödest. Endises Linnagaleriis Rüütli t. näitus 6.-12. IX sümpoosioni raames toimunud workshop'ide töödest
76 FR 554 - Ocean Transportation Intermediary License Applicants
2011-01-05
... Western Way, Torrance, CA 90501. Officer: Hseanru aka Stephen H. Lin, President/VP/Secretary/CFO... Street, Lyndhurst, NJ 07071. Officers: Jerry Wang, Vice President (Qualifying Individual), Loong H. Chang...
Vägistaja käerauad osutusid kuldseteks / Raul Ranne, Rain Pruul
Ranne, Raul
2010-01-01
Vägistamises süüdimõistetud Arunas Mickevicius varjas ennast 10 aastat välismaal (1997-2007), tabamisel ta vangistati, kuid Riigikohus vabastas mehe kuriteo aegumise tõttu ning talle määrati alusetult vangis istutud 151 päeva eest hüvitist 160 000 krooni
Arnold Rüütel superstar ehk kevadine veinituur Gruusiasse / Raul Ranne
Ranne, Raul
2006-01-01
President Arnold Rüütli visiidist Gruusiasse. Vt. samas lk. A14 intervjuud presidendi kaaskonnas olnud suurettevõtja Urmas Sõõrumaaga. Sõõrumaa: "Ma soovitan Gruusiat!". Vabariigi Presidendi ametlik visiit Gruusia Vabariiki 9.-13.05.2006
Stephen Kingi tee tumeda tornini võttis 30 aastat / Raul Sulbi
Sulbi, Raul
2007-01-01
Stephen Kingi triloogiast "Tume torn" (Tallinn : Pegasus, 2006-2007) : Laskur : [romaan] / tõlkija Mart Kalvet ; Kolm saatusekaarti / [tõlkinud Kaido Haavandi] ; Ahermaad / [tõlkinud Matti Piirimaa] ;
Solar Secure Schools: Strategies and Guidelines; October 2004--April 2005
Energy Technology Data Exchange (ETDEWEB)
Braun, G. W.; Varadi, P. F.
2006-01-01
This report explores the technical and economic aspects of installing solar power (photovoltaic aka PV) systems on schools to improve the schools' energy security and provide power during disasters.
2010-09-29
... as Anvifish JSC) Anvifish Co., Ltd Asia Commerce Fisheries Joint Stock Company (aka as Acomfish JSC... Trading Company Limited Qingdao Tiger Hardware Factory Co., Ltd Qingyuan County Hongyi Hardware Products...
Data Element Registry Services
U.S. Environmental Protection Agency — Data Element Registry Services (DERS) is a resource for information about value lists (aka code sets / pick lists), data dictionaries, data elements, and EPA data...
TCTE Level 3 Total Solar Irradiance Daily Means V002
National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) Calibration Transfer Experiment (TCTE) data set TCTE3TSID contains daily averaged total solar irradiance (a.k.a solar constant) data...
2010-08-12
...; Kingston Technology Far East (Malaysia) Sdn Bhd, Bayan Legas, Malaysia; MiTAC Digital Corporation (aka... to the orders are used in the United States; (ii) Identify any public health, safety, or welfare...
76 FR 61776 - Designation of Five Individuals Pursuant to Executive Order 13224
2011-10-05
... (Pakistan) issued 8 Sep 2008 expires 7 Sep 2013 (individual) [SDGT] 4. ABBASIN, Abdul Aziz (a.k.a. MAHSUD, Abdul Aziz); DOB 1969; POB Sheykhan Village, Pirkowti Area, Orgun District, Paktika Province...
2012-11-15
.... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined..., Mohammad (a.k.a. MINAEE, Muhamed); DOB 1964; POB Iran; citizen Iran (individual) [SDGT] [IRGC] [IFSR...
GPM, DPR Level 2A Ka Precipitation V03
National Aeronautics and Space Administration — The 2AKa algorithm provides precipitation estimates from the Ka radar of the Dual-Frequency Precipitation Radar on the core GPM spacecraft. The product contains two...
Yeast Interacting Proteins Database: YLR423C, YKR083C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available of the Dam1 complex (aka DASH complex), couples kinetochores to the force produce...lex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segrega
Experiment list: SRX188970 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available SRX188970 hg19 TFs and others CTCF Neural Medullo Tissue=brain|Lineage=ectoderm|Description=medulloblastoma... (aka D721), surgical resection from a patient with medulloblastoma as described by
TCTE Level 3 Total Solar Irradiance 6-Hour Means V002 (TCTE3TSI6) at GES DISC
National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) Calibration Transfer Experiment (TCTE) data set TCTE3TSI6 contains 6-hour averaged total solar irradiance (a.k.a solar constant)...
CRED Towed-Diver Fish Biomass Survey at Asuncion, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
75 FR 74769 - Designation of Three Individuals Pursuant to Executive Order 13224
2010-12-01
.... nationals or the national security, foreign policy, or economy of the United States; (3) persons determined... passport; Holder of a Bangladesh passport (individual) [SDGT] 3. RAUF, Hafiz Abdur (a.k.a. RAOUF, Hafiz...
SAFARI 2000 PAI Estimates from Hemispherical Photography, Kalahari Transect
National Aeronautics and Space Administration — This data set was collected during February-March 2000 wet season and September 2000 dry season field campaigns of SAFARI 2000. Mongu in Zambia and Pandematenga (aka...
CRED Towed-Diver Fish Biomass Survey at Swains, American Samoa in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Lanai, Main Hawaiian Islands in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Tau, American Samoa in 2012
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at South Bank, American Samoa in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Asuncion, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Kingman, Pacific Remote Island Areas in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Baker, Pacific Remote Island Areas in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Guam, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Baker, Pacific Remote Island Areas in 2012
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Sarigan, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Jarvis, Pacific Remote Island Areas in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Wake, Pacific Remote Island Areas in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Wake, Pacific Remote Island Areas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Guam, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Maui, Main Hawaiian Islands in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Rose, American Samoa in 2012
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Pagan, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Palmyra, Pacific Remote Island Areas in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Sarigan, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Alamagan, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Tinian, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Oahu, Main Hawaiian Islands in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Howland, Pacific Remote Island Areas in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
2012-04-03
... Zone 1, Abuja, Nigeria; DOB 1965; nationality Nigeria (individual) [SDGT] Entities 1. YAS AIR (a.k.a..., Tehran, Iran [SDGT] 2. BEHINEH TRADING, Tehran, Iran [SDGT] Dated: March 27, 2012. Adam J. Szubin...
Virtual Combat Convoy Trainer: Successful Rapid Prototyping
National Research Council Canada - National Science Library
Delk-Tierney, Sara
2004-01-01
.... The LM-FATS VCCT solution (aka VCCT-L) provides basic to advanced convoy skills training and mission rehearsal, incorporating precision weapons engagement training, realistic weapons, a full-scale HMMWV mockup, high-fidelity mobility...
CRED Towed-Diver Fish Biomass Survey at Aguijan, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Rota, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Ofu & Olosega, American Samoa in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Tinian, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Agrihan, Marianas in 2011
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Johnston, Pacific Remote Island Areas in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Lehua, Main Hawaiian Islands in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Ofu & Olosega, American Samoa in 2012
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Tutuila, American Samoa in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at French Frigate, Northwestern Hawaiian Islands in 2010
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Maug, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
CRED Towed-Diver Fish Biomass Survey at Guguan, Mariana Archipelago in 2014
National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys (AKA...
Directory of Open Access Journals (Sweden)
I. B. Belyaeva
2007-01-01
Full Text Available Abstract. To study the value of antibodies to cirtullinated antigens in diagnosis and their significance in prediction of erosion formation of rheumatoid arthritis (RA, we examined serological status in 129 patients with early RA (ERA and 55 cases of undifferentiated arthritis, lasting less than 12 months. Another group consisted of 39 patients with long-standing rheumatoid arthritis, in whom the disease persisted for > 2 years. Control group included 39 patients with osteoarthrosis and 29 patients with reactive arthritis. The titers of rheumatoid factor (RF, antikeratin antibodies (AKA, antiperinuclear factor (APF and antibodies to cyclic citrullinated peptide (anti-CCP were studied during initial examination and 12 months later. Serial cryosections of rat esophagus and normal human buccal epithelial cells served as substrates for AKA and APF detection. AntiCCPs were revealed by means of DIASTAT technique (Axis Shield, UK.Upon initial observation of the patients with ERA, sensitivity and specificity of anti-CCP was, resp., 63.5% and 97,8%, thus exceeding both parameters for RF (48,8% и 86,7%. Sensitivity of AKA and APF for the same group was 17% and 24 %, with specificity of 97.7%. In RF-seronegative cases of early RA, anti-CCP were detected in 37% with ERA and 42% long-standing RA. In patients with non-differentiated arthritis who developed RA within one year, RF and anti-CCP were found in 12,2% and 45,5%. Following a one-year observation, a statistically significant increase was found in incidence of RF and anti-CCP in ERA patients.Positivity for anti-citrulline antibodies (AKA, APF and anti-CCP in ERA patients were associated with higher levels of CRP, increased HAQ, DAS4, Sharp scores, as compared to the patients who were seronegative. In ERA patients positive for anti-citrulline antibodies, higher frequencies of synovitis and erosive arthritis were detected by means of ultrasound and magnetic resonance imaging. In the patients with ERA
Diversidade na sala de aula: Representação da cultura afro-brasileira
Directory of Open Access Journals (Sweden)
Flávia Brocchetto Ramos
2015-08-01
Full Text Available After the implementation of the Elementary School in nine years, the Ministry of Education (MEC, by means of the Programa Nacional do Livro Didático (PNLD – The National Coursebook Program, distributed, in 2010, collections formed by supplementary teaching materials to Elementary School classrooms of the 1st and 2nd years. In this study, we analyze the book “Seis pequenos contos africanos sobre a criação do mundo e do homem” (“Six African short stories about the creation of the world and the man, by Raul Lody. The article discusses the representation of African culture in children’s literature, presents the object of analysis and, finally, discusses ethnic issues in the book, which is designed for young readers. Thus, the paper aims to contribute for the consideration of the young reader as an individual who has the right to live with cultural diversity, present in Brazil and conveyed in the literature. A partir da implantação do Ensino Fundamental de nove anos, o MEC (Ministério da Educação, pelo Programa Nacional do Livro Didático (PNLD, distribuiu, em 2010, às salas de aula do 1º e 2º anos do Ensino Fundamental, acervos formados por obras paradidáticas. Neste estudo, analisaremos o título Seis pequenos contos africanos sobre a criação do mundo e do homem, de Raul Lody. O artigo discute a representação da cultura africana na literatura infantil, apresenta a obra objeto de análise e, por fim, discute questões étnicas na obra destinada ao leitor criança. Assim, o artigo pretende contribuir para pensar a criança leitora como um sujeito que tem direito a conviver com a diversidade cultural, presente no Brasil e veiculada na literatura.
CRED Towed-Diver Fish Biomass Surveys at Molokai Island, Main Hawaiian Islands in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
SORCE Level 3 Total Solar Irradiance Daily Average V016
National Aeronautics and Space Administration — The Total Solar Irradiance (TSI) data set SOR3TSID contains the total solar irradiance (a.k.a solar constant) data collected by the Total Irradiance Monitor (TIM)...
CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Necker Island, NW Hawaiian Islands in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Raita Bank, NW Hawaiian Islands in 2001
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Midway Atoll, NW Hawaiian Islands in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Guam Island, Marianas Archipelago in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Asuncion Island, Marianas Archipelago in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Sarigan Island, Marianas Archipelago in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Pearl And Hermes Atoll, NW Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Jarvis Island, Pacific Remote Island Areas in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Johnston Atoll, Pacific Remote Island Areas in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Nihoa Island, NW Hawaiian Islands in 2000
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Lanai Island, Main Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Tau Island, American Samoa in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Alamagan Island, Marianas Archipelago in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maug Islands, Marianas Archipelago in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2009
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maug Islands, Marianas Archipelago in 2009
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
Tartu ehk unbewusste Ängste / Rauno Thomas Moss ; interv. Harry Liivrand
Moss, Rauno Thomas, 1977-
2008-01-01
Rauno Thomas Mossi (1977) näitus "Silent Tartu aka Clinical" Vaal galeriis. Kunstniku eluloolisi andmeid, loomingust, alasti mehekeha kujutamisest. Töötab Tartu Ülikoolis joonistamise ja plastilise anatoomia õppejõuna. Tema lemmikkunstnikud
CRED Towed-Diver Fish Biomass Surveys at Kaula Rock, Main Hawaiian Islands in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Arakane Bank, Marianas Archipelago in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Kure Atoll, NW Hawaiian Islands in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Farallon De Pajaros Island, Marianas Archipelago in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Kure Atoll, NW Hawaiian Islands in 2000
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Oahu Island, Main Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Sarigan Island, Marianas Archipelago in 2009
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Tinian Island, Marianas Archipelago in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2000
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Asuncion Island, Marianas Archipelago in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2009
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Rota Island, Marianas Archipelago in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Tinian Island, Marianas Archipelago in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Gardner Pinnacles, NW Hawaiian Islands in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2001
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Rota Island, Marianas Archipelago in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Palmyra Atoll, Pacific Remote Island Areas in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Guguan Island, Marianas Archipelago in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Palmyra Atoll, Pacific Remote Island Areas in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Gardner Pinnacles, NW Hawaiian Islands in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maui Island, Main Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Swains Island, American Samoa in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
ORF Alignment: NC_006087 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available mal protein L18 [Kineococcus radiotolerans SRS30216] ... Length = 94 ... Query: 29 ... TELRPRLVVTRSARHVFVQVVDDAQGRTLASASTM...EADLRGFDGDKTAKARKVGELVAER 88 ... T +RPRLVVTRS RHVFVQV+DDA G TLASASTMEADLR ... DK+AKA+ V...G LV ER Sbjct: 1 ... TAVRPRLVVTRSTRHVFVQVIDDAAGHTLASASTMEADLRASGDDKSAKAKAVGVLVGER 60 ...
Ecosystem Monitoring (HB1502, EK60)
National Oceanic and Atmospheric Administration, Department of Commerce — The Ecosystem Monitoring (aka Ecomon) survery uses bongo and CTD sampling to monitor and map the distribution of zooplankton, krill and smaller organisms) and the...
CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Laysan Island, NW Hawaiian Islands in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
Ecosystem Monitoring (AL9804, EK500)
National Oceanic and Atmospheric Administration, Department of Commerce — The Ecosystem Monitoring (aka Ecomon) survery uses bongo and CTD sampling to monitor and map the distribution of zooplankton, krill and smaller organisms) and the...
Development of a "Digital Bridge" Thermal Anemometer for Turbulence Measurements, Phase II
National Aeronautics and Space Administration — Thermal anemometry (a.k.a. hot-wire anemometry) has been a key experimental technique in fluid mechanics for many decades. Due to the small physical size and high...
Development of a "Digital Bridge" Thermal Anemometer for Turbulence Measurements, Phase I
National Aeronautics and Space Administration — Thermal anemometry (a.k.a. hot-wire anemometry) has been a key experimental technique in fluid mechanics for many decades. Due to the small physical size and high...
CRED Towed-Diver Fish Biomass Surveys at Lehua Rock, Main Hawaiian Islands in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
2012-03-13
... SECURITIES AND EXCHANGE COMMISSION [File No. 500-1] Advanced Growing Systems, Inc., Advantage Capital Development Corp., Amazon Biotech, Inc., Andover Holdings, Inc. a/k/a Andover Energy Holdings, Inc... securities of Amazon [[Page 14853
2013-10-22
...., Bogota, Colombia; c/o FERTILIZANTES LIQUIDOS DE LA SABANA LTDA., Bogota, Colombia; Calle 109 No. 21-41... 800099351-8 (Colombia) [SDNTK]. 3. FERTILIZANTES LIQUIDOS DE LA SABANA LTDA. (a.k.a. FERTILISA LTDA.), Calle...
CRED Towed-Diver Fish Biomass Surveys at Agrihan Island, Marianas Archipelago in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Ofu And Olosega Islands, American Samoa in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Hawaii Island, Main Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Oahu Island, Main Hawaiian Islands in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Midway Atoll, NW Hawaiian Islands in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Johnston Atoll, Pacific Remote Island Areas in 2004
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Ofu And Olosega Islands, American Samoa in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2000
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Pearl And Hermes Atoll, NW Hawaiian Islands in 2000
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Molokini Crater, Main Hawaiian Islands in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Aguijan Island, Marianas Archipelago in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Farallon De Pajaros Island, Marianas Archipelago in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Wake Island, Pacific Remote Island Areas in 2007
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2008
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2002
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at French Frigate Shoals, NW Hawaiian Islands in 2001
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Howland Island, Pacific Remote Island Areas in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Oahu Island, Main Hawaiian Islands in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Necker Island, NW Hawaiian Islands in 2000
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Lisianski Island, NW Hawaiian Islands in 2003
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maro Reef, NW Hawaiian Islands in 2001
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Kauai Island, Main Hawaiian Islands in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Maui Island, Main Hawaiian Islands in 2005
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Baker Island, Pacific Remote Island Areas in 2006
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
CRED Towed-Diver Fish Biomass Surveys at Guguan Island, Marianas Archipelago in 2009
National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...
National Oceanic and Atmospheric Administration, Department of Commerce — Salinity, temperature, and physical data were collected from the AKADEMIK FEDOROV (AKA AKADEMIK FYODOROV), LENA, and OB from December 4, 1956 to May 1, 1989. These...
Technical product bulletin: aka OIL SOLUTIONS POWDER, SPILL GREEN LS, this miscellaneous oil spill control agent used in cleanups initially behaves like a synthetic sorbent, then as a solidifier as the molecular microencapsulating process occurs.
2012-10-01
... security, foreign policy, or economy of the United States; (3) persons determined by the Director of OFAC.... JUMALE, Ahmed Nur; a.k.a. JUMALI, Ahmed Ali), P.O. Box 3312, Dubai, United Arab Emirates; Mogadishu...
Directory of Open Access Journals (Sweden)
Minne de Boer
2015-12-01
Full Text Available Recensione di: Ilaria Marzia Orsini, Donne in giallo: la detective story tra genere e gender, Milano/Udine, Mimesis/DeGenere – USB Ultra Slim Books, 2014, 128 p., ISBN: 97888575245680, € 11,00. Bruna Durante, Specchio delle mie trame: la vita secondo dieci scrittori italiani. Con interviste a Eraldo Baldini, Gianni Biondillo, Giancarlo De Cataldo, Giorgio Faletti, Marcello Fois, Carlo Lucarelli, Raul Montanari, Santo Piazzese, Andrea G. Pinketts, Gaetano Savatteri, Milano/Udine, Mimesis/DeGenere, 2014, 180 p., ISBN: 9788857518176, € 13,60.Carlo Oliva, Giallo popolare: il poliziesco alla radio, a cura di Nicoletta Di Ciolla e Nicoletta Vallorani, Milano/Udine, Mimesis/DeGenere, 2013, 150 p., ISBN: 9788857518183, € 12,00.
National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...
National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...
National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...
National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...
Honey Do Franchising Group, Inc. Information Sheet
Honey Do Franchising Group, Inc., a/k/a The Honey Do Service, Inc. (the Company) is located in Bristol, Virginia. The settlement involves renovation activities conducted at properties constructed prior to 1978, located in Bristol, Virginia.
SeaWiFS_L3m_MO_CHL_chlor_a_9km
National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...
Vogten, Hubert; Martens, Harrie; Koper, Rob
2005-01-01
Changes in this release: This version contains: added support for Apache Derby database (aka IBM Cloudscape), moved JBoss specific code from general code base to own package, improved TimerSchedule setup, fixed a number of bugs.
Khamis, Abdullah M.; Hamilton, Adam R.; Medvedeva, Yulia A.; Alam, Tanvir; Alam, Intikhab; Essack, Magbubah; Umylny, Boris; Jankovic, Boris R.; Naeger, Nicholas L.; Suzuki, Makoto; Harbers, Matthias; Robinson, Gene E.; Bajic, Vladimir B.
2015-01-01
(brood care (aka “nursing”) and foraging) and identified transcription factors (TFs) that may govern their expression. More than half of the differentially expressed TFs were associated with motifs enriched in the promoter regions of differentially
National Aeronautics and Space Administration — The SeaWiFS instrument was launched by Orbital Sciences Corporation on the OrbView-2 (a.k.a. SeaStar) satellite in August 1997, and collected data from September...
ENGLISH-IGBO GLOSSARY CREATION OF PALM OIL ...
African Journals Online (AJOL)
Dean SPGS NAU
Abstract. The Igbo speaking people are well known for palm oil production ... ventures among other trades or occupations for which the Igbo are known. .... Q na-eme aka ntxtx vii. ..... Professionals – teachers, lawyers, writers, journalists and.
Technical product bulletin: aka SEACARE, ECOSPERSE, this water based dispersant may be applied in oil spill cleanups by aerial or boat spraying. Concentration/application rates depend on type of oil, degree of weathering, temperature, extent of slick.
Technical product bulletin: aka MICRO CLEAN or POWERCLEAN, this surface washing agent used in oil spill cleanups should be applied full strength to surfaces such as shorelines and beaches, pressure sprayed into cracks/crevices, and scrubbed well.
75 FR 79440 - Additional Designations, Foreign Narcotics Kingpin Designation Act
2010-12-20
..., Colombia; c/o FERTILIZANTES LIQUIDOS DE LA SABANA LTDA., Bogota, Colombia; Calle 109 No. 21-41 Apto. 403...) [SDNTK] 13. FERTILIZANTES LIQUIDOS DE LA SABANA LTDA. (a.k.a. FERTILISA LTDA.), Calle 98 Bis No. 57-66...
75 FR 3523 - Additional Designation of Entities and Individuals Pursuant to Executive Order 12978
2010-01-21
... VELEZ, Jorge Enrique (a.k.a. ``El Onli''); c/o ERA DE LUZ LTDA. LIBRERIA CAFE, Cali, Colombia; DOB 09... 805028212-7 (Colombia); (ENTITY) [SDNT]. 6. ERA DE LUZ LTDA. LIBRERIA CAFE, Calle 16 No. 100-98, Cali...
Kepler Planet Detection Metrics: Statistical Bootstrap Test
Jenkins, Jon M.; Burke, Christopher J.
2016-01-01
This document describes the data produced by the Statistical Bootstrap Test over the final three Threshold Crossing Event (TCE) deliveries to NExScI: SOC 9.1 (Q1Q16)1 (Tenenbaum et al. 2014), SOC 9.2 (Q1Q17) aka DR242 (Seader et al. 2015), and SOC 9.3 (Q1Q17) aka DR253 (Twicken et al. 2016). The last few years have seen significant improvements in the SOC science data processing pipeline, leading to higher quality light curves and more sensitive transit searches. The statistical bootstrap analysis results presented here and the numerical results archived at NASAs Exoplanet Science Institute (NExScI) bear witness to these software improvements. This document attempts to introduce and describe the main features and differences between these three data sets as a consequence of the software changes.
Recht und Rechtssystem als globale Struktur und Medium der Verhaltensorientierung / Raul Narits
Narits, Raul, 1952-
2008-01-01
Äratr.: Multiple Modernität, Globalisierung der Rechtsordnung und Kommunikationsstruktur der Rechtssysteme : Internationales Symposium zur Theorie der Rechtskommunikation an der Universität Tartu im April 2006 ; II. Sonderheft Estland. Berlin, 2008, lk. 219-238. - (Rechtstheorie : Zeitschrift für Logik und Juristische Methodenlehre, Rechtsinformatik, Kommunikationsforschung, Normen- und Handlungstheorie, Soziologie und Philosophie des Rechts ; Bd. 38, 2007, H. 2/3)
Uudses simulatsioonikeskuses matkiti suurõnnetust haiglas / Raul Vatsa, Janno Soidla, Tambet Vodi
Vatsa, Raul
2007-01-01
Kaitseväe Ühendatud Õppeasutuse uues simulatsioonikeskuses toimunud evakuatsiooniõppusest A.P.P.I., mille virtuaalne toimumiskoht oli Tartu Ülikooli Kliinikumi üks ravikorpustest. Simulatsioonikeskuses kasutatakse USA päritolu staabisimulatsiooni JCATS (Joint Conflict And Tactical Simulation)
Know-how : loomeinkubaator / Katriin Fisch-Uibopuu, Raul Oreshkin ; interv. Maarja Mänd
Fisch-Uibopuu, Katriin
2008-01-01
Tartu linnavalitsuse kultuuriosakonna juhataja R. Oreshkin ja loomemajanduse koordinaator K. Fisch-Uibopuu Tartu loomemajanduskeskuse ning loomeinkubaatori võimalustest, mis hakkavad pakkuma tuge alustavatele loome-ettevõtjatele
Ekspert: poerohkus ajab Eesti hinnad kõrgeks / Katre Pilvinski ; kommenteerinud Raul Puusepp
Pilvinski, Katre
2010-01-01
Kanada Guelphi ülikooli turundus- ja kaubandusprofessor Brent McKenzie leiab, et Eesti jaekaubandusturul on liiga palju erinevaid super- ja hüpermarketeid ning seetõttu pole jaemüüjatel suurt mõju varustajatele
15 CFR Supplement No. 4 to Part 744 - Entity List
2010-01-01
.../22/08. Ali Akbar Yahya, 505 Siraj Building 17B Street, Mankhool, Dubai, U.A.E For all items subject... EAR) Presumption of denial 73 FR 54503, 9/22/08. Farrokh Nia Yaghmaei, a.k.a. Farrokh Nia Yaghmayi...
Technical product bulletin: aka OIL SPILL CLEANUP, this surface washing agent may be applied liberally to heavily weathered oil on rocks or beaches/sand, vegetation, or at full strength on tar balls. Best results if allowed to soak, agitated, or reapplied.
2012-07-30
..., Jorge Enrique (a.k.a. ``EL ONLI''), c/o ERA DE LUZ LTDA. LIBRERIA CAFE, Cali, Colombia; DOB 09 Aug 1968..., Venezuela; RIF J-30460672-9 (Venezuela) [SDNT] 3. ERA DE LUZ LTDA. LIBRERIA CAFE, Calle 16 No. 100-98, Cali...
Christoffersen, R.; Dukes, C. A.; Keller, L. P.; Rahman, Z.; Baragiola, R. A.
2015-01-01
Both transmission electron micros-copy (TEM) and surface analysis techniques such as X-ray photoelectron spectroscopy (XPS) were instrumen-tal in making the first characterizations of material generated by space weathering in lunar samples [1,2]. Without them, the nature of nanophase metallic Fe (npFe0) correlated with the surface of lunar regolith grains would have taken much longer to become rec-ognized and understood. Our groups at JSC and UVa have been using both techniques in a cross-correlated way to investigate how the solar wind contributes to space weathering [e.g., 3]. These efforts have identified a number of ongoing problems and knowledge gaps. Key insights made by UVa group leader Raul Barag-iola during this work are gratefully remembered.
Today, the U.S. Environmental Protection Agency released the list of Superfund sites that Administrator Pruitt has targeted for immediate and intense attention. The former Mohawk Tannery facility (a.k.a. Granite State Leathers) is one of the 21 sites on th
Nigerian Veterinary Journal - Vol 32, No 3 (2011)
African Journals Online (AJOL)
Management of Unilateral Suppurative Mastitis in A Four-year-old Red · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NN Pilau, AA Abubakar, U Adamu, B Saidu, CE Okoli, LO Aka, AA Adeyeye ...
High-speed web attack detection through extracting exemplars from HTTP traffic
Wang, Wei; Zhang, Xiangliang
2011-01-01
Vector Machine (SVM) are used for anomaly detection. To facilitate comparison, we also employ information gain to select key attributes (a.k.a. features) from the HTTP traffic for web attack detection. Two large real HTTP traffic are used to validate our
76 FR 5858 - Additional Designations, Foreign Narcotics Kingpin Designation Act
2011-02-02
... ORGANIZATION/DRUG TRAFFICKING ORGANIZATION (a.k.a. ``JOUMAA MLO/DTO''); Beirut, Lebanon; Maicao, Colombia... Investigation, the Administrator of the Drug Enforcement Administration, the Secretary of Defense, the Secretary... support of, the international narcotics trafficking activities of a person designated pursuant to the...
76 FR 6843 - Additional Designations, Foreign Narcotics Kingpin Designation Act
2011-02-08
..., Jaslico, Mexico; Vereda Del Canario 1, Guadalajara, Jalisco, Mexico; Puerto de Hierro, Zapopan, Jalisco..., Jalisco, Mexico; Puerto de Hierro, Zapopan, Jalisco, Mexico; Mexico City, Distrito Federal, Mexico.... RODRIGUEZ OLIVERA, Daniel (a.k.a. RODRIGUEZ MORFIN, Daniel), Puerto de Hierro, Zapopan, Jalisco, Mexico...
Formulation de microparticules et de gelules a base de Sida acuta ...
African Journals Online (AJOL)
Formulation de microparticules et de gelules a base de Sida acuta (Malvaceae) par spray drying. A N'guessan, A.A. Koffi, L.I. Dally, K Issoufou, S Any-Grah-Aka, J.A. Lia, A Kouassi-Tuo, K.C. N'guessan-Gnaman ...
Suppression of GHS-R in AgRP neurons mitigates diet-induced obesity by activating thermogenesis
Ghrelin, an orexigenic hormone released primarily from the gut, signals the hypothalamus to stimulate growth hormone release, enhance appetite and promote weight gain. The ghrelin receptor, aka Growth Hormone Secretagogue Receptor (GHS-R), is highly expressed in the brain, with highest expression in...
Roulette, Casey J; Hagen, Edward; Hewlett, Barry S
2016-06-01
In the developing world, the dramatic male bias in tobacco use is usually ascribed to pronounced gender disparities in social, political, or economic power. This bias might also reflect under-reporting by woman and/or over-reporting by men. To test the role of gender inequality on gender differences in tobacco use we investigated tobacco use among the Aka, a Congo Basin foraging population noted for its exceptionally high degree of gender equality. We also tested a sexual selection hypothesis-that Aka men's tobacco use is related to risk taking. Tobacco use, income, tobacco purchases, tobacco sharing, reasons for using tobacco, risk taking, and other variables were measured using structured surveys and peer reports. Tobacco use was verified by testing for salivary cotinine, a nicotine metabolite. Contrary to expectations, we found a very large male bias in tobacco use. Low levels of use among females appeared to be explained by aversions to tobacco, concerns over its negative effects on fetal health, and a desire to attract husbands, who prefer nonsmoking wives. High male use appeared to be related to a desire to enhance hunting abilities and attract and/or retain wives, who prefer husbands that smoke. We conclude that low levels of smoking by Aka women are better explained by the hypothesis that women evolved to avoid plant toxins to protect their fetuses and nursing infants. High male use might be better explained by sexual selection. We also highlight the important role that recreational drugs appear to play in hunter-gatherer sharing relationships.
Technical intelligence and culture: Nut cracking in humans and chimpanzees.
Boesch, Christophe; Bombjaková, Daša; Boyette, Adam; Meier, Amelia
2017-06-01
According to the technical intelligence hypothesis, humans are superior to all other animal species in understanding and using tools. However, the vast majority of comparative studies between humans and chimpanzees, both proficient tool users, have not controlled for the effects of age, prior knowledge, past experience, rearing conditions, or differences in experimental procedures. We tested whether humans are superior to chimpanzees in selecting better tools, using them more dexteriously, achieving higher performance and gaining access to more resource as predicted under the technical intelligence hypothesis. Aka and Mbendjele hunter-gatherers in the rainforest of Central African Republic and the Republic of Congo, respectively, and Taï chimpanzees in the rainforest of Côte d'Ivoire were observed cracking hard Panda oleosa nuts with different tools, as well as the soft Coula edulis and Elaeis guinensis nuts. The nut-cracking techniques, hammer material selection and two efficiency measures were compared. As predicted, the Aka and the Mbendjele were able to exploit more species of hard nuts in the forest than chimpanzees. However, the chimpanzees were sometimes more efficient than the humans. Social roles differed between the two species, with the Aka and especially the Mbendjele exhibiting cooperation between nut-crackers whereas the chimpanzees were mainly individualistic. Observations of nut-cracking by humans and chimpanzees only partially supported the technical intelligence hypothesis as higher degrees of flexibility in tool selection seen in chimpanzees compensated for use of less efficient tool material than in humans. Nut cracking was a stronger social undertaking in humans than in chimpanzees. © 2017 Wiley Periodicals, Inc.
2011-09-09
... concludes that there is a significant potential for the manipulation of price or production. For further... 29, 2010) (``Initiation''). \\6\\ This includes: (1) An Giang Fisheries Import and Export Joint Stock...) Anvifish Joint Stock Company (aka Anvifish JSC); (4) Asia Commerce Fisheries Joint Stock Company...