WorldWideScience

Sample records for rate chr method

  1. CHR grammars

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2005-01-01

    A grammar formalism based upon CHR is proposed analogously to the way Definite Clause Grammars are defined and implemented on top of Prolog. These grammars execute as robust bottom-up parsers with an inherent treatment of ambiguity and a high flexibility to model various linguistic phenomena....... The formalism extends previous logic programming based grammars with a form of context-sensitive rules and the possibility to include extra-grammatical hypotheses in both head and body of grammar rules. Among the applications are straightforward implementations of Assumption Grammars and abduction under...... integrity constraints for language analysis. CHR grammars appear as a powerful tool for specification and implementation of language processors and may be proposed as a new standard for bottom-up grammars in logic programming....

  2. CHR Grammars

    DEFF Research Database (Denmark)

    Christiansen, Henning

    A grammar formalism based upon CHR is proposed analogously to the way Definite Clause Grammars are defined and implemented on top of Prolog. These grammars execute as robust bottom-up parsers with an inherent treatment of ambiguity and a high flexibility to model various linguistic phenomena....... The formalism extends previous logic programming based grammars with a form of context-sensitive rules and the possibility to include extra-grammatical hypotheses in both head and body of grammar rules. Among the applications are straightforward implementations of Assumption Grammars and abduction under...... integrity constraints for language analysis. CHR grammars appear as a powerful tool for specification and implementation of language processors and may be proposed as a new standard for bottom-up grammars in logic programming....

  3. Prioritized Abduction with CHR

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2008-01-01

    A class of Prioritized Abductive Logic Programs (PrioALPs) is introduced and an implementation is developed in CHR for solving abductive problems, providing minimal explanations with best-first search. Priorities may represent probabilities or a cost function to be optimized. Compared with other...

  4. Reasoning about passive declarations in CHR

    DEFF Research Database (Denmark)

    Christiansen, Henning

    2005-01-01

    The programming language of Constraint Handling Rules (CHR) is gaining more and more popularity and this has motivated the development of new optimization techniques to be applied in implementations of CHR. As for other logic programming languages, a program written CHR can be understood declarat......The programming language of Constraint Handling Rules (CHR) is gaining more and more popularity and this has motivated the development of new optimization techniques to be applied in implementations of CHR. As for other logic programming languages, a program written CHR can be understood...

  5. A sensitive chemiluminescent immunoassay to detect Chromotrope FB (Chr FB) in foods.

    Science.gov (United States)

    Xu, Kun; Long, Hao; Xing, Rongge; Yin, Yongmei; Eremin, Sergei A; Meng, Meng; Xi, Rimo

    2017-03-01

    Chromotrope FB (Chr FB) is a synthetic azo dye permitted for use in foods and medicines. An acceptable daily intake (ADI) of Chr FB was 0-0.5mg/kg in China. In this study, we synthesized a Chr FB hapten with an amino group to prepare its artificial immunogen. Polyclonal antibodies obtained from New Zealand rabbits were applied to develop an indirect competitive chemiluminescent immunoassay (icCLIA) to detect Chr FB in foods. A horseradish peroxidase (HRP)-luminol-H 2 O 2 system was used to yield CL signal with p-iodophenol as an enhancement reagent. The method showed good specificity towards Chr FB and could detect as low as 0.02ngmL -1 Chr FB in buffer, 0.07ngg -1 in yoghurt candy, 0.07ngg -1 in vitamin drink and 0.13ngg -1 in bread. Compared with HPLC method, the proposed method is more sensitive by two orders of magnitude. The accuracy and precision of this method are acceptable and comparable with HPLC method. Therefore, the proposed method could be used for rapid screening of Chr FB in the mentioned foodstuffs. Copyright © 2016. Published by Elsevier B.V.

  6. Dicty_cDB: CHR591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK

  7. Expansion of the CHR bone code system

    International Nuclear Information System (INIS)

    Farnham, J.E.; Schlenker, R.A.

    1976-01-01

    This report describes the coding system used in the Center for Human Radiobiology (CHR) to identify individual bones and portions of bones of a complete skeletal system. It includes illustrations of various bones and bone segments with their respective code numbers. Codes are also presented for bone groups and for nonbone materials

  8. "J. Chr. Brotze. Estonica" esitlused Poolas

    Index Scriptorium Estoniae

    2007-01-01

    TLÜ emeriitprofessori Raimo Pullati juhtimisel ja TLÜ teadlaste ühistööna valminud entsüklopeedilise suurteose "J. Chr. Brotze. Estonica" esitlused Johannes Paulus II nim. Lublini Katoliiklikus Ülikoolis seminaril "Eesti kultuur ja kunst" ning Poola Rahvusraamatukogus, kus toimub ka Brotze kollektsiooni näituse avamine

  9. Chromium resistance characteristics of Cr(VI) resistance genes ChrA and ChrB in Serratia sp. S2.

    Science.gov (United States)

    He, Yuan; Dong, Lanlan; Zhou, Simin; Jia, Yan; Gu, Ruijia; Bai, Qunhua; Gao, Jieying; Li, Yingli; Xiao, Hong

    2018-08-15

    To find an efficient chromium (VI) resistance system, with a highly efficient, economical, safe, and environmentally friendly chromium-removing strain, ChrA, ChrB, and ChrAB fragments of the chromium (VI) resistance gene in Serratia sp. S2 were cloned, and their prokaryotic expression vectors were constructed and transformed into E. coli BL21. The anti-chromium (VI) capacity and characteristics of engineered bacteria, role of ChrA and ChrB genes in the anti-chromium (VI) processes, and the mechanism of chromium metabolism, were explored. The PCR technique was used to amplify ChrA, ChrB, and ChrAB genes from the Serratia sp. S2 genome. ChrA, ChrB, and ChrAB genes were connected to the prokaryotic expression vector pET-28a and transferred into E. coli BL21 for prokaryotic expression. Cr-absorption and Cr-efflux ability of the engineered strains were determined. The effects of respiratory inhibitors and oxygenated anions on Cr-efflux of ChrA and ChrB engineered strains were explored. ChrA, ChrB, and ChrAB engineered strains were constructed successfully; there was no significant difference between the control strain and the ChrB engineered strain for Cr-metabolism (P > 0.05). Cr-absorption and Cr-efflux of ChrA and ChrAB engineered strains were significantly stronger than the control strain (P < 0.05). Oxyanions (sulfate and molybdate) and inhibitors (valinomycin and CN - ) could significantly inhibit the Cr-efflux capacities of ChrA and ChrAB engineered strains (P < 0.05), while NADPH could significantly promote such capacities (P < 0.05). The Cr-transporter, encoded by ChrA gene, confer the ability to pump out intracellular Cr on ChrA and ChrAB engineered strains. The ChrB gene plays a positive regulatory role in ChrA gene regulation. The Cr-metabolism ability of the ChrAB engineered strain is stronger than the ChrA engineered strain. ChrA and ChrAB genes in the Cr-resistance system may involve a variety of mechanisms, such as sulfate ion channel and

  10. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  11. CHR729 Is a CHD3 Protein That Controls Seedling Development in Rice.

    Science.gov (United States)

    Ma, Xiaoding; Ma, Jian; Zhai, Honghong; Xin, Peiyong; Chu, Jinfang; Qiao, Yongli; Han, Longzhi

    2015-01-01

    CHD3 is one of the chromatin-remodeling factors that contribute to controlling the expression of genes associated with plant development. Loss-of-function mutants display morphological and growth defects. However, the molecular mechanisms underlying CHD3 regulation of plant development remain unclear. In this study, a rice CHD3 protein, CHR729, was identified. The corresponding mutant line (t483) exhibited late seed germination, low germination rate, dwarfism, low tiller number, root growth inhibition, adaxial albino leaves, and short and narrow leaves. CHR729 encoded a nuclear protein and was expressed in almost all organs. RNA-sequencing analysis showed that several plant hormone-related genes were up- or down-regulated in t483 compared to wild type. In particular, expression of the gibberellin synthetase gibberellin 20 oxidase 4 gene was elevated in the mutant. Endogenous gibberellin assays demonstrated that the content of bioactive GA3 was reduced in t483 compared to wild type. Moreover, the seedling dwarfism, late seed germination, and short root length phenotypes of t483 were partially rescued by treatment with exogenous GA3. These results suggest that the rice CHD3 protein CHR729 plays an important role in many aspects of seedling development and controls this development via the gibberellin pathway.

  12. CHR729 Is a CHD3 Protein That Controls Seedling Development in Rice.

    Directory of Open Access Journals (Sweden)

    Xiaoding Ma

    Full Text Available CHD3 is one of the chromatin-remodeling factors that contribute to controlling the expression of genes associated with plant development. Loss-of-function mutants display morphological and growth defects. However, the molecular mechanisms underlying CHD3 regulation of plant development remain unclear. In this study, a rice CHD3 protein, CHR729, was identified. The corresponding mutant line (t483 exhibited late seed germination, low germination rate, dwarfism, low tiller number, root growth inhibition, adaxial albino leaves, and short and narrow leaves. CHR729 encoded a nuclear protein and was expressed in almost all organs. RNA-sequencing analysis showed that several plant hormone-related genes were up- or down-regulated in t483 compared to wild type. In particular, expression of the gibberellin synthetase gibberellin 20 oxidase 4 gene was elevated in the mutant. Endogenous gibberellin assays demonstrated that the content of bioactive GA3 was reduced in t483 compared to wild type. Moreover, the seedling dwarfism, late seed germination, and short root length phenotypes of t483 were partially rescued by treatment with exogenous GA3. These results suggest that the rice CHD3 protein CHR729 plays an important role in many aspects of seedling development and controls this development via the gibberellin pathway.

  13. Reduction of Hexavalent Chromium and Detection of Chromate Reductase (ChrR in Stenotrophomonas maltophilia

    Directory of Open Access Journals (Sweden)

    Rosa Baldiris

    2018-02-01

    Full Text Available An Gram negative strain of S. maltophilia, indigenous to environments contaminated by Cr(VI and identified by biochemical methods and 16S rRNA gene analysis, reduced chromate by 100%, 98–99% and 92% at concentrations in the 10–70, 80–300, and 500 mg/L range, respectively at pH 7 and temperature 37 °C. Increasing concentrations of Cr(VI in the medium lowered the growth rate but could not be directly correlated with the amount of Cr(VI reduced. The strain also exhibited multiple resistance to antibiotics and tolerance and resistance to various heavy metals (Ni, Zn and Cu, with the exception of Hg. Hexavalent chromium reduction was mainly associated with the soluble fraction of the cell evaluated with crude cell-free extracts. A protein of molecular weight around 25 kDa was detected on SDS-PAGE gel depending on the concentration of hexavalent chromium in the medium (0, 100 and 500 mg/L. In silico analysis in this contribution, revealed the presence of the chromate reductase gene ChrR in S. maltophilia, evidenced through a fragment of around 468 bp obtained experimentally. High Cr(VI concentration resistance and high Cr(VI reducing ability of the strain make it a suitable candidate for bioremediation.

  14. Multimerized CHR-derived peptides as HIV-1 fusion inhibitors.

    Science.gov (United States)

    Nomura, Wataru; Hashimoto, Chie; Suzuki, Takaharu; Ohashi, Nami; Fujino, Masayuki; Murakami, Tsutomu; Yamamoto, Naoki; Tamamura, Hirokazu

    2013-08-01

    To date, several HIV-1 fusion inhibitors based on the carboxy-terminal leucine/isoleucine heptad repeat (CHR) region of an HIV-1 envelope protein gp41 have been discovered. We have shown that a synthetic peptide mimetic of a trimer form of the CHR-derived peptide C34 has potent inhibitory activity against the HIV-1 fusion mechanism, compared to a monomer C34 peptide. The present study revealed that a dimeric form of C34 is evidently structurally critical for fusion inhibitors, and that the activity of multimerized CHR-derived peptides in fusion inhibition is affected by the properties of the unit peptides C34, SC34EK, and T20. The fluorescence-based study suggested that the N36-interactive sites of the C34 trimer, including hydrophobic residues, are exposed outside the trimer and that trimerization of C34 caused a remarkable increase in fusion inhibitory activity. The present results could be useful in the design of fusion inhibitors against viral infections which proceed via membrane fusion with host cells. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. Bypass flow rate control method

    International Nuclear Information System (INIS)

    Kiyama, Yoichi.

    1997-01-01

    In a PWR type reactor, bypass flow rate is controlled by exchanging existent jetting hole plugs of a plurality of nozzles disposed to the upper end of incore structures in order to flow a portion of primary coolants as a bypass flow to the upper portion of the pressure vessel. Two kinds of exchange plugs, namely, a first plug and a second plug each having a jetting out hole of different diameter are used as exchange plugs. The first plug has the diameter as that of an existent plug and the second plug has a jetting out hole having larger diameter than that of the existent plug. Remained extent plugs are exchanged to a combination of the first and the second plugs without exchanging existent plugs having seizing with the nozzles, in which the number and the diameter of the jetting out holes of the second plugs are previously determined based on predetermined total bypass flow rate to be jetted from the entire plugs after exchange of plugs. (N.H.)

  16. A Phase Ib dose-escalation study to evaluate safety and tolerability of the addition of the aminopeptidase inhibitor tosedostat (CHR-2797) to paclitaxel in patients with advanced solid tumours.

    NARCIS (Netherlands)

    Herpen, C.M.L. van; Eskens, F.A.; Jonge, M. de; Desar, I.M.E.; Hooftman, L.; Bone, E.A.; Timmer-Bonte, J.N.H.; Verweij, J.

    2010-01-01

    BACKGROUND: This Phase Ib dose-escalating study investigated safety, maximum tolerated dose (MTD), dose-limiting toxicity (DLT), pharmacokinetics (PK) and clinical antitumour activity of tosedostat (CHR-2797), an orally bioavailable aminopeptidase inhibitor, in combination with paclitaxel. METHODS:

  17. An algorithm using reticulocyte hemoglobin content (CHr) measurement in screening adolescents for iron deficiency.

    Science.gov (United States)

    Stoffman, Nava; Brugnara, Carlo; Woods, Elizabeth R

    2005-06-01

    To evaluate whether the use of an algorithm including reticulocyte hemoglobin content (CHr), a new hematologic parameter, in addition to the screening complete blood count (CBC), improves detection of iron deficiency and iron deficiency anemia in healthy adolescents. After initiation of an algorithm using CHr in addition to CBC results for identifying iron-deficient patients in a primary care hospital-based adolescent clinic, we reviewed results of all hematological tests performed in the clinic during an 8-month period. Electronic medical records were screened for health status and inclusion criteria. We determined the number of patients with low hematocrit values, low mean cell volume (MCV), and low CHr. To evaluate the impact of the protocol, we calculated the percentage of cases in which the CHr results suggested a management plan different from that which would have been formulated using the CBC results only. A total of 381 patients (mean age 16.8 +/- 3.1 years) were included in the study. Anemia was diagnosed by the Centers for Disease Control (CDC) guidelines in 63 patients (16.5%), low MCV in 170 patients (44.6%), and a low CHr in 80 (21%) patients. In 68% of anemia cases, a normal CHr suggested that iron deficiency was not the cause of the anemia. Although low MCV values were found in 38 (60.4%) of all anemic cases, mean MCV was significantly (p < 0.001) lower in the 19 cases with a low CHr as well. In 19% of 318 patients with a normal hematocrit (HCT), a low CHr suggested the need for treatment of early iron deficiency. In 103 (27%) cases, CHr suggested a different treatment plan from that which would have been formulated using the screening CBC only. The use of an algorithm including CHr to screen for iron deficiency anemia may increase the accuracy of diagnosis, enabling early detection and treatment of iron deficiency in adolescents without the need for additional costly iron studies.

  18. ChR2 transgenic animals in peripheral sensory system: Sensing light as various sensations.

    Science.gov (United States)

    Ji, Zhi-Gang; Wang, Hongxia

    2016-04-01

    Since the introduction of Channelrhodopsin-2 (ChR2) to neuroscience, optogenetics technology was developed, making it possible to activate specific neurons or circuits with spatial and temporal precision. Various ChR2 transgenic animal models have been generated and are playing important roles in revealing the mechanisms of neural activities, mapping neural circuits, controlling the behaviors of animals as well as exploring new strategy for treating the neurological diseases in both central and peripheral nervous system. An animal including humans senses environments through Aristotle's five senses (sight, hearing, smell, taste and touch). Usually, each sense is associated with a kind of sensory organ (eyes, ears, nose, tongue and skin). Is it possible that one could hear light, smell light, taste light and touch light? When ChR2 is targeted to different peripheral sensory neurons by viral vectors or generating ChR2 transgenic animals, the animals can sense the light as various sensations such as hearing, touch, pain, smell and taste. In this review, we focus on ChR2 transgenic animals in the peripheral nervous system. Firstly the working principle of ChR2 as an optogenetic actuator is simply described. Then the current transgenic animal lines where ChR2 was expressed in peripheral sensory neurons are presented and the findings obtained by these animal models are reviewed. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Rating Methods for Proactive Recommendation on Smartwatches

    OpenAIRE

    Janosch Maier, Wolfgang Wörndl

    2015-01-01

    This paper analyzes possible interaction methods for using a recommender system on a smartwatch. As prerequisite, we describe interaction patterns currently used by Android Wear applications. Based on a prototype implementation the interaction methods action buttons, two button card and swipes are compared against each other. In a user study, 31 participating students were asked to rate restaurant recommendations offered in the setting of a context-aware, proactive recommender system. For eac...

  20. Sterilization: new method options, failure rate info.

    Science.gov (United States)

    1998-01-01

    This article discusses new sterilization methods for tubal ligation, failure rates, and risks for ectopic pregnancy in the US. The Filshie clip, which was developed by Femcare, Ltd. in Nottingham, England, and is distributed by Avalon Medical Corp of Vermont, was approved by the US Food and Drug Administration in September 1996. The company has provided training sessions at major universities nationwide and exhibited at national professional association meetings. A training video and two more films will be available in 1998. The new clip is considered a more modern approach to a tubal occlusion method, which relies on newer materials and solves prior problems. Physicians usually used Falope rings, which had better failure rates than the Hulka clip and bipolar coagulation methods. There is a need for more long-term and large scale information exchange about the new Filshie clip. Some physicians still use the Falope ring because it is cost effective and well-studied. Physicians are warned to continue to advise women about the potential failure rates up to 10 years after sterilization and the 1 in 3 risk of ectopic pregnancy. Counseling about failure rates and the risk of ectopic pregnancy should target women under 30 years old, who have the highest failure rates, and women 30-34 years old. All sterilized women should be advised to seek a provider immediately if they have pregnancy symptoms following sterilization. Counseling should include the issue of "regrets," since it is a permanent method. All women should know about nonpermanent methods and experience a basic informed consent process. Young women and newly divorced women are particularly vulnerable to the "regrets" syndrome.

  1. Identification and functional analysis of a CDE/CHR element in the POLDI promoter

    Institute of Scientific and Technical Information of China (English)

    SONG NanMeng; ZHU XiaoYu; SHI Lei; AN Jing; WU YanWei; SANG JianLi

    2009-01-01

    Chinese Center for Disease Control and Prevention, Beijing 102206, China DNA polymerase delta is encoded by the POLD1 gene, the transcription of which is strictly cell cy-cle-dependent. However, the means by which POLD1 transcription is regulated by the cell cycle mechanism is currently unknown. We discovered a novel element in the POLD1 promoter known as a CDE(cell cycle-dependent element)lCHR(cell cycle gene homology region) element. A series of luci-ferase reporter constructs containing various POLD1 promoter mutations were used to investigate the role of the CDF_JCHR element in POLD1 transcription. When the CDE/CHR element was mutated, the promoter activity was up-regulated, and the cell-cycle related factors E2F1 and p21 stopped regulating the promoter. Furthermore, cell cycle-dependent changes in the promoter activity required the integra-tive CDE/CHR element. Electrophoretic mobility shift assay (EMSA) revealed the presence of at least three types of DNA/protein complexes binding to the CDE/CHR element. Our findings provide strong evidence that the CDE/CHR-like sequence is an active functional element in the POLD1 promoter, which is important for the cell cycle regulation of the POLD1 gene.

  2. Fastest Rates for Stochastic Mirror Descent Methods

    KAUST Repository

    Hanzely, Filip

    2018-03-20

    Relative smoothness - a notion introduced by Birnbaum et al. (2011) and rediscovered by Bauschke et al. (2016) and Lu et al. (2016) - generalizes the standard notion of smoothness typically used in the analysis of gradient type methods. In this work we are taking ideas from well studied field of stochastic convex optimization and using them in order to obtain faster algorithms for minimizing relatively smooth functions. We propose and analyze two new algorithms: Relative Randomized Coordinate Descent (relRCD) and Relative Stochastic Gradient Descent (relSGD), both generalizing famous algorithms in the standard smooth setting. The methods we propose can be in fact seen as a particular instances of stochastic mirror descent algorithms. One of them, relRCD corresponds to the first stochastic variant of mirror descent algorithm with linear convergence rate.

  3. Fastest Rates for Stochastic Mirror Descent Methods

    KAUST Repository

    Hanzely, Filip; Richtarik, Peter

    2018-01-01

    Relative smoothness - a notion introduced by Birnbaum et al. (2011) and rediscovered by Bauschke et al. (2016) and Lu et al. (2016) - generalizes the standard notion of smoothness typically used in the analysis of gradient type methods. In this work we are taking ideas from well studied field of stochastic convex optimization and using them in order to obtain faster algorithms for minimizing relatively smooth functions. We propose and analyze two new algorithms: Relative Randomized Coordinate Descent (relRCD) and Relative Stochastic Gradient Descent (relSGD), both generalizing famous algorithms in the standard smooth setting. The methods we propose can be in fact seen as a particular instances of stochastic mirror descent algorithms. One of them, relRCD corresponds to the first stochastic variant of mirror descent algorithm with linear convergence rate.

  4. Baltika CHR/Evermani asemele tuleb Mosaic / Liis Kängsepp

    Index Scriptorium Estoniae

    Kängsepp, Liis, 1981-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 22. veebr. lk. 6. AS Baltika annab kaubamärgile CHR/Evermen uue nime Mosaic. Diagramm: Kaupluste arv ja käive. Vt. samas: Klementi juht kiidab Baltika brändivahetuse heaks

  5. Synthesis and spectroscopic studies of silver and rhodium mono- and polynuclear complexes with multidentate phosphines (Ph2P)2CHR (R = H, Me, PPh2)

    NARCIS (Netherlands)

    Koten, G. van; Ploeg, A.F.M.J. van der

    1981-01-01

    Trinuclear [{(Ph{2}P){3}CH}Ag{3}(O{2}CR'){3}], dinuclear [{(Ph{2}P){2}CHR}Ag{2}(O{2}CR'){2}], [{(Ph{2}P){2}CHR}{2}Ag{2}](BF{4}){2} and (Rh{2}(Cl)(CO){2}{(Ph{2}P){2}CHMe}{2}][RhCl{2}(CO){2}], and mononuclear (Rh{(Ph{2}P){2}CHR}{2}](BF{4}), (Rh{(Ph{2}P){2}CHR}{2}HCl](BF{4}), d

  6. Baltika muudab CHR/Evermeni kaubamärgi Mosaiciks / Anneli Lepp

    Index Scriptorium Estoniae

    Lepp, Anneli

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 15. veebr. lk. 7. Baltika muudab rõivamärgi CHR/Everman nime Mosaiciks, et anda viimastel aastatel kõige kiiremini kasvanud poeketile ühtne identiteet ja kergem kirjapilt, mis võimaldaks ka välisturul edukamalt läbi lüüa. Lisa: Baltika uus kaubamärk Mosaic

  7. High Repetition Rate Thermometry System And Method

    KAUST Repository

    Chrystie, Robin

    2015-05-14

    A system and method for rapid thermometry using intrapulse spectroscopy can include a laser for propagating pulses of electromagnetic radiation to a region. Each of the pulses can be chirped. The pulses from the region can be detected. An intrapulse absorbance spectrum can be determined from the pulses. An instantaneous temperature of the region based on the intrapulse absorbance spectrum can be determined.

  8. High Repetition Rate Thermometry System And Method

    KAUST Repository

    Chrystie, Robin; Farooq, Aamir

    2015-01-01

    A system and method for rapid thermometry using intrapulse spectroscopy can include a laser for propagating pulses of electromagnetic radiation to a region. Each of the pulses can be chirped. The pulses from the region can be detected. An intrapulse absorbance spectrum can be determined from the pulses. An instantaneous temperature of the region based on the intrapulse absorbance spectrum can be determined.

  9. High School Graduation Rates:Alternative Methods and Implications

    Directory of Open Access Journals (Sweden)

    Jing Miao

    2004-10-01

    Full Text Available The No Child Left Behind Act has brought great attention to the high school graduation rate as one of the mandatory accountability measures for public school systems. However, there is no consensus on how to calculate the high school graduation rate given the lack of longitudinal databases that track individual students. This study reviews literature on and practices in reporting high school graduation rates, compares graduation rate estimates yielded from alternative methods, and estimates discrepancies between alternative results at national, state, and state ethnic group levels. Despite the graduation rate method used, results indicate that high school graduation rates in the U.S. have been declining in recent years and that graduation rates for black and Hispanic students lag substantially behind those of white students. As to graduation rate method preferred, this study found no evidence that the conceptually more complex methods yield more accurate or valid graduation rate estimates than the simpler methods.

  10. A constitutively expressed pair of rpoE2-chrR2 in Azospirillum brasilense Sp7 is required for survival under antibiotic and oxidative stress.

    Science.gov (United States)

    Gupta, Namrata; Kumar, Santosh; Mishra, Mukti Nath; Tripathi, Anil Kumar

    2013-02-01

    Extracytoplasmic function (ECF) sigma factors (σ(E)) are known to bring about changes in gene expression to enable bacteria to adapt to different stresses. The Azospirillum brasilense Sp245 genome harbours nine genes encoding σ(E), of which two are adjacent to the genes encoding ChrR-type zinc-binding anti-sigma (ZAS) factors. We describe here the role and regulation of a new pair of rpoE-chrR, which was found in the genome of A. brasilense Sp7 in addition to the previously described rpoE-chrR pair (designated rpoE1-chrR1). The rpoE2-chrR2 pair is also cotranscribed, and their products show protein-protein interaction. The -10 and -35 promoter elements of rpoE2-chrR2 and rpoE1-chrR1 were similar but not identical. Unlike the promoter of rpoE1-chrR1, the rpoE2-chrR2 promoter was neither autoregulated nor induced by oxidative stress. Inactivation of chrR2 or overexpression of rpoE2 in A. brasilense Sp7 resulted in an overproduction of carotenoids. It also conferred resistance to oxidative stresses and antibiotics. By controlling the synthesis of carotenoids, initiation and elongation of translation, protein folding and purine biosynthesis, RpoE2 seems to play a crucial role in preventing and repairing the cellular damage caused by oxidative stress. Lack of autoregulation and constitutive expression of rpoE2-chrR2 suggest that RpoE2-ChrR2 may provide a rapid mechanism to cope with oxidative stress, wherein singlet oxygen ((1)O(2))-mediated dissociation of the RpoE2-ChrR2 complex might release RpoE2 to drive the expression of its target genes.

  11. An SEU rate prediction method for microprocessors of space applications

    International Nuclear Information System (INIS)

    Gao Jie; Li Qiang

    2012-01-01

    In this article,the relationship between static SEU (Single Event Upset) rate and dynamic SEU rate in microprocessors for satellites is studied by using process duty cycle concept and fault injection technique. The results are compared to in-orbit flight monitoring data. The results show that dynamic SEU rate by using process duty cycle can estimate in-orbit SEU rate of microprocessor reasonable; and the fault injection technique is a workable method to estimate SEU rate. (authors)

  12. A New Method to Calculate Internal Rate of Return

    Directory of Open Access Journals (Sweden)

    azadeh zandi

    2015-09-01

    Full Text Available A number of methods have been developed to choose the best capital investment projects such as net present value, internal rate of return and etc. Internal rate of return method is probably the most popular method among managers and investors. But despite the popularity there are serious drawbacks and limitations in this method. After decades of efforts made by economists and experts to improve the method and its shortcomings, Magni in 2010 has revealed a new approach that can solves the most of internal rate of return method problems. This paper present a new method which is originated from Magni’s approach but has much more simple calculations and can resolve all the drawbacks of internal rate of return method.

  13. Proposed test method for determining discharge rates from water closets

    DEFF Research Database (Denmark)

    Nielsen, V.; Fjord Jensen, T.

    At present the rates at which discharge takes place from sanitary appliances are mostly known only in the form of estimated average values. SBI has developed a measuring method enabling determination of the exact rate of discharge from a sanitary appliance as function of time. The methods depends...

  14. High School Graduation Rates:Alternative Methods and Implications

    OpenAIRE

    Jing Miao; Walt Haney

    2004-01-01

    The No Child Left Behind Act has brought great attention to the high school graduation rate as one of the mandatory accountability measures for public school systems. However, there is no consensus on how to calculate the high school graduation rate given the lack of longitudinal databases that track individual students. This study reviews literature on and practices in reporting high school graduation rates, compares graduation rate estimates yielded from alternative methods, and estimates d...

  15. Sodium flow rate measurement method of annular linear induction pump

    International Nuclear Information System (INIS)

    Araseki, Hideo

    2011-01-01

    This report describes a method for measuring sodium flow rate of annular linear induction pumps arranged in parallel and its verification result obtained through an experiment and a numerical analysis. In the method, the leaked magnetic field is measured with measuring coils at the stator end on the outlet side and is correlated with the sodium flow rate. The experimental data and the numerical result indicate that the leaked magnetic field at the stator edge keeps almost constant when the sodium flow rate changes and that the leaked magnetic field change arising from the flow rate change is small compared with the overall leaked magnetic field. It is shown that the correlation between the leaked magnetic field and the sodium flow rate is almost linear due to this feature of the leaked magnetic field, which indicates the applicability of the method to small-scale annular linear induction pumps. (author)

  16. Review of assessment methods discount rate in investment analysis

    Directory of Open Access Journals (Sweden)

    Yamaletdinova Guzel Hamidullovna

    2011-08-01

    Full Text Available The article examines the current methods of calculating discount rate in investment analysis and business valuation, as well as analyzes the key problems using various techniques in terms of the Russian economy.

  17. Heart rate-based lactate minimum test: a reproducible method.

    NARCIS (Netherlands)

    Strupler, M.; Muller, G.; Perret, C.

    2009-01-01

    OBJECTIVE: To find the individual intensity for aerobic endurance training, the lactate minimum test (LMT) seems to be a promising method. LMTs described in the literature consist of speed or work rate-based protocols, but for training prescription in daily practice mostly heart rate is used. The

  18. Sodium flow rate measurement method of annular linear induction pumps

    International Nuclear Information System (INIS)

    Araseki, Hideo; Kirillov, Igor R.; Preslitsky, Gennady V.

    2012-01-01

    Highlights: ► We found a new method of flow rate monitoring of electromagnetic pump. ► The method is very simple and does not require a large space. ► The method was verified with an experiment and a numerical analysis. ► The experimental data and the numerical results are in good agreement. - Abstract: The present paper proposes a method for measuring sodium flow rate of annular linear induction pumps. The feature of the method lies in measuring the leaked magnetic field with measuring coils near the stator end on the outlet side and in correlating it with the sodium flow rate. This method is verified through an experiment and a numerical analysis. The data obtained in the experiment reveals that the correlation between the leaked magnetic field and the sodium flow rate is almost linear. The result of the numerical analysis agrees with the experimental data. The present method will be particularly effective to sodium flow rate monitoring of each one of plural annular linear induction pumps arranged in parallel in a vessel which forms a large-scale pump unit.

  19. Re-assessing copepod growth using the Moult Rate method

    DEFF Research Database (Denmark)

    Hirst, Andrew G.; Keister, J. E.; Richardson, A. J.

    2014-01-01

    Estimating growth and production rates of mesozooplankton, and copepods in particular, is important in describing flows of material and energy though pelagic systems. Over the past 30 years, the Moult Rate (MR) method has been used to estimate juvenile copepod growth rates in ∼40 papers. Yet the MR......-moulting stage, e.g. copepodite stage 5 to adult. We performed experiments with Calanus pacificus to estimate growth of stage C5 using an alternative method. We found that the error size and sign varied between mass type (i.e. DW, C and N). Recommendations for practical future assessments of growth in copepods...

  20. Advanced evaluation method of SG TSP BEC hole blockage rate

    International Nuclear Information System (INIS)

    Izumida, Hiroyuki; Nagata, Yasuyuki; Harada, Yutaka; Murakami, Ryuji

    2003-01-01

    In spite of the control of the water chemistry of SG secondary feed-water in PWR-SG, SG TSP BEC holes, which are the flow path of secondary water, are often clogged. In the past, the trending of BEC hole blockage rate has conducted by evaluating ECT original signals and visual inspections. However, the ECT original signals of deposits are diversified, it becomes difficult to analyze them with the existing evaluation method using the ECT original signals. In this regard, we have developed the secondary side visual inspection system, which enables the high-accuracy evaluation of BEC hole blockage rate, and new ECT signal evaluation method. (author)

  1. A method to assign failure rates for piping reliability assessments

    International Nuclear Information System (INIS)

    Gamble, R.M.; Tagart, S.W. Jr.

    1991-01-01

    This paper reports on a simplified method that has been developed to assign failure rates that can be used in reliability and risk studies of piping. The method can be applied on a line-by-line basis by identifying line and location specific attributes that can lead to piping unreliability from in-service degradation mechanisms and random events. A survey of service experience for nuclear piping reliability also was performed. The data from this survey provides a basis for identifying in-service failure attributes and assigning failure rates for risk and reliability studies

  2. Novel Method For Low-Rate Ddos Attack Detection

    Science.gov (United States)

    Chistokhodova, A. A.; Sidorov, I. D.

    2018-05-01

    The relevance of the work is associated with an increasing number of advanced types of DDoS attacks, in particular, low-rate HTTP-flood. Last year, the power and complexity of such attacks increased significantly. The article is devoted to the analysis of DDoS attacks detecting methods and their modifications with the purpose of increasing the accuracy of DDoS attack detection. The article details low-rate attacks features in comparison with conventional DDoS attacks. During the analysis, significant shortcomings of the available method for detecting low-rate DDoS attacks were found. Thus, the result of the study is an informal description of a new method for detecting low-rate denial-of-service attacks. The architecture of the stand for approbation of the method is developed. At the current stage of the study, it is possible to improve the efficiency of an already existing method by using a classifier with memory, as well as additional information.

  3. Measurement for the Leak Rate enhanced by a Improved Method

    International Nuclear Information System (INIS)

    Bae, Sang-Hoon; Choi, Young-San; Kim, Young-Ki; Lee, Yong-Sub; Jung, Hoan-Sung

    2007-01-01

    The leak rate measurement of the HANARO such as a research reactor that adopts a confinement concept for a reactor hall is very important one during a period inspection. This test verifies whether the reactor building could maintain the negative pressure or not when radiation is perceived by abnormal accidents. Of course, this may not cause a problem in a reactor operation only if it can satisfy the design requirement, but it is necessary to have some margin of a limitation value because a reactor hall should be managed more conservatively than the design reference. To meet the requirements of this strict design condition, previous method was changed to a new type of test with more stable and robust measuring method. The new leak rate measurement method is briefly introduced and the merits of this proposed method are shown through the data analyzed for last 3 years

  4. Benchmark calculations for evaluation methods of gas volumetric leakage rate

    International Nuclear Information System (INIS)

    Asano, R.; Aritomi, M.; Matsuzaki, M.

    1998-01-01

    A containment function of radioactive materials transport casks is essential for safe transportation to prevent the radioactive materials from being released into environment. Regulations such as IAEA standard determined the limit of radioactivity to be released. Since is not practical for the leakage tests to measure directly the radioactivity release from a package, as gas volumetric leakages rates are proposed in ANSI N14.5 and ISO standards. In our previous works, gas volumetric leakage rates for several kinds of gas from various leaks were measured and two evaluation methods, 'a simple evaluation method' and 'a strict evaluation method', were proposed based on the results. The simple evaluation method considers the friction loss of laminar flow with expansion effect. The strict evaluating method considers an exit loss in addition to the friction loss. In this study, four worked examples were completed for on assumed large spent fuel transport cask (Type B Package) with wet or dry capacity and at three transport conditions; normal transport with intact fuels or failed fuels, and an accident in transport. The standard leakage rates and criteria for two kinds of leak test were calculated for each example by each evaluation method. The following observations are made based upon the calculations and evaluations: the choked flow model of ANSI method greatly overestimates the criteria for tests ; the laminar flow models of both ANSI and ISO methods slightly overestimate the criteria for tests; the above two results are within the design margin for ordinary transport condition and all methods are useful for the evaluation; for severe condition such as failed fuel transportation, it should pay attention to apply a choked flow model of ANSI method. (authors)

  5. CREME96 and Related Error Rate Prediction Methods

    Science.gov (United States)

    Adams, James H., Jr.

    2012-01-01

    Predicting the rate of occurrence of single event effects (SEEs) in space requires knowledge of the radiation environment and the response of electronic devices to that environment. Several analytical models have been developed over the past 36 years to predict SEE rates. The first error rate calculations were performed by Binder, Smith and Holman. Bradford and Pickel and Blandford, in their CRIER (Cosmic-Ray-Induced-Error-Rate) analysis code introduced the basic Rectangular ParallelePiped (RPP) method for error rate calculations. For the radiation environment at the part, both made use of the Cosmic Ray LET (Linear Energy Transfer) spectra calculated by Heinrich for various absorber Depths. A more detailed model for the space radiation environment within spacecraft was developed by Adams and co-workers. This model, together with a reformulation of the RPP method published by Pickel and Blandford, was used to create the CR ME (Cosmic Ray Effects on Micro-Electronics) code. About the same time Shapiro wrote the CRUP (Cosmic Ray Upset Program) based on the RPP method published by Bradford. It was the first code to specifically take into account charge collection from outside the depletion region due to deformation of the electric field caused by the incident cosmic ray. Other early rate prediction methods and codes include the Single Event Figure of Merit, NOVICE, the Space Radiation code and the effective flux method of Binder which is the basis of the SEFA (Scott Effective Flux Approximation) model. By the early 1990s it was becoming clear that CREME and the other early models needed Revision. This revision, CREME96, was completed and released as a WWW-based tool, one of the first of its kind. The revisions in CREME96 included improved environmental models and improved models for calculating single event effects. The need for a revision of CREME also stimulated the development of the CHIME (CRRES/SPACERAD Heavy Ion Model of the Environment) and MACREE (Modeling and

  6. Simple method for the estimation of glomerular filtration rate

    Energy Technology Data Exchange (ETDEWEB)

    Groth, T [Group for Biomedical Informatics, Uppsala Univ. Data Center, Uppsala (Sweden); Tengstroem, B [District General Hospital, Skoevde (Sweden)

    1977-02-01

    A simple method is presented for indirect estimation of the glomerular filtration rate from two venous blood samples, drawn after a single injection of a small dose of (/sup 125/I)sodium iothalamate (10 ..mu..Ci). The method does not require exact dosage, as the first sample, taken after a few minutes (t=5 min) after injection, is used to normilize the value of the second sample, which should be taken in between 2 to 4 h after injection. The glomerular filtration rate, as measured by standard insulin clearance, may then be predicted from the logarithm of the normalized value and linear regression formulas with a standard error of estimate of the order of 1 to 2 ml/min/1.73 m/sup 2/. The slope-intercept method for direct estimation of glomerular filtration rate is also evaluated and found to significantly underestimate standard insulin clearance. The normalized 'single-point' method is concluded to be superior to the slope-intercept method and more sophisticated methods using curve fitting technique, with regard to predictive force and clinical applicability.

  7. Parallel efficient rate control methods for JPEG 2000

    Science.gov (United States)

    Martínez-del-Amor, Miguel Á.; Bruns, Volker; Sparenberg, Heiko

    2017-09-01

    Since the introduction of JPEG 2000, several rate control methods have been proposed. Among them, post-compression rate-distortion optimization (PCRD-Opt) is the most widely used, and the one recommended by the standard. The approach followed by this method is to first compress the entire image split in code blocks, and subsequently, optimally truncate the set of generated bit streams according to the maximum target bit rate constraint. The literature proposes various strategies on how to estimate ahead of time where a block will get truncated in order to stop the execution prematurely and save time. However, none of them have been defined bearing in mind a parallel implementation. Today, multi-core and many-core architectures are becoming popular for JPEG 2000 codecs implementations. Therefore, in this paper, we analyze how some techniques for efficient rate control can be deployed in GPUs. In order to do that, the design of our GPU-based codec is extended, allowing stopping the process at a given point. This extension also harnesses a higher level of parallelism on the GPU, leading to up to 40% of speedup with 4K test material on a Titan X. In a second step, three selected rate control methods are adapted and implemented in our parallel encoder. A comparison is then carried out, and used to select the best candidate to be deployed in a GPU encoder, which gave an extra 40% of speedup in those situations where it was really employed.

  8. Effect of different rates and methods of benomyl and mancozeb ...

    African Journals Online (AJOL)

    AJB SERVER

    2006-07-22

    Jul 22, 2006 ... Field assessment of different rates and methods of three fungicide applications on delay in senescence. (DS) and grain ... Out of 170 species in the genus, V. unguiculata is ... The experiment was conducted at the teaching and research farm of Faculty of Agricultural Sciences, Ladoke Akintola University of.

  9. Seeding method and rate influence on weed suppression in aerobic ...

    African Journals Online (AJOL)

    High weed pressure is amongst the major constraints to the extensive adoption of aerobic rice system as a water-wise technique. Towards developing a sustainable weed management strategy, seeding method and rate may substantially contribute to weed suppression and reduce herbicide use and weeding cost. A trough ...

  10. Estimating Maternal Mortality Rate Using Sisterhood Methods in ...

    African Journals Online (AJOL)

    ... maternal and child morbidity and mortality, which could serve as a surveillance strategy to identify the magnitude of the problem and to mobilize resources to areas where the problems are most prominent for adequate control. KEY WORDS: Maternal Mortality Rate, Sisterhood Method. Highland Medical Research Journal ...

  11. Lidar method to estimate emission rates from extended sources

    Science.gov (United States)

    Currently, point measurements, often combined with models, are the primary means by which atmospheric emission rates are estimated from extended sources. However, these methods often fall short in their spatial and temporal resolution and accuracy. In recent years, lidar has emerged as a suitable to...

  12. Reduction of patient dose delivered by CHR diagnostic x-ray examinations

    International Nuclear Information System (INIS)

    Evans, R.D.; Schlenker, R.A.

    1978-01-01

    Three changes in technique have been made which reduce the x-ray dose delivered by diagnostic examinations of patients of the Center for Human Radiobiology (CHR): Kodak Lanex Regular screens and Kodak Ortho G film have been substituted for DuPont Cronex Parspeed screens and DuPont Cronex 4 film for five projections in the MIT examinations; 3 mm Al added filtration is now used in place of 1 mm Al added filtration in the ANL examination; improvements in collimation for the ANL examination have been made. Use of the new screen-film combination at MIT has reduced the mean dose to the active marrow of the female RANDO phantom from 606 +- 69 mrad to 235 +- 16 mrad; it has reduced the ovary dose from 606 +- 40 mrad to 291 +- 19 mrad and has left the breast dose unchanged at 333 +- 103 mrad. The change from 1 mm Al to 3 mm Al added filtration at ANL, without changes in collimation, would reduce the mean marrow dose in the phantom from 232 +- 14 mrad to 175 +- 26 mrad, reduce the ovary dose from 243 +- 25 mrad to 162 +- 38 mrad and reduce the breast dose from 388 +- 35 mrad to 226 +- 9 mrad. The changes in collimation at ANL should reduce these doses even further but the quantitative effect has not been ascertained

  13. Comparison between calculation methods of dose rates in gynecologic brachytherapy

    International Nuclear Information System (INIS)

    Vianello, E.A.; Biaggio, M.F.; D R, M.F.; Almeida, C.E. de

    1998-01-01

    In treatments with radiations for gynecologic tumors is necessary to evaluate the quality of the results obtained by different calculation methods for the dose rates on the points of clinical interest (A, rectal, vesicle). The present work compares the results obtained by two methods. The Manual Calibration Method (MCM) tri dimensional (Vianello E., et.al. 1998), using orthogonal radiographs for each patient in treatment, and the Theraplan/T P-11 planning system (Thratonics International Limited 1990) this last one verified experimentally (Vianello et.al. 1996). The results show that MCM can be used in the physical-clinical practice with a percentile difference comparable at the computerized programs. (Author)

  14. Prospects for DNA methods to measure human heritable mutation rates

    International Nuclear Information System (INIS)

    Mendelsohn, M.L.

    1985-01-01

    A workshop cosponsored by ICPEMC and the US Department of Energy was held in Alta, Utah, December 9-13, 1984 to examine the extent to which DNA-oriented methods might provide new approaches to the important but intractable problem of measuring mutation rates in control and exposed human populations. The workshop identified and analyzed six DNA methods for detection of human heritable mutation, including several created at the meeting, and concluded that none of the methods combine sufficient feasibility and efficiency to be recommended for general application. 8 refs

  15. A Genome-wide Association Study Provides Evidence of Sex-specific Involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 With Diabetic Neuropathic Pain

    Directory of Open Access Journals (Sweden)

    Weihua Meng

    2015-10-01

    Full Text Available Neuropathic pain is defined as pain arising as a direct consequence of a lesion or a disease affecting the somatosensory system and it affects around 1 in 4 diabetic patients in the UK. The purpose of this genome-wide association study (GWAS was to identify genetic contributors to this disorder. Cases of neuropathic pain were defined as diabetic patients with a multiple prescription history of at least one of five drugs specifically indicated for the treatment of neuropathic pain. Controls were diabetic individuals who were not prescribed any of these drugs, nor amitriptyline, carbamazepine, or nortriptyline. Overall, 961 diabetic neuropathic pain cases and 3260 diabetic controls in the Genetics of Diabetes Audit and Research Tayside (GoDARTS cohort were identified. We found a cluster in the Chr1p35.1 (ZSCAN20-TLR12P with a lowest P value of 2.74 × 10−7 at rs71647933 in females and a cluster in the Chr8p23.1, next to HMGB1P46 with a lowest P value of 8.02 × 10−7 at rs6986153 in males. Sex-specific narrow sense heritability was higher in males (30.0% than in females (14.7%. This GWAS on diabetic neuropathic pain provides evidence for the sex-specific involvement of Chr1p35.1 (ZSCAN20-TLR12P and Chr8p23.1 (HMGB1P46 with the disorder, indicating the need for further research.

  16. 76 FR 38281 - Federal Employees Health Benefits Program: New Premium Rating Method for Most Community Rated...

    Science.gov (United States)

    2011-06-29

    ... CFR Parts 1602, 1615, et al. Federal Employees Health Benefits Program: New Premium Rating Method for... Part 890; 48 CFR Parts 1602, 1615, 1632, and 1652 RIN 3206-AM39 Federal Employees Health Benefits..., 2011 (76 FR 36857). The document amends the Federal Employees Health Benefits (FEHB) regulations at 5...

  17. Methods for estimating disease transmission rates: Evaluating the precision of Poisson regression and two novel methods

    DEFF Research Database (Denmark)

    Kirkeby, Carsten Thure; Hisham Beshara Halasa, Tariq; Gussmann, Maya Katrin

    2017-01-01

    the transmission rate. We use data from the two simulation models and vary the sampling intervals and the size of the population sampled. We devise two new methods to determine transmission rate, and compare these to the frequently used Poisson regression method in both epidemic and endemic situations. For most...... tested scenarios these new methods perform similar or better than Poisson regression, especially in the case of long sampling intervals. We conclude that transmission rate estimates are easily biased, which is important to take into account when using these rates in simulation models....

  18. A comparison of surveillance methods for small incidence rates

    Energy Technology Data Exchange (ETDEWEB)

    Sego, Landon H.; Woodall, William H.; Reynolds, Marion R.

    2008-05-15

    A number of methods have been proposed to detect an increasing shift in the incidence rate of a rare health event, such as a congenital malformation. Among these are the Sets method, two modifcations of the Sets method, and the CUSUM method based on the Poisson distribution. We consider the situation where data are observed as a sequence of Bernoulli trials and propose the Bernoulli CUSUM chart as a desirable method for the surveillance of rare health events. We compare the performance of the Sets method and its modifcations to the Bernoulli CUSUM chart under a wide variety of circumstances. Chart design parameters were chosen to satisfy a minimax criteria.We used the steady- state average run length to measure chart performance instead of the average run length which was used in nearly all previous comparisons involving the Sets method or its modifcations. Except in a very few instances, we found that the Bernoulli CUSUM chart has better steady-state average run length performance than the Sets method and its modifcations for the extensive number of cases considered.

  19. Method for enhancing microbial utilization rates of gases using perfluorocarbons

    Science.gov (United States)

    Turick, C.E.

    1997-06-10

    A method of enhancing the bacterial reduction of industrial gases using perfluorocarbons (PFCs) is disclosed. Because perfluorocarbons (PFCs) allow for a much greater solubility of gases than water does, PFCs have the potential to deliver gases in higher concentrations to microorganisms when used as an additive to microbial growth media thereby increasing the rate of the industrial gas conversion to economically viable chemicals and gases. 3 figs.

  20. Large deviations and queueing networks: Methods for rate function identification

    OpenAIRE

    Atar, Rami; Dupuis, Paul

    1999-01-01

    This paper considers the problem of rate function identification for multidimensional queueing models with feedback. A set of techniques are introduced which allow this identification when the model possesses certain structural properties. The main tools used are representation formulas for exponential integrals, weak convergence methods, and the regularity properties of associated Skorokhod Problems. Two examples are treated as special cases of the general theory: the classical Jackson netwo...

  1. Semi-Automatic Rating Method for Neutrophil Alkaline Phosphatase Activity.

    Science.gov (United States)

    Sugano, Kanae; Hashi, Kotomi; Goto, Misaki; Nishi, Kiyotaka; Maeda, Rie; Kono, Keigo; Yamamoto, Mai; Okada, Kazunori; Kaga, Sanae; Miwa, Keiko; Mikami, Taisei; Masauzi, Nobuo

    2017-01-01

    The neutrophil alkaline phosphatase (NAP) score is a valuable test for the diagnosis of myeloproliferative neoplasms, but it has still manually rated. Therefore, we developed a semi-automatic rating method using Photoshop ® and Image-J, called NAP-PS-IJ. Neutrophil alkaline phosphatase staining was conducted with Tomonaga's method to films of peripheral blood taken from three healthy volunteers. At least 30 neutrophils with NAP scores from 0 to 5+ were observed and taken their images. From which the outer part of neutrophil was removed away with Image-J. These were binarized with two different procedures (P1 and P2) using Photoshop ® . NAP-positive area (NAP-PA) and granule (NAP-PGC) were measured and counted with Image-J. The NAP-PA in images binarized with P1 significantly (P < 0.05) differed between images with NAP scores from 0 to 3+ (group 1) and those from 4+ to 5+ (group 2). The original images in group 1 were binarized with P2. NAP-PGC of them significantly (P < 0.05) differed among all four NAP score groups. The mean NAP-PGC with NAP-PS-IJ indicated a good correlation (r = 0.92, P < 0.001) to results by human examiners. The sensitivity and specificity of NAP-PS-IJ were 60% and 92%, which might be considered as a prototypic method for the full-automatic rating NAP score. © 2016 Wiley Periodicals, Inc.

  2. RCS Leak Rate Calculation with High Order Least Squares Method

    International Nuclear Information System (INIS)

    Lee, Jeong Hun; Kang, Young Kyu; Kim, Yang Ki

    2010-01-01

    As a part of action items for Application of Leak before Break(LBB), RCS Leak Rate Calculation Program is upgraded in Kori unit 3 and 4. For real time monitoring of operators, periodic calculation is needed and corresponding noise reduction scheme is used. This kind of study was issued in Korea, so there have upgraded and used real time RCS Leak Rate Calculation Program in UCN unit 3 and 4 and YGN unit 1 and 2. For reduction of the noise in signals, Linear Regression Method was used in those programs. Linear Regression Method is powerful method for noise reduction. But the system is not static with some alternative flow paths and this makes mixed trend patterns of input signal values. In this condition, the trend of signal and average of Linear Regression are not entirely same pattern. In this study, high order Least squares Method is used to follow the trend of signal and the order of calculation is rearranged. The result of calculation makes reasonable trend and the procedure is physically consistence

  3. 76 FR 21673 - Alternative Efficiency Determination Methods and Alternate Rating Methods

    Science.gov (United States)

    2011-04-18

    ... EERE-2011-BP-TP-00024] RIN 1904-AC46 Alternative Efficiency Determination Methods and Alternate Rating Methods AGENCY: Office of Energy Efficiency and Renewable Energy, Department of Energy. ACTION: Notice of... and data related to the use of computer simulations, mathematical methods, and other alternative...

  4. Apparatus and method for determining solids circulation rate

    Science.gov (United States)

    Ludlow, J Christopher [Morgantown, WV; Spenik, James L [Morgantown, WV

    2012-02-14

    The invention relates to a method of determining bed velocity and solids circulation rate in a standpipe experiencing a moving packed bed flow, such as the in the standpipe section of a circulating bed fluidized reactor The method utilizes in-situ measurement of differential pressure over known axial lengths of the standpipe in conjunction with in-situ gas velocity measurement for a novel application of Ergun equations allowing determination of standpipe void fraction and moving packed bed velocity. The method takes advantage of the moving packed bed property of constant void fraction in order to integrate measured parameters into simultaneous solution of Ergun-based equations and conservation of mass equations across multiple sections of the standpipe.

  5. Waste tank ventilation rates measured with a tracer gas method

    International Nuclear Information System (INIS)

    Huckaby, J.L.; Evans, J.C.; Sklarew, D.S.; Mitroshkov, A.V.

    1998-08-01

    Passive ventilation with the atmosphere is used to prevent accumulation of waste gases and vapors in the headspaces of 132 of the 177 high-level radioactive waste Tanks at the Hanford Site in Southeastern Washington State. Measurements of the passive ventilation rates are needed for the resolution of two key safety issues associated with the rates of flammable gas production and accumulation and the rates at which organic salt-nitrate salt mixtures dry out. Direct measurement of passive ventilation rates using mass flow meters is not feasible because ventilation occurs va multiple pathways to the atmosphere (i.e., via the filtered breather riser and unsealed tank risers and pits), as well as via underground connections to other tanks, junction boxes, and inactive ventilation systems. The tracer gas method discussed in this report provides a direct measurement of the rate at which gases are removed by ventilation and an indirect measurement of the ventilation rate. The tracer gas behaves as a surrogate of the waste-generated gases, but it is only diminished via ventilation, whereas the waste gases are continuously released by the waste and may be subject to depletion mechanisms other than ventilation. The fiscal year 1998 tracer studies provide new evidence that significant exchange of air occurs between tanks via the underground cascade pipes. Most of the single-shell waste tanks are connected via 7.6-cm diameter cascade pipes to one or two adjacent tanks. Tracer gas studies of the Tank U-102/U-103 system indicated that the ventilation occurring via the cascade line could be a significant fraction of the total ventilation. In this two-tank cascade, air evidently flowed from Tank U-103 to Tank U-102 for a time and then was observed to flow from Tank U-102 to Tank U-103

  6. Scale factor measure method without turntable for angular rate gyroscope

    Science.gov (United States)

    Qi, Fangyi; Han, Xuefei; Yao, Yanqing; Xiong, Yuting; Huang, Yuqiong; Wang, Hua

    2018-03-01

    In this paper, a scale factor test method without turntable is originally designed for the angular rate gyroscope. A test system which consists of test device, data acquisition circuit and data processing software based on Labview platform is designed. Taking advantage of gyroscope's sensitivity of angular rate, a gyroscope with known scale factor, serves as a standard gyroscope. The standard gyroscope is installed on the test device together with a measured gyroscope. By shaking the test device around its edge which is parallel to the input axis of gyroscope, the scale factor of the measured gyroscope can be obtained in real time by the data processing software. This test method is fast. It helps test system miniaturized, easy to carry or move. Measure quarts MEMS gyroscope's scale factor multi-times by this method, the difference is less than 0.2%. Compare with testing by turntable, the scale factor difference is less than 1%. The accuracy and repeatability of the test system seems good.

  7. A Galvanic Coupling Method for Assessing Hydration Rates

    Directory of Open Access Journals (Sweden)

    Clement Ogugua Asogwa

    2016-07-01

    Full Text Available Recent advances in biomedical sensors, data acquisition techniques, microelectronics and wireless communication systems opened up the use of wearable technology for ehealth monitoring. We introduce a galvanic coupled intrabody communication for monitoring human body hydration. Studies in hydration provide the information necessary for understanding the desired fluid levels for optimal performance of the body’s physiological and metabolic processes during exercise and activities of daily living. Current measurement techniques are mostly suitable for laboratory purposes due to their complexity and technical requirements. Less technical methods such as urine color observation and skin turgor testing are subjective and cannot be integrated into a wearable device. Bioelectrical impedance methods are popular but mostly used for estimating total body water with limited accuracy and sensitive to 800 mL–1000 mL change in body fluid levels. We introduce a non-intrusive and simple method of tracking hydration rates that can detect up to 1.30 dB reduction in attenuation when as little as 100 mL of water is consumed. Our results show that galvanic coupled intrabody signal propagation can provide qualitative hydration and dehydration rates in line with changes in an individual’s urine specific gravity and body mass. The real-time changes in galvanic coupled intrabody signal attenuation can be integrated into wearable electronic devices to evaluate body fluid levels on a particular area of interest and can aid diagnosis and treatment of fluid disorders such as lymphoedema.

  8. A Fast Soft Bit Error Rate Estimation Method

    Directory of Open Access Journals (Sweden)

    Ait-Idir Tarik

    2010-01-01

    Full Text Available We have suggested in a previous publication a method to estimate the Bit Error Rate (BER of a digital communications system instead of using the famous Monte Carlo (MC simulation. This method was based on the estimation of the probability density function (pdf of soft observed samples. The kernel method was used for the pdf estimation. In this paper, we suggest to use a Gaussian Mixture (GM model. The Expectation Maximisation algorithm is used to estimate the parameters of this mixture. The optimal number of Gaussians is computed by using Mutual Information Theory. The analytical expression of the BER is therefore simply given by using the different estimated parameters of the Gaussian Mixture. Simulation results are presented to compare the three mentioned methods: Monte Carlo, Kernel and Gaussian Mixture. We analyze the performance of the proposed BER estimator in the framework of a multiuser code division multiple access system and show that attractive performance is achieved compared with conventional MC or Kernel aided techniques. The results show that the GM method can drastically reduce the needed number of samples to estimate the BER in order to reduce the required simulation run-time, even at very low BER.

  9. The method of treatment cessation and recurrence rate of amblyopia.

    Science.gov (United States)

    Walsh, Leah A; Hahn, Erik K; LaRoche, G Robert

    2009-09-01

    To date, much of the research regarding amblyopia has been focused on which therapeutic modality is the most efficacious in amblyopia management. Unfortunately, there is a lack of research into which method of treatment cessation is the most appropriate once therapy has been completed. The purpose of this study is to investigate if the cessation method affects the recurrence rate of amblyopia. This study was a prospective randomized clinical trial of 20 subjects who were wearing full-time occlusion and were at the end point of their therapy. The subjects were randomized into one of two groups: abrupt cessation or therapy tapering. All subjects were followed for 3 consecutive 4-week intervals, for a total of 12 weeks, to assess the short-term recurrence rate of amblyopia. Subjects who were in the tapered group had their occlusion reduced from full-time occlusion (all waking hours minus one) to 50% of waking hours at study enrollment (i.e., from 12 hours/day to 6 hours per day); occlusion was reduced by an additional 50% at the first 4-week study visit (i.e., from 6 hours/day to 3 hours), with occlusion being discontinued completely at the week 8 visit. All subjects who were in the abrupt cessation group had their full-time occlusion discontinued completely at the start of the study (i.e., from 12 hours/day to none). Additional assessments were also conducted at week 26 and week 52 post-therapy cessation to determine the longer term amblyopia regression rate. For the purposes of this study, recurrence was defined as a 0.2 (10 letters) or more logarithm of the minimum angle of resolution (logMAR) loss of visual acuity. A recurrence of amblyopia occurred in 4 of 17 (24%; CI 9%-47%) participants completing the study by the week 52 study end point. There were 2 subjects from each treatment group who demonstrated a study protocol-defined recurrence. There was a 24% risk of amblyopia recurrence if therapy was discontinued abruptly or tapered in 8 weeks. In this small

  10. Calculation method for gamma-dose rates from spherical puffs

    International Nuclear Information System (INIS)

    Thykier-Nielsen, S.; Deme, S.; Lang, E.

    1993-05-01

    The Lagrangian puff-models are widely used for calculation of the dispersion of atmospheric releases. Basic output from such models are concentrations of material in the air and on the ground. The most simple method for calculation of the gamma dose from the concentration of airborne activity is based on semi-infinite cloud model. This method is however only applicable for points far away from the release point. The exact calculation of the cloud dose using the volume integral requires significant computer time. The volume integral for the gamma dose could be approximated by using the semi-infinite cloud model combined with correction factors. This type of calculation procedure is very fast, but usually the accuracy is poor due to the fact that the same correction factors are used for all isotopes. The authors describe a more elaborate correction method. This method uses precalculated values of the gamma-dose rate as a function of the puff dispersion parameter (δ p ) and the distance from the puff centre for four energy groups. The release of energy for each radionuclide in each energy group has been calculated and tabulated. Based on these tables and a suitable interpolation procedure the calculation of gamma doses takes very short time and is almost independent of the number of radionuclides. (au) (7 tabs., 7 ills., 12 refs.)

  11. Standard test method for measurement of fatigue crack growth rates

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2015-01-01

    1.1 This test method covers the determination of fatigue crack growth rates from near-threshold to Kmax controlled instability. Results are expressed in terms of the crack-tip stress-intensity factor range (ΔK), defined by the theory of linear elasticity. 1.2 Several different test procedures are provided, the optimum test procedure being primarily dependent on the magnitude of the fatigue crack growth rate to be measured. 1.3 Materials that can be tested by this test method are not limited by thickness or by strength so long as specimens are of sufficient thickness to preclude buckling and of sufficient planar size to remain predominantly elastic during testing. 1.4 A range of specimen sizes with proportional planar dimensions is provided, but size is variable to be adjusted for yield strength and applied force. Specimen thickness may be varied independent of planar size. 1.5 The details of the various specimens and test configurations are shown in Annex A1-Annex A3. Specimen configurations other than t...

  12. Dose rate reduction method for NMCA applied BWR plants

    International Nuclear Information System (INIS)

    Nagase, Makoto; Aizawa, Motohiro; Ito, Tsuyoshi; Hosokawa, Hideyuki; Varela, Juan; Caine, Thomas

    2012-09-01

    BRAC (BWR Radiation Assessment and Control) dose rate is used as an indicator of the incorporation of activated corrosion by products into BWR recirculation piping, which is known to be a significant contributor to dose rate received by workers during refueling outages. In order to reduce radiation exposure of the workers during the outage, it is desirable to keep BRAC dose rates as low as possible. After HWC was adopted to reduce IGSCC, a BRAC dose rate increase was observed in many plants. As a countermeasure to these rapid dose rate increases under HWC conditions, Zn injection was widely adopted in United States and Europe resulting in a reduction of BRAC dose rates. However, BRAC dose rates in several plants remain high, prompting the industry to continue to investigate methods to achieve further reductions. In recent years a large portion of the BWR fleet has adopted NMCA (NobleChem TM ) to enhance the hydrogen injection effect to suppress SCC. After NMCA, especially OLNC (On-Line NobleChem TM ), BRAC dose rates were observed to decrease. In some OLNC applied BWR plants this reduction was observed year after year to reach a new reduced equilibrium level. This dose rate reduction trends suggest the potential dose reduction might be obtained by the combination of Pt and Zn injection. So, laboratory experiments and in-plant tests were carried out to evaluate the effect of Pt and Zn on Co-60 deposition behaviour. Firstly, laboratory experiments were conducted to study the effect of noble metal deposition on Co deposition on stainless steel surfaces. Polished type 316 stainless steel coupons were prepared and some of them were OLNC treated in the test loop before the Co deposition test. Water chemistry conditions to simulate HWC were as follows: Dissolved oxygen, hydrogen and hydrogen peroxide were below 5 ppb, 100 ppb and 0 ppb (no addition), respectively. Zn was injected to target a concentration of 5 ppb. The test was conducted up to 1500 hours at 553 K. Test

  13. Calculation method for gamma dose rates from Gaussian puffs

    Energy Technology Data Exchange (ETDEWEB)

    Thykier-Nielsen, S; Deme, S; Lang, E

    1995-06-01

    The Lagrangian puff models are widely used for calculation of the dispersion of releases to the atmosphere. Basic output from such models is concentration of material in the air and on the ground. The most simple method for calculation of the gamma dose from the concentration of airborne activity is based on the semi-infinite cloud model. This method is however only applicable for puffs with large dispersion parameters, i.e. for receptors far away from the release point. The exact calculation of the cloud dose using volume integral requires large computer time usually exceeding what is available for real time calculations. The volume integral for gamma doses could be approximated by using the semi-infinite cloud model combined with correction factors. This type of calculation procedure is very fast, but usually the accuracy is poor because only a few of the relevant parameters are considered. A multi-parameter method for calculation of gamma doses is described here. This method uses precalculated values of the gamma dose rates as a function of E{sub {gamma}}, {sigma}{sub y}, the asymmetry factor - {sigma}{sub y}/{sigma}{sub z}, the height of puff center - H and the distance from puff center R{sub xy}. To accelerate the calculations the release energy, for each significant radionuclide in each energy group, has been calculated and tabulated. Based on the precalculated values and suitable interpolation procedure the calculation of gamma doses needs only short computing time and it is almost independent of the number of radionuclides considered. (au) 2 tabs., 15 ills., 12 refs.

  14. Calculation method for gamma dose rates from Gaussian puffs

    International Nuclear Information System (INIS)

    Thykier-Nielsen, S.; Deme, S.; Lang, E.

    1995-06-01

    The Lagrangian puff models are widely used for calculation of the dispersion of releases to the atmosphere. Basic output from such models is concentration of material in the air and on the ground. The most simple method for calculation of the gamma dose from the concentration of airborne activity is based on the semi-infinite cloud model. This method is however only applicable for puffs with large dispersion parameters, i.e. for receptors far away from the release point. The exact calculation of the cloud dose using volume integral requires large computer time usually exceeding what is available for real time calculations. The volume integral for gamma doses could be approximated by using the semi-infinite cloud model combined with correction factors. This type of calculation procedure is very fast, but usually the accuracy is poor because only a few of the relevant parameters are considered. A multi-parameter method for calculation of gamma doses is described here. This method uses precalculated values of the gamma dose rates as a function of E γ , σ y , the asymmetry factor - σ y /σ z , the height of puff center - H and the distance from puff center R xy . To accelerate the calculations the release energy, for each significant radionuclide in each energy group, has been calculated and tabulated. Based on the precalculated values and suitable interpolation procedure the calculation of gamma doses needs only short computing time and it is almost independent of the number of radionuclides considered. (au) 2 tabs., 15 ills., 12 refs

  15. Validation method training: nurses' experiences and ratings of work climate.

    Science.gov (United States)

    Söderlund, Mona; Norberg, Astrid; Hansebo, Görel

    2014-03-01

    Training nursing staff in communication skills can impact on the quality of care for residents with dementia and contributes to nurses' job satisfaction. Changing attitudes and practices takes time and energy and can affect the entire nursing staff, not just the nurses directly involved in a training programme. Therefore, it seems important to study nurses' experiences of a training programme and any influence of the programme on work climate among the entire nursing staff. To explore nurses' experiences of a 1-year validation method training programme conducted in a nursing home for residents with dementia and to describe ratings of work climate before and after the programme. A mixed-methods approach. Twelve nurses participated in the training and were interviewed afterwards. These individual interviews were tape-recorded and transcribed, then analysed using qualitative content analysis. The Creative Climate Questionnaire was administered before (n = 53) and after (n = 56) the programme to the entire nursing staff in the participating nursing home wards and analysed with descriptive statistics. Analysis of the interviews resulted in four categories: being under extra strain, sharing experiences, improving confidence in care situations and feeling uncertain about continuing the validation method. The results of the questionnaire on work climate showed higher mean values in the assessment after the programme had ended. The training strengthened the participating nurses in caring for residents with dementia, but posed an extra strain on them. These nurses also described an extra strain on the entire nursing staff that was not reflected in the results from the questionnaire. The work climate at the nursing home wards might have made it easier to conduct this extensive training programme. Training in the validation method could develop nurses' communication skills and improve their handling of complex care situations. © 2013 Blackwell Publishing Ltd.

  16. Measurement of gastric emptying rate in humans. Simplified scanning method

    Energy Technology Data Exchange (ETDEWEB)

    Holt, S.; Colliver, J.; Guram, M.; Neal, C.; Verhulst, S.J.; Taylor, T.V. (Univ. of South Carolina School of Medicine, Columbia (USA))

    1990-11-01

    Simultaneous measurements of the gastric emptying rate of the solid and liquid phase of a dual-isotope-labeled test meal were made using a gamma camera and a simple scintillation detector, similar to that used in a hand-held probe. A simple scanning apparatus, similar to that used in a hand-held scintillation probe, was compared with simultaneous measurements made by a gamma camera in 16 healthy males. A dual-labeled test meal was utilized to measure liquid and solid emptying simultaneously. Anterior and posterior scans were taken at intervals up to 120 min using both a gamma camera and the scintillation probe. Good relative agreement between the methods was obtained both for solid-phase (correlation range 0.92-0.99, mean 0.97) and for liquid-phase data (correlation range 0.93-0.99, mean 0.97). For solid emptying data regression line slopes varied from 0.75 to 1.03 (mean 0.84). Liquid emptying data indicated that slopes ranged from 0.71 to 1.06 (mean 0.87). These results suggested that an estimate of the gamma measurement could be obtained by multiplying the scintillation measurement by a factor of 0.84 for the solid phase and 0.87 for the liquid phase. Correlation between repeat studies was 0.97 and 0.96 for solids and liquids, respectively. The application of a hand-held probe technique provides a noninvasive and inexpensive method for accurately assessing solid- and liquid-phase gastric emptying from the human stomach that correlates well with the use of a gamma camera, within the range of gastric emptying rate in the normal individuals in this study.

  17. Measurement of gastric emptying rate in humans. Simplified scanning method

    International Nuclear Information System (INIS)

    Holt, S.; Colliver, J.; Guram, M.; Neal, C.; Verhulst, S.J.; Taylor, T.V.

    1990-01-01

    Simultaneous measurements of the gastric emptying rate of the solid and liquid phase of a dual-isotope-labeled test meal were made using a gamma camera and a simple scintillation detector, similar to that used in a hand-held probe. A simple scanning apparatus, similar to that used in a hand-held scintillation probe, was compared with simultaneous measurements made by a gamma camera in 16 healthy males. A dual-labeled test meal was utilized to measure liquid and solid emptying simultaneously. Anterior and posterior scans were taken at intervals up to 120 min using both a gamma camera and the scintillation probe. Good relative agreement between the methods was obtained both for solid-phase (correlation range 0.92-0.99, mean 0.97) and for liquid-phase data (correlation range 0.93-0.99, mean 0.97). For solid emptying data regression line slopes varied from 0.75 to 1.03 (mean 0.84). Liquid emptying data indicated that slopes ranged from 0.71 to 1.06 (mean 0.87). These results suggested that an estimate of the gamma measurement could be obtained by multiplying the scintillation measurement by a factor of 0.84 for the solid phase and 0.87 for the liquid phase. Correlation between repeat studies was 0.97 and 0.96 for solids and liquids, respectively. The application of a hand-held probe technique provides a noninvasive and inexpensive method for accurately assessing solid- and liquid-phase gastric emptying from the human stomach that correlates well with the use of a gamma camera, within the range of gastric emptying rate in the normal individuals in this study

  18. Assessment method to predict the rate of unresolved false alarms

    International Nuclear Information System (INIS)

    Reardon, P.T.; Eggers, R.F.; Heaberlin, S.W.

    1982-06-01

    A method has been developed to predict the rate of unresolved false alarms of material loss in a nuclear facility. The computer program DETRES-1 was developed. The program first assigns the true values of control unit components receipts, shipments, beginning and ending inventories. A normal random number generator is used to generate measured values of each component. A loss estimator is calculated from the control unit's measured values. If the loss estimator triggers a detection alarm, a response is simulated. The response simulation is divided into two phases. The first phase is to simulate remeasurement of the components of the detection loss estimator using the same or better measurement methods or inferences from surrounding control units. If this phase of response continues to indicate a material loss, phase of response simulating a production shutdown and comprehensive cleanout is initiated. A new loss estimator is found, and tested against the alarm thresholds. If the estimator value is below the threshold, the original detection alarm is considered resolved; if above the threshold, an unresolved alarm has occurred. A tally is kept of valid alarms, unresolved false alarms, and failure to alarm upon a true loss

  19. Development of a method for rating climate seat comfort

    Science.gov (United States)

    Scheffelmeier, M.; Classen, E.

    2017-10-01

    The comfort aspect in the vehicle interior is becoming increasingly important. A high comfort level offers the driver a good and secure feeling and has a strong influence on passive traffic safety. One important part of comfort is the climate aspect, especially the microclimate that emerges between passenger and seat. In this research, different combinations of typical seat materials are used. Fourteen woven and knitted fabrics and eight leathers and its substitutes for the face fabric layer, one foam, one non-woven and one 3D spacer for the plus pad layer and for the support layer three foam types with variations in structure and raw material as well as one rubber hair structure were investigated. To characterise this sample set by thermo-physiological aspects (e.g. water vapour resistance Ret, thermal resistance Rct, buffering capacity of water vapour Fd) regular and modified sweating guarded hotplates were used according to DIN EN ISO 11092. The results of the material characterisation confirm the common knowledge that seat covers out of textiles have better water vapour resistance values than leathers and its substitutes. Subject trials in a driving simulator were executed to rate the subjective sensation while driving in a vehicle seat. With a thermal, sweating Manikin (Newton Type, Thermetrics) objective product measurements were carried out on the same seat. Indeed the subject trials show that every test subject has his or her own subjective perception concerning the climate comfort. The results of the subject trials offered the parameters for the Newton measuring method. Respectively the sweating rate, sit-in procedure, ambient conditions and sensor positions on and between the seat layers must be comparable with the subject trials. By taking care of all these parameters it is possible to get repeatable and reliable results with the Newton Manikin. The subjective feelings of the test subjects, concerning the microclimate between seat and passenger, provide

  20. Methods of achieving and maintaining an appropriate caesarean section rate.

    LENUS (Irish Health Repository)

    Robson, Michael

    2013-04-01

    Caesarean section rates continue to increase worldwide. The appropriate caesarean section rate remains a topic of debate among women and professionals. Evidence-based medicine has not provided an answer and depends on interpretation of the literature. Overall caesarean section rates are unhelpful, and caesarean section rates should not be judged in isolation from other outcomes and epidemiological characteristics. Better understanding of caesarean section rates, their consequences and their benefits will improve care, and enable learning between delivery units nationally and internationally. To achieve and maintain an appropriate caesarean section rate requires a Multidisciplinary Quality Assurance Programme in each delivery unit, recognising caesarean section rates as one of many factors that determine quality. Women will always choose the type of delivery that seems safest to them and their babies. Professionals need to monitor the quality of their practice continuously in a standardised way to ensure that women can make the right choice.

  1. Experiences with leak rate calculations methods for LBB application

    International Nuclear Information System (INIS)

    Grebner, H.; Kastner, W.; Hoefler, A.; Maussner, G.

    1997-01-01

    In this paper, three leak rate computer programs for the application of leak before break analysis are described and compared. The programs are compared to each other and to results of an HDR Reactor experiment and two real crack cases. The programs analyzed are PIPELEAK, FLORA, and PICEP. Generally, the different leak rate models are in agreement. To obtain reasonable agreement between measured and calculated leak rates, it was necessary to also use data from detailed crack investigations

  2. Experiences with leak rate calculations methods for LBB application

    Energy Technology Data Exchange (ETDEWEB)

    Grebner, H.; Kastner, W.; Hoefler, A.; Maussner, G. [and others

    1997-04-01

    In this paper, three leak rate computer programs for the application of leak before break analysis are described and compared. The programs are compared to each other and to results of an HDR Reactor experiment and two real crack cases. The programs analyzed are PIPELEAK, FLORA, and PICEP. Generally, the different leak rate models are in agreement. To obtain reasonable agreement between measured and calculated leak rates, it was necessary to also use data from detailed crack investigations.

  3. Methods of analysis speech rate: a pilot study.

    Science.gov (United States)

    Costa, Luanna Maria Oliveira; Martins-Reis, Vanessa de Oliveira; Celeste, Letícia Côrrea

    2016-01-01

    To describe the performance of fluent adults in different measures of speech rate. The study included 24 fluent adults, of both genders, speakers of Brazilian Portuguese, who were born and still living in the metropolitan region of Belo Horizonte, state of Minas Gerais, aged between 18 and 59 years. Participants were grouped by age: G1 (18-29 years), G2 (30-39 years), G3 (40-49 years), and G4 (50-59 years). The speech samples were obtained following the methodology of the Speech Fluency Assessment Protocol. In addition to the measures of speech rate proposed by the protocol (speech rate in words and syllables per minute), the rate of speech into phonemes per second and the articulation rate with and without the disfluencies were calculated. We used the nonparametric Friedman test and the Wilcoxon test for multiple comparisons. Groups were compared using the nonparametric Kruskal Wallis. The significance level was of 5%. There were significant differences between measures of speech rate involving syllables. The multiple comparisons showed that all the three measures were different. There was no effect of age for the studied measures. These findings corroborate previous studies. The inclusion of temporal acoustic measures such as speech rate in phonemes per second and articulation rates with and without disfluencies can be a complementary approach in the evaluation of speech rate.

  4. Determining Sorption Rate by a Continuous Gravimetric Method

    National Research Council Canada - National Science Library

    Hall, Monicia R; Procell, Lawrence R; Bartram, Philip W; Shuely, Wendel J

    2003-01-01

    ... were automatically recorded in an Excel file while CARC coupons were submerged in solvent. Initial sorption rates were determined for butyl acetate, butyl ether, cyclohexane and propylene carbonate...

  5. De l’utopie socialiste au réalisme chrétien

    Directory of Open Access Journals (Sweden)

    Isabelle Richet

    2006-03-01

    Full Text Available Le New Deal est le premier mouvement réformiste d’ampleur dans l’histoire des Etats‑Unis qui n’ait pas été inspiré, ni soutenu, par les forces du protestantisme. Si une majorité des protestants et de leur clergé se sont opposés au New Deal à partir de positions conservatrices, le théologien Reinhold Niebuhr en a développé au départ une virulente critique de gauche avant de finalement rallier le président démocrate à la fin des années trente. Nourrie par le rejet de l’idéalisme du Social Gospel, incapable à ses yeux de comprendre les rapports sociaux en terme de classe et de pouvoir, la critique de Niebuhr emprunte les outils d’analyse marxistes pour développer une approche réaliste, tant du point de vue des fins que des moyens de la lutte politique. Le New Deal lui apparaît avant tout comme un programme visant à sauver le capitalisme, alors que la société fondée sur la justice qu’il envisage passe par la socialisation des moyens de production qui ne pourra émerger qu’à travers des conflits sociaux au cours desquels les moyens de lutte même violents sont justifiés. Mais sous l’influence des évènements en Europe au lendemain de la victoire d’Hitler, Reinhold Niebuhr se tourne au milieu des années trente vers une réflexion théologique inspirée de l’orthodoxie de Karl Barth et de son frère Richard Niebuhr, qui l’amène à réintroduire le péché comme la limite absolue de toute l’expérience humaine, interdisant d’envisager la création d’une société de paix et de justice. Ce nouvel absolutisme théologique nourrit un relativisme politique, le réalisme chrétien consistant désormais à choisir la moins mauvaise des options en présence. De ce point de vue, le président démocrate qui appelle à la préparation militaire s’impose désormais comme le choix le plus réaliste face à la montée du fascisme en Europe.The New Deal was the first major reformist experiment in the

  6. Effect of weed management methods and nitrogen fertilizer rates on ...

    African Journals Online (AJOL)

    Inefficient weed management practices and the use of inappropriate nitrogen fertilizer rates are the major causes of low yield of wheat in Ethiopia. Therefore, field experiments were conducted at Bobicho and Faate in southern Ethiopia to determine the effect of weed management practices and N fertilizer rates on grain yield ...

  7. Success rate of two different methods of ilioinguinal-iliohypogastric ...

    African Journals Online (AJOL)

    Background: The ilioinguinal-iliohypogastric (ILIH) nerve block is a safe, effective, and easy to perform in order to provide analgesia for a variety of inguinal surgical procedures in pediatric patients. A relatively high failure rate of 10%-25% has been reported, even in experienced hands. It is assumed that this high failure rate ...

  8. Du neuf dans les relations de l'Église orthodoxe avec les autres chrétiens

    OpenAIRE

    Famerée, Joseph

    2015-01-01

    Cette note évoque quatre réunions scientifiques (Athènes, Chambésy, Thessalonique, Iasi) qui, coup sur coup, de mai 2013 à mai 2014, ont permis à des Orthodoxes d’échanger avec d’autres chrétiens, catholiques notamment, sur des sujets théologiques et œcuméniques importants pour l’évolution des différentes Églises. Une nouvelle génération de théologiens orthodoxes se lève, osant parler librement à propos de leur Église et montrer l’écart entre l’Orthodoxie idéale et l’Orthodoxie réelle, spécia...

  9. Optical Methods For Automatic Rating Of Engine Test Components

    Science.gov (United States)

    Pritchard, James R.; Moss, Brian C.

    1989-03-01

    In recent years, increasing commercial and legislative pressure on automotive engine manufacturers, including increased oil drain intervals, cleaner exhaust emissions and high specific power outputs, have led to increasing demands on lubricating oil performance. Lubricant performance is defined by bench engine tests run under closely controlled conditions. After test, engines are dismantled and the parts rated for wear and accumulation of deposit. This rating must be consistently carried out in laboratories throughout the world in order to ensure lubricant quality meeting the specified standards. To this end, rating technicians evaluate components, following closely defined procedures. This process is time consuming, inaccurate and subject to drift, requiring regular recalibration of raters by means of international rating workshops. This paper describes two instruments for automatic rating of engine parts. The first uses a laser to determine the degree of polishing of the engine cylinder bore, caused by the reciprocating action of piston. This instrument has been developed to prototype stage by the NDT Centre at Harwell under contract to Exxon Chemical, and is planned for production within the next twelve months. The second instrument uses red and green filtered light to determine the type, quality and position of deposit formed on the piston surfaces. The latter device has undergone feasibility study, but no prototype exists.

  10. What Predicts Method Effects in Child Behavior Ratings

    Science.gov (United States)

    Low, Justin A.; Keith, Timothy Z.; Jensen, Megan

    2015-01-01

    The purpose of this research was to determine whether child, parent, and teacher characteristics such as sex, socioeconomic status (SES), parental depressive symptoms, the number of years of teaching experience, number of children in the classroom, and teachers' disciplinary self-efficacy predict deviations from maternal ratings in a…

  11. Dose rate measuring device and dose rate measuring method using the same

    International Nuclear Information System (INIS)

    Urata, Megumu; Matsushita, Takashi; Hanazawa, Sadao; Konno, Takahiro; Chiba, Yoshinori; Yumitate, Tadahiro

    1998-01-01

    The device of the present invention comprises a scintillation fiber scope having a shape elongated in the direction of the height of a pressure vessel and emitting light by incident of radiation to detect radiation, a radioactivity measuring device for measuring a dose rate based on the detection of the fiber scope and a reel means for dispensing and taking up the fiber scope, and it constituted such that the dose rate of the pressure vessel and that of a shroud are determined independently. Then, when the taken out shroud is contained in an container, excessive shielding is not necessary, in addition, this device can reliably be inserted to or withdrawn from complicated places between the pressure vessel and the shroud, and further, the dose rate of the pressure vessel and that of the shroud can be measured approximately accurately even when the thickness of them is different greatly. (N.H.)

  12. Dose rate measuring device and dose rate measuring method using the same

    Energy Technology Data Exchange (ETDEWEB)

    Urata, Megumu; Matsushita, Takashi; Hanazawa, Sadao; Konno, Takahiro; Chiba, Yoshinori; Yumitate, Tadahiro

    1998-11-13

    The device of the present invention comprises a scintillation fiber scope having a shape elongated in the direction of the height of a pressure vessel and emitting light by incident of radiation to detect radiation, a radioactivity measuring device for measuring a dose rate based on the detection of the fiber scope and a reel means for dispensing and taking up the fiber scope, and it constituted such that the dose rate of the pressure vessel and that of a shroud are determined independently. Then, when the taken out shroud is contained in an container, excessive shielding is not necessary, in addition, this device can reliably be inserted to or withdrawn from complicated places between the pressure vessel and the shroud, and further, the dose rate of the pressure vessel and that of the shroud can be measured approximately accurately even when the thickness of them is different greatly. (N.H.)

  13. Study of brittle crack jump rate using acoustic emission method

    International Nuclear Information System (INIS)

    Yasnij, P.V.; Pokrovskij, V.V.; Strizhalo, V.A.; Dobrovol'skij, Yu.V.

    1987-01-01

    A new peocedure is elaborated to detect brittle jumps of small length (0.1...5mm) occuring both inside the specimen and along the crack front under static and cyclic loading using the phenomena of acoustic emission (AE). Recording of the crack start and stop moments with an AE sensor as well as evaluation of the brittle crack jump length by the after-failure specimen fracture make it possible to find the mean crack propagation rate. Experimental dependences are obtained for the crack propagation rate with a brittle crack jump in steel 15Kh2MFA (σ B =1157 MPa, σ 0.2 =100 MPa) at 293 K and under cyclic loading as a function of the jump length and also as a function of the critical stress intensity factor K jc i corresponding to the crack jump

  14. Methods of forecasting crack growth rate under creep conditions

    International Nuclear Information System (INIS)

    Ol'kin, S.I.

    1979-01-01

    Using construction aluminium alloy application possibility of linear mechanics of the destruction for quantitative description of crack development process under creepage conditions is investigated. It is shown, that the grade dependence between the stress intensity coefficient and the crack growth rate takes place only at certain combination of the sample geometry and creepage parameters, and consequently, its applicability in every given case must necessarily be tested experimentally

  15. Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148

    NARCIS (Netherlands)

    Fang, Jun; Jia, Jinping; Makowski, Matthew; Xu, Mai; Wang, Zhaoming; Zhang, Tongwu; Hoskins, Jason W; Choi, Jiyeon; Han, Younghun; Zhang, Mingfeng; Thomas, Janelle; Kovacs, Michael; Collins, Irene; Dzyadyk, Marta; Thompson, Abbey; O'Neill, Maura; Das, Sudipto; Lan, Qi; Koster, Roelof; Stolzenberg-Solomon, Rachael S; Kraft, Peter; Wolpin, Brian M; Jansen, Pascal W T C; Olson, Sara H; McGlynn, Katherine A; Kanetsky, Peter A; Chatterjee, Nilanjan; Barrett, Jennifer H.; Dunning, Alison M.; Taylor, John C.; Newton-Bishop, Julia A; Bishop, D. Timothy; Andresson, Thorkell; Petersen, Gloria M; Amos, Christopher I; Iles, Mark M.; Nathanson, Katherine L.; Landi, Maria Teresa; Vermeulen, Michiel; Brown, Kevin M; Amundadottir, Laufey T; Peeters, P

    2017-01-01

    Genome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of these,

  16. Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148

    NARCIS (Netherlands)

    Fang, J. (Jun); Jia, J. (Jinping); Makowski, M. (Matthew); Xu, M. (Mai); Z. Wang (Zhaoming); Zhang, T. (Tongwu); Hoskins, J.W. (Jason W.); Choi, J. (Jiyeon); Han, Y. (Younghun); M. Zhang (Mingfeng); Thomas, J. (Janelle); Kovacs, M. (Michael); Collins, I. (Irene); Dzyadyk, M. (Marta); Thompson, A. (Abbey); O'Neill, M. (Maura); Das, S. (Sudipto); Lan, Q. (Qi); Koster, R. (Roelof); Stolzenberg-Solomon, R.S. (Rachael S.); P. Kraft (Peter); Wolpin, B.M. (Brian M.); P. Jansen; Olson, S. (Sara); K.A. McGlynn; P.P. Kanetsky (Peter P.); N. Chatterjee (Nilanjan); J.H. Barrett (Jennifer H.); A.M. Dunning (Alison); Taylor, J.C. (John C.); J.A. Newton Bishop (Julia); Timothy Bishop, D. (D.); Andresson, T. (Thorkell); Petersen, G.M. (Gloria M.); W. Amos; M.M. Iles (Mark M.); K.L. Nathanson (Katherine); Landi, M.T. (Maria Teresa); M. Vermeulen (Michiel); Brown, K.M. (Kevin M.); Amundadottir, L.T. (Laufey T.)

    2017-01-01

    textabstractGenome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of

  17. Functional characterization of a multi-cancer risk locus on chr5p15.33 reveals regulation of TERT by ZNF148.

    NARCIS (Netherlands)

    Fang, Jun; Jia, Jinping; Makowski, Matthew; Xu, Mai; Wang, Zhaoming; Zhang, Tongwu; Hoskins, Jason W; Choi, Jiyeon; Han, Younghun; Zhang, Mingfeng; Thomas, Janelle; Kovacs, Michael; Collins, Irene; Dzyadyk, Marta; Thompson, Abbey; O'Neill, Maura; Das, Sudipto; Lan, Qi; Koster, Roelof; Stolzenberg-Solomon, Rachael S; Kraft, Peter; Wolpin, Brian M; Jansen, Pascal W T C; Olson, Sara; McGlynn, Katherine A; Kanetsky, Peter A; Chatterjee, Nilanjan; Barrett, Jennifer H; Dunning, Alison M; Taylor, John C; Newton-Bishop, Julia A; Bishop, D Timothy; Andresson, Thorkell; Petersen, Gloria M; Amos, Christopher I; Iles, Mark M; Nathanson, Katherine L; Landi, Maria Teresa; Vermeulen, Michiel; Brown, Kevin M; Amundadottir, Laufey T

    2017-01-01

    Genome wide association studies (GWAS) have mapped multiple independent cancer susceptibility loci to chr5p15.33. Here, we show that fine-mapping of pancreatic and testicular cancer GWAS within one of these loci (Region 2 in CLPTM1L) focuses the signal to nine highly correlated SNPs. Of these,

  18. Comprehensive fine mapping of chr12q12-14 and follow-up replication identify activin receptor 1B (ACVR1B) as a muscle strength gene

    NARCIS (Netherlands)

    Windelinckx, An; De Mars, Gunther; Huygens, Wim; Peeters, Maarten W.; Vincent, Barbara; Wijmenga, Cisca; Lambrechts, Diether; Delecluse, Christophe; Roth, Stephen M.; Metter, E. Jeffrey; Ferrucci, Luigi; Aerssens, Jeroen; Vlietinck, Robert; Beunen, Gaston P.; Thomis, Martine A.

    Muscle strength is important in functional activities of daily living and the prevention of common pathologies. We describe the two-staged fine mapping of a previously identified linkage peak for knee strength on chr12q12-14. First, 209 tagSNPs in/around 74 prioritized genes were genotyped in 500

  19. Los orígenes del grial en la literatura medieval: de Chrétien de Troyes a Robert de Boron

    Directory of Open Access Journals (Sweden)

    Mario Martín Botero

    2010-12-01

    Full Text Available Este artículo muestra el origen literario del tema del Grial en la literatura medieval francesa, abordando dos textos esenciales para el surgimiento y consolidación de la “literatura del Grial”: Le Conte du Graal de Chrétien de Troyes y Le Roman de l’Estoire dou Graal de Robert de Boron. Los autores de estas obras establecen las bases para el desarrollo de toda una temática que gira alrededor del Grial a partir del siglo XII hasta nuestros días. El artículo muestra cómo de un objeto apenas sagrado en el texto de Chrétien de Troyes se pasa a una reliquia de la sangre de Cristo en la versión de Robert de Boron.This paper studies the literary origin of the Grail legend in medieval French literature, taking into account two important romances: Le Conte du Graal by Chrétien de Troyes and Le Roman de l’Estoire dou Graal by Robert de Boron. In these two texts the authors established the basis for the development of a new subject matter around the mysterious object called “Grail” from the Middle Ages to the present times. It will also be shown how an object, not totally sacred in Chrétien de Troyes, becomes a relic related with Jesus’s blood in Robert de Boron.

  20. Comparison of two methods forecasting binding rate of plasma protein.

    Science.gov (United States)

    Hongjiu, Liu; Yanrong, Hu

    2014-01-01

    By introducing the descriptors calculated from the molecular structure, the binding rates of plasma protein (BRPP) with seventy diverse drugs are modeled by a quantitative structure-activity relationship (QSAR) technique. Two algorithms, heuristic algorithm (HA) and support vector machine (SVM), are used to establish linear and nonlinear models to forecast BRPP. Empirical analysis shows that there are good performances for HA and SVM with cross-validation correlation coefficients Rcv(2) of 0.80 and 0.83. Comparing HA with SVM, it was found that SVM has more stability and more robustness to forecast BRPP.

  1. A rapid method to estimate Westergren sedimentation rates.

    Science.gov (United States)

    Alexy, Tamas; Pais, Eszter; Meiselman, Herbert J

    2009-09-01

    The erythrocyte sedimentation rate (ESR) is a nonspecific but simple and inexpensive test that was introduced into medical practice in 1897. Although it is commonly utilized in the diagnosis and follow-up of various clinical conditions, ESR has several limitations including the required 60 min settling time for the test. Herein we introduce a novel use for a commercially available computerized tube viscometer that allows the accurate prediction of human Westergren ESR rates in as little as 4 min. Owing to an initial pressure gradient, blood moves between two vertical tubes through a horizontal small-bore tube and the top of the red blood cell (RBC) column in each vertical tube is monitored continuously with an accuracy of 0.083 mm. Using data from the final minute of a blood viscosity measurement, a sedimentation index (SI) was calculated and correlated with results from the conventional Westergren ESR test. To date, samples from 119 human subjects have been studied and our results indicate a strong correlation between SI and ESR values (R(2)=0.92). In addition, we found a close association between SI and RBC aggregation indices as determined by an automated RBC aggregometer (R(2)=0.71). Determining SI on human blood is rapid, requires no special training and has minimal biohazard risk, thus allowing physicians to rapidly screen for individuals with elevated ESR and to monitor therapeutic responses.

  2. The rate of convergence in the method of alternating projections

    Czech Academy of Sciences Publication Activity Database

    Badea, C.; Grivaux, S.; Müller, Vladimír

    2012-01-01

    Roč. 23, č. 3 (2012), s. 413-434 ISSN 1061-0022 R&D Projects: GA ČR GA201/09/0473; GA AV ČR IAA100190903 Institutional support: RVO:67985840 Keywords : Friedrichs angle * method of alternating projections * arbitrarily slow convergence Subject RIV: BA - General Mathematics Impact factor: 0.460, year: 2012 http://www.ams.org/journals/spmj/2012-23-03/S1061-0022-2012-01202-1/home.html

  3. A New Method for Unconstrained Heart Rate Monitoring

    Science.gov (United States)

    2001-10-25

    members. However, care of bedridden elderly persons are not easy task, and this caused severe psychological and financial problems for other family...physical and mental conditions of bedridden elderly people at home and patients at hospitals and to contribute to the labor saving of the care and the...not suitable for home care of bedridden elderly people. Our method provides very small, simple and mechanically rugged device suitable for home

  4. Une catastrophe glorieuse : le martyre des premiers chrétiens du Japon, Nagasaki, 1597

    Directory of Open Access Journals (Sweden)

    Clotilde Jacquelard

    2011-11-01

    Full Text Available Le naufrage du galion San Felipe dans le port de Urado (Shikoku, Japon en octobre 1596 fut le déclencheur d’un désastre missionnaire : le martyre de vingt-six chrétiens, franciscains espagnols et chrétiens japonais, à Nagasaki, le 5 février 1597. Cet article s’attache à examiner la relation dialectique entre les deux événements par l’étude de deux discours missionnaires franciscains hagiographiques. Il s’agit tout d’abord de rappeler la lecture providentialiste du temps à travers la perception de présages matériels et spirituels de la part des acteurs, puis de montrer que ces évènements paroxystiques révèlent en même temps qu’ils résolvent – temporairement – des tensions et des crises latentes, résultat de la confrontation entre plusieurs communautés culturelles comme la japonaise, l’espagnole et la portugaise, autour de prétentions géopolitiques, commerciales et religieuses dans cette zone de frontière de l’antiméridien du Pacifique nord.El naufragio del galeón San Felipe en el puerto de Urado (Shikoku, Japón en octubre de 1596 desembocó en un desastre misionero : el martirio de veintiséis cristianos, franciscanos españoles y cristianos japoneses, en Nagasaki, el 5 de febrero de 1597. Este artículo quiere examinar la relación dialéctica entre ambos acontecimientos, mediante el estudio de dos discursos misioneros franciscanos hagiográficos. Se trata de recordar primero la lectura providencialista de la época a través de la percepción de presagios tanto materiales como espirituales por parte de los actores, y mostrar luego que estos acontecimientos paroxísticos revelan, al mismo tiempo que resuelven –temporalmente– tensiones y crisis latentes, resultados de la confrontación de varias comunidades culturales como la japonesa, la española y la portuguesa, en torno a pretensiones geopolíticas, comerciales y religiosas en la zona fronteriza del antimeridiano del Pacífico norte.

  5. 77 FR 31756 - Energy Conservation Program: Alternative Efficiency Determination Methods and Alternative Rating...

    Science.gov (United States)

    2012-05-30

    ...-AC46 Energy Conservation Program: Alternative Efficiency Determination Methods and Alternative Rating... regulations authorizing the use of alternative methods of determining energy efficiency or energy consumption... alternative methods of determining energy efficiency or energy consumption of various consumer products and...

  6. A method of estimating the knock rating of hydrocarbon fuel blend

    Science.gov (United States)

    Sanders, Newell D

    1943-01-01

    The usefulness of the knock ratings of pure hydrocarbon compounds would be increased if some reliable method of calculating the knock ratings of fuel blends was known. The purpose of this study was to investigate the possibility of developing a method of predicting the knock ratings of fuel blends.

  7. Living Joyfully after Losing Social Hope: Kierkegaard and Chrétien on Selfhood and Eschatological Expectation

    Directory of Open Access Journals (Sweden)

    J. Aaron Simmons

    2017-02-01

    Full Text Available In this essay, I offer an existential-phenomenological consideration of what it might look like to live joyfully after losing social hope. Using the example of the widespread hopelessness that many are feeling in light of the election of Donald Trump, I suggest that the danger of losing hope is that we can also lose our selfhood in the process. In order to develop a conception of “eschatological hope” that would be resistant to the loss of such social and political expectations, I draw specifically on Søren Kierkegaard’s notion that “the expectancy of faith is victory,” and Jean-Louis Chrétien’s idea of “the unhoped for,” in order to develop a model of hope that remains when it seems like all other hope has been lost. Rather than being overcome by anxiety about the future, eschatological hope fosters joy in the present.

  8. Minimal time spiking in various ChR2-controlled neuron models.

    Science.gov (United States)

    Renault, Vincent; Thieullen, Michèle; Trélat, Emmanuel

    2018-02-01

    We use conductance based neuron models, and the mathematical modeling of optogenetics to define controlled neuron models and we address the minimal time control of these affine systems for the first spike from equilibrium. We apply tools of geometric optimal control theory to study singular extremals, and we implement a direct method to compute optimal controls. When the system is too large to theoretically investigate the existence of singular optimal controls, we observe numerically the optimal bang-bang controls.

  9. Jeux et enjeux d’écriture chez Chrétien de Troyes: l’exemple de «Cligès»

    Directory of Open Access Journals (Sweden)

    Ida Lucia Machado

    2011-10-01

    Full Text Available Neste artigo, nos propomos descrever a estética da trama irônica presente na escritura de Chrétien de Troyes, tomando por base seu romance Cligès. A destacar algumas estratégias passíveis de criar o fenômeno irônico, estaremos também mostrando o poder de sedução que emana desta escritura.Nous nous proposons, dans cet artible, de décrire l’esthétique du jeu ironique chez Chrétien de Troyes, em puisant dans son roman Cligès. Enn dégageant qulques unes dês stratégies susceptibles de créer le phénomène ironique, nous montrerons, à la fois, le pouvoir de séduction qui emane de cette écriture.

  10. Estimation in adults of the glomerular filtration rate in [99mTc] DTPA renography - the rate constant method

    International Nuclear Information System (INIS)

    Carlsen, Ove

    2004-01-01

    The purpose of this study was to design an alternative and robust method for estimation of glomerular filtration rate (GFR) in [ 99 mTc]-diethylenetriaminepentaacetic acid ([ 99 mTc] -DTPA renography with a reliability not significantly lower than that of the conventional Gates' method. Methods: The method is based on renographies lasting 40 min in which regions of interest (ROIs) are manually created over selected parts of certain blood pools (e.g. heart, lungs, spleen, and liver). For each ROI the corresponding time-activity curve (TAC) was generated, decay corrected and exposed to a monoexponential fit in the time interval 10 to 40 min postinjection. The rate constant in min-1 of the monoexponential fit was denoted BETA. Following an iterative procedure comprising usually 5-10 manually created ROIs, the monoexponential fit with the maximum rate constant (BETA max ) was used for estimation of GFR. Results: In a patient material of 54 adult subjects in whom GFR was determined with multiple or one sample techniques with [ 51 Cr]-ethylenediaminetetraacetic acid ([ 51 Cr]-EDTA) the regression curve of standard GFR (GFR std ) (i.e. GFR adjusted to 1.73 m 2 body surface area) showed a close, non-linear relationship with BETA max with a correlation coefficient of 95%. The standard errors of estimate (SEE) were 6.6, 10.6 and 16.8 for GFR std equal to 30, 60, and 120 ml/(min .73 m 2 ), respectively. The corresponding SEE values for almost the same patient material using Gates' method were 8.4, 11.9, and 16.8 ml/(min 1.73 m 2 ). Conclusions: The alternative rate constant method yields estimates of GFR std with SEE values equal to or slightly smaller than in Gates' method. The two methods provide statistically uncorrelated estimates of GFR std . Therefore, pooled estimates of GFR std can be calculated with SEE values approximately 1.41 times smaller than those mentioned above. The reliabilities of the pooled estimate of GFR std separately and of the multiple samples method

  11. A review on measuring methods of gas-liquid flow rates

    International Nuclear Information System (INIS)

    Minemura, Kiyoshi; Yamashita, Masato

    2000-01-01

    This paper presents a review on the state of current measuring techniques for gas-liquid multiphase flow rates. After briefly discussing the basic idea on measuring methods for single-phase and two-phase flows, existing methods for the two-phase flow rates are classified into several types, that is, with or without a homogenizing device, single or combined method of several techniques, with intrusive or non-intrusive sensors, and physical or software method. Each methods are comparatively reviewed in view of measuring accuracy and manageability. Its scope also contains the techniques developed for petroleum-gas-water flow rates. (author)

  12. Trends in Suicide Methods and Rates among Older Adults in South Korea: A Comparison with Japan

    OpenAIRE

    Park, Subin; Lee, Hochang Benjamin; Lee, Su Yeon; Lee, Go Eun; Ahn, Myung Hee; Yi, Ki Kyoung; Hong, Jin Pyo

    2016-01-01

    Objective Lethality of the chosen method during a suicide attempt is a strong risk factor for completion of suicide. We examined whether annual changes in the pattern of suicide methods is related to annual changes in suicide rates among older adults in South Korea and Japan. Methods We analyzed annual the World Health Organization data on rates and methods of suicide from 2000 to 2011 in South Korea and Japan. Results For Korean older adults, there was a significant positive correlation betw...

  13. Test Method for High β Particle Emission Rate of 63Ni Source Plate

    OpenAIRE

    ZHANG Li-feng

    2015-01-01

    For the problem of measurement difficulties of β particle emission rate of Ni-63 source plate used for Ni-63 betavoltaic battery, a relative test method of scintillation current method was erected according to the measurement principle of scintillation detector.β particle emission rate of homemade Ni-63 source plate was tested by the method, and the test results were analysed and evaluated, it was initially thought that scintillation current method was a feasible way of testing β particle emi...

  14. Measuring Protein Synthesis Rate In Living Object Using Flooding Dose And Constant Infusion Methods

    OpenAIRE

    Ulyarti, Ulyarti

    2018-01-01

    Constant infusion is a method used for measuring protein synthesis rate in living object which uses low concentration of amino acid tracers. Flooding dose method is another technique used to measure the rate of protein synthesis which uses labelled amino acid together with large amount of unlabelled amino acid.  The latter method was firstly developed to solve the problem in determination of precursor pool arise from constant infusion method.  The objective of this writing is to com...

  15. Trends in Suicide Methods and Rates among Older Adults in South Korea: A Comparison with Japan.

    Science.gov (United States)

    Park, Subin; Lee, Hochang Benjamin; Lee, Su Yeon; Lee, Go Eun; Ahn, Myung Hee; Yi, Ki Kyoung; Hong, Jin Pyo

    2016-03-01

    Lethality of the chosen method during a suicide attempt is a strong risk factor for completion of suicide. We examined whether annual changes in the pattern of suicide methods is related to annual changes in suicide rates among older adults in South Korea and Japan. We analyzed annual the World Health Organization data on rates and methods of suicide from 2000 to 2011 in South Korea and Japan. For Korean older adults, there was a significant positive correlation between suicide rate and the rate of hanging or the rate of jumping, and a significant negative correlation between suicide rate and the rate of poisoning. Among older adults in Japan, annual changes in the suicide rate and the pattern of suicide methods were less conspicuous, and no correlation was found between them. The results of the present study suggest that the increasing use of lethal suicide methods has contributed to the rise in suicide rates among older adults in South Korea. Targeted efforts to reduce the social acceptability and accessibility of lethal suicide methods might lead to lower suicide rate among older adults in South Korea.

  16. A parametric method for assessing diversification-rate variation in phylogenetic trees.

    Science.gov (United States)

    Shah, Premal; Fitzpatrick, Benjamin M; Fordyce, James A

    2013-02-01

    Phylogenetic hypotheses are frequently used to examine variation in rates of diversification across the history of a group. Patterns of diversification-rate variation can be used to infer underlying ecological and evolutionary processes responsible for patterns of cladogenesis. Most existing methods examine rate variation through time. Methods for examining differences in diversification among groups are more limited. Here, we present a new method, parametric rate comparison (PRC), that explicitly compares diversification rates among lineages in a tree using a variety of standard statistical distributions. PRC can identify subclades of the tree where diversification rates are at variance with the remainder of the tree. A randomization test can be used to evaluate how often such variance would appear by chance alone. The method also allows for comparison of diversification rate among a priori defined groups. Further, the application of the PRC method is not restricted to monophyletic groups. We examined the performance of PRC using simulated data, which showed that PRC has acceptable false-positive rates and statistical power to detect rate variation. We apply the PRC method to the well-studied radiation of North American Plethodon salamanders, and support the inference that the large-bodied Plethodon glutinosus clade has a higher historical rate of diversification compared to other Plethodon salamanders. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

  17. A Phase Ib dose-escalation study to evaluate safety and tolerability of the addition of the aminopeptidase inhibitor tosedostat (CHR-2797) to paclitaxel in patients with advanced solid tumours

    NARCIS (Netherlands)

    C.M.L. Herpen (Carla); F.A.L.M. Eskens (Ferry); M.J.A. de Jonge (Maja); I.M.E. Desar (Ingrid); L. Hooftman (Leon); E. Bone (Elisabeth); J.N.H. Timmerbonte (Johanna); J. Verweij (Jaap)

    2010-01-01

    textabstractBackground: This Phase Ib dose-escalating study investigated safety, maximum tolerated dose (MTD), dose-limiting toxicity (DLT), pharmacokinetics (PK) and clinical antitumour activity of tosedostat (CHR-2797), an orally bioavailable aminopeptidase inhibitor, in combination with

  18. Implementation and Analysis of the Chromakey Augmented Virtual Environment (ChrAVE) Version 3.0 and Virtual Environment Helicopter (VEHELO) Version 2.0 in Simulated Helicopter Training

    National Research Council Canada - National Science Library

    Hahn, M. E

    2005-01-01

    The Chromakey Augmented Virtual Environment (ChrAVE) 3.0 System is a training system created to augment initial, refresher, and proficiency training in helicopter aviation using accurate simulation...

  19. Om Chr. Petersen

    DEFF Research Database (Denmark)

    Rasborg, Klaus

    1992-01-01

    Om en i dag næsten glemt skikkelse i dansk sociologi, der i sin samtid især blev kendt for sin doktordisputats om den franske sociolog Émile Durkheim......Om en i dag næsten glemt skikkelse i dansk sociologi, der i sin samtid især blev kendt for sin doktordisputats om den franske sociolog Émile Durkheim...

  20. In situ feeding rates of plantonic copepods: A comparison of four methods

    DEFF Research Database (Denmark)

    Kiørboe, Thomas; Møhlenberg, Flemming; Riisgård, Hans Ulrik

    1985-01-01

    into estimates of in situ algal grazing rates by means of independently estimated gut turnover times, and were compared with chlorophyll and particle-volume grazing rates of animals sampled simultaneously and incubated in water from the collection depth. In addition, egg-production rates of adult females were...... problems of the different methods are discussed, and it is concluded that they all approach representative (although minimum) estimates of in situ feeding rates....

  1. Reexamining the Dissolution of Spent Fuel: A Comparison of Different Methods for Calculating Rates

    International Nuclear Information System (INIS)

    Hanson, Brady D.; Stout, Ray B.

    2004-01-01

    Dissolution rates for spent fuel have typically been reported in terms of a rate normalized to the surface area of the specimen. Recent evidence has shown that neither the geometric surface area nor that measured with BET accurately predicts the effective surface area of spent fuel. Dissolution rates calculated from results obtained by flowthrough tests were reexamined comparing the cumulative releases and surface area normalized rates. While initial surface area is important for comparison of different rates, it appears that normalizing to the surface area introduces unnecessary uncertainty compared to using cumulative or fractional release rates. Discrepancies in past data analyses are mitigated using this alternative method

  2. A method for projecting age-specific mortality rates for certain causes of death

    International Nuclear Information System (INIS)

    Leggett, R.W.; Crawford, D.J.

    1981-01-01

    A method is presented for projecting mortality rates for certain causes on the basis of observed rates during past years. This method arose from a study of trends in age-specific mortality rates for respiratory cancers, and for heuristic purposes it is shown how the method can be developed from certain theories of cancer induction. However, the method is applicable in the more common situation in which the underlying physical processes cannot be modeled with any confidence but the mortality rates are approximable over short time intervals by functions of the form a exp(bt), where b may vary in a continuous, predictable fashion as the time interval is varied. It appears from applications to historical data that this projection method is in some cases a substantial improvement over conventional curve-fitting methods and often uncovers trends which are not from observed data

  3. Correction to the count-rate detection limit and sample/blank time-allocation methods

    International Nuclear Information System (INIS)

    Alvarez, Joseph L.

    2013-01-01

    A common form of count-rate detection limits contains a propagation of uncertainty error. This error originated in methods to minimize uncertainty in the subtraction of the blank counts from the gross sample counts by allocation of blank and sample counting times. Correct uncertainty propagation showed that the time allocation equations have no solution. This publication presents the correct form of count-rate detection limits. -- Highlights: •The paper demonstrated a proper method of propagating uncertainty of count rate differences. •The standard count-rate detection limits were in error. •Count-time allocation methods for minimum uncertainty were in error. •The paper presented the correct form of the count-rate detection limit. •The paper discussed the confusion between count-rate uncertainty and count uncertainty

  4. Standard Test Method for Determining Thermal Neutron Reaction Rates and Thermal Neutron Fluence Rates by Radioactivation Techniques

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 The purpose of this test method is to define a general procedure for determining an unknown thermal-neutron fluence rate by neutron activation techniques. It is not practicable to describe completely a technique applicable to the large number of experimental situations that require the measurement of a thermal-neutron fluence rate. Therefore, this method is presented so that the user may adapt to his particular situation the fundamental procedures of the following techniques. 1.1.1 Radiometric counting technique using pure cobalt, pure gold, pure indium, cobalt-aluminum, alloy, gold-aluminum alloy, or indium-aluminum alloy. 1.1.2 Standard comparison technique using pure gold, or gold-aluminum alloy, and 1.1.3 Secondary standard comparison techniques using pure indium, indium-aluminum alloy, pure dysprosium, or dysprosium-aluminum alloy. 1.2 The techniques presented are limited to measurements at room temperatures. However, special problems when making thermal-neutron fluence rate measurements in high-...

  5. Sequential multi-nuclide emission rate estimation method based on gamma dose rate measurement for nuclear emergency management

    International Nuclear Information System (INIS)

    Zhang, Xiaole; Raskob, Wolfgang; Landman, Claudia; Trybushnyi, Dmytro; Li, Yu

    2017-01-01

    Highlights: • Sequentially reconstruct multi-nuclide emission using gamma dose rate measurements. • Incorporate a priori ratio of nuclides into the background error covariance matrix. • Sequentially augment and update the estimation and the background error covariance. • Suppress the generation of negative estimations for the sequential method. • Evaluate the new method with twin experiments based on the JRODOS system. - Abstract: In case of a nuclear accident, the source term is typically not known but extremely important for the assessment of the consequences to the affected population. Therefore the assessment of the potential source term is of uppermost importance for emergency response. A fully sequential method, derived from a regularized weighted least square problem, is proposed to reconstruct the emission and composition of a multiple-nuclide release using gamma dose rate measurement. The a priori nuclide ratios are incorporated into the background error covariance (BEC) matrix, which is dynamically augmented and sequentially updated. The negative estimations in the mathematical algorithm are suppressed by utilizing artificial zero-observations (with large uncertainties) to simultaneously update the state vector and BEC. The method is evaluated by twin experiments based on the JRodos system. The results indicate that the new method successfully reconstructs the emission and its uncertainties. Accurate a priori ratio accelerates the analysis process, which obtains satisfactory results with only limited number of measurements, otherwise it needs more measurements to generate reasonable estimations. The suppression of negative estimation effectively improves the performance, especially for the situation with poor a priori information, where it is more prone to the generation of negative values.

  6. Sequential multi-nuclide emission rate estimation method based on gamma dose rate measurement for nuclear emergency management

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xiaole, E-mail: zhangxiaole10@outlook.com [Institute for Nuclear and Energy Technologies, Karlsruhe Institute of Technology, Karlsruhe, D-76021 (Germany); Institute of Public Safety Research, Department of Engineering Physics, Tsinghua University, Beijing, 100084 (China); Raskob, Wolfgang; Landman, Claudia; Trybushnyi, Dmytro; Li, Yu [Institute for Nuclear and Energy Technologies, Karlsruhe Institute of Technology, Karlsruhe, D-76021 (Germany)

    2017-03-05

    Highlights: • Sequentially reconstruct multi-nuclide emission using gamma dose rate measurements. • Incorporate a priori ratio of nuclides into the background error covariance matrix. • Sequentially augment and update the estimation and the background error covariance. • Suppress the generation of negative estimations for the sequential method. • Evaluate the new method with twin experiments based on the JRODOS system. - Abstract: In case of a nuclear accident, the source term is typically not known but extremely important for the assessment of the consequences to the affected population. Therefore the assessment of the potential source term is of uppermost importance for emergency response. A fully sequential method, derived from a regularized weighted least square problem, is proposed to reconstruct the emission and composition of a multiple-nuclide release using gamma dose rate measurement. The a priori nuclide ratios are incorporated into the background error covariance (BEC) matrix, which is dynamically augmented and sequentially updated. The negative estimations in the mathematical algorithm are suppressed by utilizing artificial zero-observations (with large uncertainties) to simultaneously update the state vector and BEC. The method is evaluated by twin experiments based on the JRodos system. The results indicate that the new method successfully reconstructs the emission and its uncertainties. Accurate a priori ratio accelerates the analysis process, which obtains satisfactory results with only limited number of measurements, otherwise it needs more measurements to generate reasonable estimations. The suppression of negative estimation effectively improves the performance, especially for the situation with poor a priori information, where it is more prone to the generation of negative values.

  7. Development of Joint Climate and Discharge Projections for the International Rhine River Basin - the CHR RheinBlick2050 Project

    Science.gov (United States)

    Görgen, K.; Pfister, L.

    2008-12-01

    The anticipated climate change will lead to modified hydro-meteorological regimes that influence discharge behaviour and hydraulics of rivers. This has variable impacts on managed (anthropogenic) and unmanaged (natural) systems, depending on their sensitivity and vulnerability (ecology, economy, infrastructure, transport, energy production, water management, etc.). Decision makers in these contexts need adequate adaptation strategies to minimize adverse effects of climate change, i.e. an improved knowledge on the potential impacts including uncertainties means an extension of the informed options open to users. The goal of the highly applied study presented here is the development of joint, consistent climate and discharge projections for the international Rhine River catchments (Switzerland, France, Germany, Netherlands) in order to assess future changes of hydro-meteorological regimes in the meso- and macroscale Rhine River catchments and to derive and improve the understanding of such impacts on hydrologic and hydraulic processes. The RheinBlick2050 project is an international effort initiated by the International Commission for the Hydrology of the Rhine Basin (CHR) in close cooperation with the International Commission for the Protection of the Rhine. The core experiment design foresees a data-synthesis, multi-model approach where (transient) (bias- corrected) regional climate change projections are used as forcing data for existing calibrated hydrological (and hydraulic) models at a daily temporal resolution over mesoscale catchments of the Rhine River. Mainly for validation purposes, hydro-meteorological observations from national weather services are compiled into a new consistent 5 km x 5 km reference dataset from 1961 to 2005. RCM data are mainly used from the ENSEMBLES project and other existing dynamical downscaling model runs to derive probabilistic ensembles and thereby also access uncertainties on a regional scale. A benchmarking is helping to

  8. Study on the evaluation method of radiation dose rate around spent fuel shipping casks

    International Nuclear Information System (INIS)

    Yamakoshi, Hisao

    1986-01-01

    This study aims at developing a simple calculation method which can evaluate radiation dose rate around casks with high accuracy in a short time. The method is based on a concept of the radiation shielding characteristics of cask walls. The concept was introduced to replace for ordinary radiation shielding calculation which requires a long calculation time and a large memory capacity of a computer in the matrix calculation. For the purpose of verifying the accuracy and reliability of the new method, it was applied to the analysis of the dose rate distribution around actual casks, which had been measured. The results of the analysis revealed that the newly proposed method was excellent for the forecast of radiation dose rate distribution around casks in view of the accuracy and calculation time. The short calculation time and high accuracy by the proposed method were attained by dividing the whole procedure of ordinary fine radiation shielding calculation into the calculation of radiation dose rate on a cask surface by the matrix expression of the characteristic function and the calculation of dose rate distribution using the simple analytical expression of dose rate distribution around casks. The effect of the heterogeneous array of spent fuel in different burnup state on dose rate distribution around casks was evaluated by this method. (Kako, I.)

  9. Tensile strength of concrete under static and intermediate strain rates: Correlated results from different testing methods

    International Nuclear Information System (INIS)

    Wu Shengxing; Chen Xudong; Zhou Jikai

    2012-01-01

    Highlights: ► Tensile strength of concrete increases with increase in strain rate. ► Strain rate sensitivity of tensile strength of concrete depends on test method. ► High stressed volume method can correlate results from various test methods. - Abstract: This paper presents a comparative experiment and analysis of three different methods (direct tension, splitting tension and four-point loading flexural tests) for determination of the tensile strength of concrete under low and intermediate strain rates. In addition, the objective of this investigation is to analyze the suitability of the high stressed volume approach and Weibull effective volume method to the correlation of the results of different tensile tests of concrete. The test results show that the strain rate sensitivity of tensile strength depends on the type of test, splitting tensile strength of concrete is more sensitive to an increase in the strain rate than flexural and direct tensile strength. The high stressed volume method could be used to obtain a tensile strength value of concrete, free from the influence of the characteristics of tests and specimens. However, the Weibull effective volume method is an inadequate method for describing failure of concrete specimens determined by different testing methods.

  10. A comparative study of different methods for calculating electronic transition rates

    Science.gov (United States)

    Kananenka, Alexei A.; Sun, Xiang; Schubert, Alexander; Dunietz, Barry D.; Geva, Eitan

    2018-03-01

    We present a comprehensive comparison of the following mixed quantum-classical methods for calculating electronic transition rates: (1) nonequilibrium Fermi's golden rule, (2) mixed quantum-classical Liouville method, (3) mean-field (Ehrenfest) mixed quantum-classical method, and (4) fewest switches surface-hopping method (in diabatic and adiabatic representations). The comparison is performed on the Garg-Onuchic-Ambegaokar benchmark charge-transfer model, over a broad range of temperatures and electronic coupling strengths, with different nonequilibrium initial states, in the normal and inverted regimes. Under weak to moderate electronic coupling, the nonequilibrium Fermi's golden rule rates are found to be in good agreement with the rates obtained via the mixed quantum-classical Liouville method that coincides with the fully quantum-mechanically exact results for the model system under study. Our results suggest that the nonequilibrium Fermi's golden rule can serve as an inexpensive yet accurate alternative to Ehrenfest and the fewest switches surface-hopping methods.

  11. Biasing transition rate method based on direct MC simulation for probabilistic safety assessment

    Institute of Scientific and Technical Information of China (English)

    Xiao-Lei Pan; Jia-Qun Wang; Run Yuan; Fang Wang; Han-Qing Lin; Li-Qin Hu; Jin Wang

    2017-01-01

    Direct Monte Carlo (MC) simulation is a powerful probabilistic safety assessment method for accounting dynamics of the system.But it is not efficient at simulating rare events.A biasing transition rate method based on direct MC simulation is proposed to solve the problem in this paper.This method biases transition rates of the components by adding virtual components to them in series to increase the occurrence probability of the rare event,hence the decrease in the variance of MC estimator.Several cases are used to benchmark this method.The results show that the method is effective at modeling system failure and is more efficient at collecting evidence of rare events than the direct MC simulation.The performance is greatly improved by the biasing transition rate method.

  12. Flow Rate Measurement Using 99mTc Radiotracer Method in a Pipe Installation

    International Nuclear Information System (INIS)

    Sipaun, S. M.; Bakar, A. Q. Abu; Othman, N.; Shaari, M. R.; Adnan, M. A. K.; Yusof, J. Mohd; Demanah, R.

    2010-01-01

    Flow rate is a significant parameter for managing processes in chemical processing plants and water processing facility. Accurate measurement of the flow rate allows engineers to monitor the delivery of process material, which in turn impacts a plant's capacity to produce their products. One of the available methods for determining the flow rate of a process material is by introducing a radiotracer to the system that mimics the material's flow pattern. In this study, a low activity Technetium-99m radioisotope was injected into a water piping setup and the 2'' x 2'' NaI (Tl) detectors were calibrated to detect spectrum peaks at specific points of the pipe installation. Using pulse velocity method, water flow rate was determined to be 11.3 litres per minute. For the sampling method, at different pump capacity, the flow rate was 15.0 litres per minute.

  13. Method of measuring the disintegration rate of a beta-emitting radionuclide in a liquid sample

    International Nuclear Information System (INIS)

    Horrocks, D.L.

    1980-01-01

    A novel liquid scintillation counting method of measuring the disintegration rate of a beta-emitting radionuclide is described which involves counting the sample at at least two different quench levels. (UK)

  14. Optimization of automation: III. Development of optimization method for determining automation rate in nuclear power plants

    International Nuclear Information System (INIS)

    Lee, Seung Min; Kim, Jong Hyun; Kim, Man Cheol; Seong, Poong Hyun

    2016-01-01

    Highlights: • We propose an appropriate automation rate that enables the best human performance. • We analyze the shortest working time considering Situation Awareness Recovery (SAR). • The optimized automation rate is estimated by integrating the automation and ostracism rate estimation methods. • The process to derive the optimized automation rate is demonstrated through case studies. - Abstract: Automation has been introduced in various industries, including the nuclear field, because it is commonly believed that automation promises greater efficiency, lower workloads, and fewer operator errors through reducing operator errors and enhancing operator and system performance. However, the excessive introduction of automation has deteriorated operator performance due to the side effects of automation, which are referred to as Out-of-the-Loop (OOTL), and this is critical issue that must be resolved. Thus, in order to determine the optimal level of automation introduction that assures the best human operator performance, a quantitative method of optimizing the automation is proposed in this paper. In order to propose the optimization method for determining appropriate automation levels that enable the best human performance, the automation rate and ostracism rate, which are estimation methods that quantitatively analyze the positive and negative effects of automation, respectively, are integrated. The integration was conducted in order to derive the shortest working time through considering the concept of situation awareness recovery (SAR), which states that the automation rate with the shortest working time assures the best human performance. The process to derive the optimized automation rate is demonstrated through an emergency operation scenario-based case study. In this case study, four types of procedures are assumed through redesigning the original emergency operating procedure according to the introduced automation and ostracism levels. Using the

  15. Novel Fingertip Image-Based Heart Rate Detection Methods for a Smartphone

    Directory of Open Access Journals (Sweden)

    Rifat Zaman

    2017-02-01

    Full Text Available We hypothesize that our fingertip image-based heart rate detection methods using smartphone reliably detect the heart rhythm and rate of subjects. We propose fingertip curve line movement-based and fingertip image intensity-based detection methods, which both use the movement of successive fingertip images obtained from smartphone cameras. To investigate the performance of the proposed methods, heart rhythm and rate of the proposed methods are compared to those of the conventional method, which is based on average image pixel intensity. Using a smartphone, we collected 120 s pulsatile time series data from each recruited subject. The results show that the proposed fingertip curve line movement-based method detects heart rate with a maximum deviation of 0.0832 Hz and 0.124 Hz using time- and frequency-domain based estimation, respectively, compared to the conventional method. Moreover, another proposed fingertip image intensity-based method detects heart rate with a maximum deviation of 0.125 Hz and 0.03 Hz using time- and frequency-based estimation, respectively.

  16. Assessing Teachers' Judgements of Students' Academic Motivation and Emotions across Two Rating Methods

    Science.gov (United States)

    Zhu, Mingjing; Urhahne, Detlef

    2014-01-01

    The present study examines the accuracy of teachers' judgements about students' motivation and emotions in English learning with two different rating methods. A sample of 480 sixth-grade Chinese students reported their academic self-concept, learning effort, enjoyment, and test anxiety via a questionnaire and were rated on these dimensions by…

  17. Comparing methods for measuring the rate of spread of invading populations

    Science.gov (United States)

    Marius Gilbert; Andrew. Liebhold

    2010-01-01

    Measuring rates of spread during biological invasions is important for predicting where and when invading organisms will spread in the future as well as for quantifying the influence of environmental conditions on invasion speed. While several methods have been proposed in the literature to measure spread rates, a comprehensive comparison of their accuracy when applied...

  18. A photocurrent compensation method of bipolar transistors under high dose rate radiation and its experimental research

    International Nuclear Information System (INIS)

    Yin Xuesong; Liu Zhongli; Li Chunji; Yu Fang

    2005-01-01

    Experiment using discrete bipolar transistors has been performed to verify the effect of the photocurrent compensation method. The theory of the dose rate effects of bipolar transistors and the photocurrent compensation method are introduced. The comparison between the response of hardened and unhardened circuits under high dose rate radiation is discussed. The experimental results show instructiveness to the hardness of bipolar integrated circuits under transient radiation. (authors)

  19. Estimating evolutionary rates using time-structured data: a general comparison of phylogenetic methods.

    Science.gov (United States)

    Duchêne, Sebastián; Geoghegan, Jemma L; Holmes, Edward C; Ho, Simon Y W

    2016-11-15

    In rapidly evolving pathogens, including viruses and some bacteria, genetic change can accumulate over short time-frames. Accordingly, their sampling times can be used to calibrate molecular clocks, allowing estimation of evolutionary rates. Methods for estimating rates from time-structured data vary in how they treat phylogenetic uncertainty and rate variation among lineages. We compiled 81 virus data sets and estimated nucleotide substitution rates using root-to-tip regression, least-squares dating and Bayesian inference. Although estimates from these three methods were often congruent, this largely relied on the choice of clock model. In particular, relaxed-clock models tended to produce higher rate estimates than methods that assume constant rates. Discrepancies in rate estimates were also associated with high among-lineage rate variation, and phylogenetic and temporal clustering. These results provide insights into the factors that affect the reliability of rate estimates from time-structured sequence data, emphasizing the importance of clock-model testing. sduchene@unimelb.edu.au or garzonsebastian@hotmail.comSupplementary information: Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  20. Los enigmas del Grial. En torno a la polémica sobre la unidad de El Cuento del Grial de Chrétien de Troyes

    Directory of Open Access Journals (Sweden)

    Victoria Cirlot

    2014-12-01

    Full Text Available Relectura de la polémica acerca de la unidad del último roman de Chrétien de Troyes, Li Contes del Graal que tuvo lugar a finales de los años cincuenta entre Martín de Riquer, Jean Frappier y Erich Köhler. Más de cincuenta años después se trata de valorar las aportaciones que dicha polémica supuso para la filología románica y, en concreto, para la valoración de la última obra del escritor de la Champaña.

  1. Orelhas de elefante, olhos de coruja, dentes de javali: maravilhoso e descritivo em Yvain ou le chevalier au lion, de Chrétien de Troyes

    OpenAIRE

    Luis Claudio Kinker Caliendo

    2009-01-01

    No final do século XII, Chrétien de Troyes considerado por muitos críticos o maior poeta francês da chamada Idade Média compõe um poema narrativo Yvain ou le Chevalier au Lion no qual se percebem elementos tidos como característicos do gênero maravilhoso, tais quais objetos mágicos e seres extraordinários, como monstros e gigantes. Esses elementos entre outros fatores levaram boa parte da crítica a enxergar na poesia medieval, durante muito tempo, uma certa ingenuidade, típica de uma in...

  2. New methods for estimating follow-up rates in cohort studies

    Directory of Open Access Journals (Sweden)

    Xiaonan Xue

    2017-12-01

    Full Text Available Abstract Background The follow-up rate, a standard index of the completeness of follow-up, is important for assessing the validity of a cohort study. A common method for estimating the follow-up rate, the “Percentage Method”, defined as the fraction of all enrollees who developed the event of interest or had complete follow-up, can severely underestimate the degree of follow-up. Alternatively, the median follow-up time does not indicate the completeness of follow-up, and the reverse Kaplan-Meier based method and Clark’s Completeness Index (CCI also have limitations. Methods We propose a new definition for the follow-up rate, the Person-Time Follow-up Rate (PTFR, which is the observed person-time divided by total person-time assuming no dropouts. The PTFR cannot be calculated directly since the event times for dropouts are not observed. Therefore, two estimation methods are proposed: a formal person-time method (FPT in which the expected total follow-up time is calculated using the event rate estimated from the observed data, and a simplified person-time method (SPT that avoids estimation of the event rate by assigning full follow-up time to all events. Simulations were conducted to measure the accuracy of each method, and each method was applied to a prostate cancer recurrence study dataset. Results Simulation results showed that the FPT has the highest accuracy overall. In most situations, the computationally simpler SPT and CCI methods are only slightly biased. When applied to a retrospective cohort study of cancer recurrence, the FPT, CCI and SPT showed substantially greater 5-year follow-up than the Percentage Method (92%, 92% and 93% vs 68%. Conclusions The Person-time methods correct a systematic error in the standard Percentage Method for calculating follow-up rates. The easy to use SPT and CCI methods can be used in tandem to obtain an accurate and tight interval for PTFR. However, the FPT is recommended when event rates and

  3. Real-time Continuous Assessment Method for Mental and Physiological Condition using Heart Rate Variability

    Science.gov (United States)

    Yoshida, Yutaka; Yokoyama, Kiyoko; Ishii, Naohiro

    It is necessary to monitor the daily health condition for preventing stress syndrome. In this study, it was proposed the method assessing the mental and physiological condition, such as the work stress or the relaxation, using heart rate variability at real time and continuously. The instantanuous heart rate (HR), and the ratio of the number of extreme points (NEP) and the number of heart beats were calculated for assessing mental and physiological condition. In this method, 20 beats heart rate were used to calculate these indexes. These were calculated in one beat interval. Three conditions, which are sitting rest, performing mental arithmetic and watching relaxation movie, were assessed using our proposed algorithm. The assessment accuracies were 71.9% and 55.8%, when performing mental arithmetic and watching relaxation movie respectively. In this method, the mental and physiological condition was assessed using only 20 regressive heart beats, so this method is considered as the real time assessment method.

  4. Standard test method for determining atmospheric chloride deposition rate by wet candle method

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2002-01-01

    1.1 This test method covers a wet candle device and its use in measuring atmospheric chloride deposition (amount of chloride salts deposited from the atmosphere on a given area per unit time). 1.2 Data on atmospheric chloride deposition can be useful in classifying the corrosivity of a specific area, such as an atmospheric test site. Caution must be exercised, however, to take into consideration the season because airborne chlorides vary widely between seasons. 1.3 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  5. Paraquat prohibition and change in the suicide rate and methods in South Korea.

    Science.gov (United States)

    Myung, Woojae; Lee, Geung-Hee; Won, Hong-Hee; Fava, Maurizio; Mischoulon, David; Nyer, Maren; Kim, Doh Kwan; Heo, Jung-Yoon; Jeon, Hong Jin

    2015-01-01

    The annual suicide rate in South Korea is the highest among the developed countries. Paraquat is a highly lethal herbicide, commonly used in South Korea as a means for suicide. We have studied the effect of the 2011 paraquat prohibition on the national suicide rate and method of suicide in South Korea. We obtained the monthly suicide rate from 2005 to 2013 in South Korea. In our analyses, we adjusted for the effects of celebrity suicides, and economic, meteorological, and seasonal factors on suicide rate. We employed change point analysis to determine the effect of paraquat prohibition on suicide rate over time, and the results were verified by structural change analysis, an alternative statistical method. After the paraquat prohibition period in South Korea, there was a significant reduction in the total suicide rate and suicide rate by poisoning with herbicides or fungicides in all age groups and in both genders. The estimated suicide rates during this period decreased by 10.0% and 46.1% for total suicides and suicides by poisoning of herbicides or fungicides, respectively. In addition, method substitution effect of paraquat prohibition was found in suicide by poisoning by carbon monoxide, which did not exceed the reduction in the suicide rate of poisoning with herbicides or fungicides. In South Korea, paraquat prohibition led to a lower rate of suicide by paraquat poisoning, as well as a reduction in the overall suicide rate. Paraquat prohibition should be considered as a national suicide prevention strategy in developing and developed countries alongside careful observation for method substitution effects.

  6. Paraquat prohibition and change in the suicide rate and methods in South Korea.

    Directory of Open Access Journals (Sweden)

    Woojae Myung

    Full Text Available The annual suicide rate in South Korea is the highest among the developed countries. Paraquat is a highly lethal herbicide, commonly used in South Korea as a means for suicide. We have studied the effect of the 2011 paraquat prohibition on the national suicide rate and method of suicide in South Korea. We obtained the monthly suicide rate from 2005 to 2013 in South Korea. In our analyses, we adjusted for the effects of celebrity suicides, and economic, meteorological, and seasonal factors on suicide rate. We employed change point analysis to determine the effect of paraquat prohibition on suicide rate over time, and the results were verified by structural change analysis, an alternative statistical method. After the paraquat prohibition period in South Korea, there was a significant reduction in the total suicide rate and suicide rate by poisoning with herbicides or fungicides in all age groups and in both genders. The estimated suicide rates during this period decreased by 10.0% and 46.1% for total suicides and suicides by poisoning of herbicides or fungicides, respectively. In addition, method substitution effect of paraquat prohibition was found in suicide by poisoning by carbon monoxide, which did not exceed the reduction in the suicide rate of poisoning with herbicides or fungicides. In South Korea, paraquat prohibition led to a lower rate of suicide by paraquat poisoning, as well as a reduction in the overall suicide rate. Paraquat prohibition should be considered as a national suicide prevention strategy in developing and developed countries alongside careful observation for method substitution effects.

  7. Leak Rate Quantification Method for Gas Pressure Seals with Controlled Pressure Differential

    Science.gov (United States)

    Daniels, Christopher C.; Braun, Minel J.; Oravec, Heather A.; Mather, Janice L.; Taylor, Shawn C.

    2015-01-01

    An enhancement to the pressure decay leak rate method with mass point analysis solved deficiencies in the standard method. By adding a control system, a constant gas pressure differential across the test article was maintained. As a result, the desired pressure condition was met at the onset of the test, and the mass leak rate and measurement uncertainty were computed in real-time. The data acquisition and control system were programmed to automatically stop when specified criteria were met. Typically, the test was stopped when a specified level of measurement uncertainty was attained. Using silicone O-ring test articles, the new method was compared with the standard method that permitted the downstream pressure to be non-constant atmospheric pressure. The two methods recorded comparable leak rates, but the new method recorded leak rates with significantly lower measurement uncertainty, statistical variance, and test duration. Utilizing this new method in leak rate quantification, projects will reduce cost and schedule, improve test results, and ease interpretation between data sets.

  8. A new method to determine reflex latency induced by high rate stimulation of the nervous system

    Directory of Open Access Journals (Sweden)

    Ilhan eKaracan

    2014-07-01

    Full Text Available High rate stimulations of the neuromuscular system, such as continuous whole body vibration, tonic vibration reflex and high frequency electrical stimulation, are used in the physiological research with an increasing interest. In these studies, the neuronal circuitries underlying the reflex responses remain unclear due to the problem of determining the exact reflex latencies. We present a novel cumulated average method to determine the reflex latency during high rate stimulation of the nervous system which was proven to be significantly more accurate than the classical method. The classical method, cumulant density analysis, reveals the relationship between the two synchronously recorded signals as a function of the lag between the signals. The comparison of new method with the classical technique and their relative accuracy was tested using a computer simulation. In the simulated signals the EMG response latency was constructed to be exactly 40 ms. The new method accurately indicated the value of the simulated reflex latency (40 ms. However, the classical method showed that the lag time between the simulated triggers and the simulated signals was 49 ms. Simulation results illustrated that the cumulated average method is a reliable and more accurate method compared with the classical method. We therefore suggest that the new cumulated average method is able to determine the high rate stimulation induced reflex latencies more accurately than the classical method.

  9. Experiments to Evaluate and Implement Passive Tracer Gas Methods to Measure Ventilation Rates in Homes

    Energy Technology Data Exchange (ETDEWEB)

    Lunden, Melissa [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Faulkner, David [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Heredia, Elizabeth [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Cohn, Sebastian [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Dickerhoff, Darryl [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Noris, Federico [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Logue, Jennifer [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Hotchi, Toshifumi [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Singer, Brett [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Sherman, Max H. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2012-10-01

    This report documents experiments performed in three homes to assess the methodology used to determine air exchange rates using passive tracer techniques. The experiments used four different tracer gases emitted simultaneously but implemented with different spatial coverage in the home. Two different tracer gas sampling methods were used. The results characterize the factors of the execution and analysis of the passive tracer technique that affect the uncertainty in the calculated air exchange rates. These factors include uncertainties in tracer gas emission rates, differences in measured concentrations for different tracer gases, temporal and spatial variability of the concentrations, the comparison between different gas sampling methods, and the effect of different ventilation conditions.

  10. Measurement of fatigue crack growth rate of reactor structural material in air based on DCPD method

    International Nuclear Information System (INIS)

    Du Donghai; Chen Kai; Yu Lun; Zhang Lefu; Shi Xiuqiang; Xu Xuelian

    2014-01-01

    The principles and details of direct current potential drop (DCPD) in monitoring the crack growth of reactor structural materials was introduced in this paper. Based on this method, the fatigue crack growth rate (CGR) of typical structural materials in nuclear power systems was measured. The effects of applied load, load ratio and loading frequency on the fatigue crack growth rate of reactor structural materials were discussed. The result shows that the fatigue crack growth rate of reactor structural materials depends on the hardness of materials, and the harder the material is, the higher the rate of crack growth is. (authors)

  11. Method of Euthanasia Influences the Oocyte Fertilization Rate with Fresh Mouse Sperm

    Science.gov (United States)

    Hazzard, Karen C; Watkins-Chow, Dawn E; Garrett, Lisa J

    2014-01-01

    In vitro fertilization (IVF) is used to produce mouse embryos for a variety of reasons. We evaluated the effect of the method of euthanasia on the fertilization rate in 2 different IVF protocols. Oocytes collected from C57BL/6J female mice euthanized by CO2 inhalation or cervical dislocation were used in IVF with fresh sperm from either wild-type or genetically engineered C57BL/6J. Compared with CO2 inhalation, cervical dislocation improved the resulting rate of fertilization by 18% in an IVF method using Cook media and by 13% in an IVF method using methyl-B cyclodextrin and reduced glutathione. The lower fertilization rate due to euthanasia by CO2 inhalation was accompanied by changes in blood pH and body temperature despite efforts to minimize temperature drops. In our hands, euthanasia by cervical dislocation improved fertilization rates and consequently reduced the number of egg-donor mice required. PMID:25650969

  12. New method of analyzing well tests in fractured wells using sandface pressure and rate data

    Energy Technology Data Exchange (ETDEWEB)

    Osman, M.; Almehaideb, R.; Abou-Kassem, J. [U.A.E. University, Al-Ain (United Arab Emirates)

    1998-05-01

    Analysis of variable flow rate tests has been of special interest recently because in many cases it is impractical to keep a flow rate constant long enough to perform a drawdown test. Further, in many other drawdown and buildup tests, the early data were influenced by wellbore storage effects, and the duration of these effects could be quite long for low-permeability reservoirs. This paper presents a mathematical model which describes drawdown and buildup tests in hydraulically fractured wells. This new method uses a specialized plot approach to analyze the linear flow data and combines it with the superposition of constant-rate solution method for the analysis of psuedoradial flow data. It does not require prior knowledge of the fracture type (uniform-flux or infinite-conductivity); in fact it predicts the fracture type. This method is useful for the analysis of simultaneously measured downhole pressure and sandface rate data. 12 refs., 11 figs., 3 tabs.

  13. Method of euthanasia influences the oocyte fertilization rate with fresh mouse sperm.

    Science.gov (United States)

    Hazzard, Karen C; Watkins-Chow, Dawn E; Garrett, Lisa J

    2014-11-01

    In vitro fertilization (IVF) is used to produce mouse embryos for a variety of reasons. We evaluated the effect of the method of euthanasia on the fertilization rate in 2 different IVF protocols. Oocytes collected from C57BL/6J female mice euthanized by CO2 inhalation or cervical dislocation were used in IVF with fresh sperm from either wild-type or genetically engineered C57BL/6J. Compared with CO2 inhalation, cervical dislocation improved the resulting rate of fertilization by 18% in an IVF method using Cook media and by 13% in an IVF method using methyl-B cyclodextrin and reduced glutathione. The lower fertilization rate due to euthanasia by CO2 inhalation was accompanied by changes in blood pH and body temperature despite efforts to minimize temperature drops. In our hands, euthanasia by cervical dislocation improved fertilization rates and consequently reduced the number of egg-donor mice required.

  14. Establishing Upper Limits for Item Ratings for the Angoff Method: Are Resulting Standards More 'Realistic'?

    Science.gov (United States)

    Reid, Jerry B.

    This report investigates an area of uncertainty in using the Angoff method for setting standards, namely whether or not a judge's conceptualizations of borderline group performance are realistic. Ratings are usually made with reference to the performance of this hypothetical group, therefore the Angoff method's success is dependent on this point.…

  15. 'Continuation rate', 'use-effectiveness' and their assessment for the diaphragm and jelly method.

    Science.gov (United States)

    Chandrasekaran, C; Karkal, M

    1972-11-01

    Abstract The application of the life-table technique in the calculation of use-effectiveness of a contraceptive was proposed by Potter in 1963.(1) The technique was also found to be useful in assessing the duration for which the use of a contraceptive was continued. The keen interest that existed in the use of IUD in the mid-1960's was reflected in the terminology developed for assessment of the continuity of use. 'Retention rate' was a frequently used index.(2) Because of the development of the concept of segments whose end-period determined either termination of the use of a method or its continuance on a cut-off date, 'closure rate' and 'termination rate' have been used as measures of the discontinuance of the use of methods primarily of the IUD.(3) While discussing concepts relating to acceptance, use and effectiveness of family planning methods, more generally, an expert group suggested that 'continuation' should be used to denote that a client (or a couple) had begun to practise a method and that the method was still being practised.(4) Since this group defined 'an acceptor' as a person taking service and/or advice, i.e. having an IUD insertion or a sterilization operation or receiving supplies (or advice on methods such as 'rhythm' or coitus-interruptus with the intent of using the method), the base for the assessment of continuation rates, according to this group, would be only those acceptors who had begun using the method. The lifetable method has also been used for the study of the continuation rate for pill acceptors.(5) Balakrishnan, et al., made a study of continuation rates of oral contraceptives using the multiple decrement life-table technique.(6).

  16. Implementation of Online Promethee Method for Poor Family Change Rate Calculation

    Science.gov (United States)

    Aji, Dhady Lukito; Suryono; Widodo, Catur Edi

    2018-02-01

    This research has been done online calculation of the rate of poor family change rate by using Preference Ranking Method of Organization Of Enrichment Evaluation (PROMETHEE) .This system is very useful to monitor poverty in a region as well as for administrative services related to poverty rate. The system consists of computer clients and servers connected via the internet network. Poor family residence data obtained from the government. In addition, survey data are inputted through the client computer in each administrative village and also 23 criteria of input in accordance with the established government. The PROMETHEE method is used to evaluate the value of poverty and its weight is used to determine poverty status. PROMETHEE output can also be used to rank the poverty of the registered population of the server based on the netflow value. The poverty rate is calculated based on the current poverty rate compared to the previous poverty rate. The rate results can be viewed online and real time on the server through numbers and graphs. From the test results can be seen that the system can classify poverty status, calculate the poverty rate change rate and can determine the value and poverty ranking of each population.

  17. Implementation of Online Promethee Method for Poor Family Change Rate Calculation

    Directory of Open Access Journals (Sweden)

    Lukito Aji Dhady

    2018-01-01

    Full Text Available This research has been done online calculation of the rate of poor family change rate by using Preference Ranking Method of Organization Of Enrichment Evaluation (PROMETHEE .This system is very useful to monitor poverty in a region as well as for administrative services related to poverty rate. The system consists of computer clients and servers connected via the internet network. Poor family residence data obtained from the government. In addition, survey data are inputted through the client computer in each administrative village and also 23 criteria of input in accordance with the established government. The PROMETHEE method is used to evaluate the value of poverty and its weight is used to determine poverty status. PROMETHEE output can also be used to rank the poverty of the registered population of the server based on the netflow value. The poverty rate is calculated based on the current poverty rate compared to the previous poverty rate. The rate results can be viewed online and real time on the server through numbers and graphs. From the test results can be seen that the system can classify poverty status, calculate the poverty rate change rate and can determine the value and poverty ranking of each population.

  18. Ballistic deficit correction methods for large Ge detectors-high counting rate study

    International Nuclear Information System (INIS)

    Duchene, G.; Moszynski, M.

    1995-01-01

    This study presents different ballistic correction methods versus input count rate (from 3 to 50 kcounts/s) using four large Ge detectors of about 70 % relative efficiency. It turns out that the Tennelec TC245 linear amplifier in the BDC mode (Hinshaw method) is the best compromise for energy resolution throughout. All correction methods lead to narrow sum-peaks indistinguishable from single Γ lines. The full energy peak throughput is found representative of the pile-up inspection dead time of the corrector circuits. This work also presents a new and simple representation, plotting simultaneously energy resolution and throughput versus input count rate. (TEC). 12 refs., 11 figs

  19. Fill rate estimation in periodic review policies with lost sales using simple methods

    Energy Technology Data Exchange (ETDEWEB)

    Cardós, M.; Guijarro Tarradellas, E.; Babiloni Griñón, E.

    2016-07-01

    Purpose: The exact estimation of the fill rate in the lost sales case is complex and time consuming. However, simple and suitable methods are needed for its estimation so that inventory managers could use them. Design/methodology/approach: Instead of trying to compute the fill rate in one step, this paper focuses first on estimating the probabilities of different on-hand stock levels so that the fill rate is computed later. Findings: As a result, the performance of a novel proposed method overcomes the other methods and is relatively simple to compute. Originality/value: Existing methods for estimating stock levels are examined, new procedures are proposed and their performance is assessed.

  20. Application of Statistical Methods of Rain Rate Estimation to Data From The TRMM Precipitation Radar

    Science.gov (United States)

    Meneghini, R.; Jones, J. A.; Iguchi, T.; Okamoto, K.; Liao, L.; Busalacchi, Antonio J. (Technical Monitor)

    2000-01-01

    The TRMM Precipitation Radar is well suited to statistical methods in that the measurements over any given region are sparsely sampled in time. Moreover, the instantaneous rain rate estimates are often of limited accuracy at high rain rates because of attenuation effects and at light rain rates because of receiver sensitivity. For the estimation of the time-averaged rain characteristics over an area both errors are relevant. By enlarging the space-time region over which the data are collected, the sampling error can be reduced. However. the bias and distortion of the estimated rain distribution generally will remain if estimates at the high and low rain rates are not corrected. In this paper we use the TRMM PR data to investigate the behavior of 2 statistical methods the purpose of which is to estimate the rain rate over large space-time domains. Examination of large-scale rain characteristics provides a useful starting point. The high correlation between the mean and standard deviation of rain rate implies that the conditional distribution of this quantity can be approximated by a one-parameter distribution. This property is used to explore the behavior of the area-time-integral (ATI) methods where fractional area above a threshold is related to the mean rain rate. In the usual application of the ATI method a correlation is established between these quantities. However, if a particular form of the rain rate distribution is assumed and if the ratio of the mean to standard deviation is known, then not only the mean but the full distribution can be extracted from a measurement of fractional area above a threshold. The second method is an extension of this idea where the distribution is estimated from data over a range of rain rates chosen in an intermediate range where the effects of attenuation and poor sensitivity can be neglected. The advantage of estimating the distribution itself rather than the mean value is that it yields the fraction of rain contributed by

  1. Charged-particle thermonuclear reaction rates: I. Monte Carlo method and statistical distributions

    International Nuclear Information System (INIS)

    Longland, R.; Iliadis, C.; Champagne, A.E.; Newton, J.R.; Ugalde, C.; Coc, A.; Fitzgerald, R.

    2010-01-01

    A method based on Monte Carlo techniques is presented for evaluating thermonuclear reaction rates. We begin by reviewing commonly applied procedures and point out that reaction rates that have been reported up to now in the literature have no rigorous statistical meaning. Subsequently, we associate each nuclear physics quantity entering in the calculation of reaction rates with a specific probability density function, including Gaussian, lognormal and chi-squared distributions. Based on these probability density functions the total reaction rate is randomly sampled many times until the required statistical precision is achieved. This procedure results in a median (Monte Carlo) rate which agrees under certain conditions with the commonly reported recommended 'classical' rate. In addition, we present at each temperature a low rate and a high rate, corresponding to the 0.16 and 0.84 quantiles of the cumulative reaction rate distribution. These quantities are in general different from the statistically meaningless 'minimum' (or 'lower limit') and 'maximum' (or 'upper limit') reaction rates which are commonly reported. Furthermore, we approximate the output reaction rate probability density function by a lognormal distribution and present, at each temperature, the lognormal parameters μ and σ. The values of these quantities will be crucial for future Monte Carlo nucleosynthesis studies. Our new reaction rates, appropriate for bare nuclei in the laboratory, are tabulated in the second paper of this issue (Paper II). The nuclear physics input used to derive our reaction rates is presented in the third paper of this issue (Paper III). In the fourth paper of this issue (Paper IV) we compare our new reaction rates to previous results.

  2. Da Chrétien de Troyes a Shakespeare («The tragedy of King Richard the Third», a. I, sc. 2

    Directory of Open Access Journals (Sweden)

    Alfonso D'Agostino

    2015-07-01

    Full Text Available L’articolo si propone di considerare le somiglianze fra alcune vicende antico-francesi (l’Yvain di Chrétien de Troyes e il fabliau anonimo De celle que se fist foutre sur la fosse son mari con una scena del Riccardo III di Shakespeare. Anche se non si può dire che il dramma inglese dipenda dai testi narrativi oitanici, esso sviluppa lo stesso motivo della vedova consolata e una serie di motivi secondarî, di immagini (il sangue, il diavolo, la seduzione e di espressioni letterarie in modo sintomaticamente affine. The paper aims to evaluate similarities between some Old-French narratives (Chrétien de Troyes’ Yvain and the anonymous fabliau De celle que se fist foutre sur la fosse son mari and a scene from Shakespeare’s Richard III. Although we cannot affirm that Shakespeare’s play derives from the French narratives, it develops the same theme of “comforted widow” along with a series of secondary themes, of images (the blood, the devil, the seduction and literary expressions in a symptomatically, very similar way.

  3. Application of response surface methodology for rapid chrysene biodegradation by newly isolated marine-derived fungus Cochliobolus lunatus strain CHR4D.

    Science.gov (United States)

    Bhatt, Jwalant K; Ghevariya, Chirag M; Dudhagara, Dushyant R; Rajpara, Rahul K; Dave, Bharti P

    2014-11-01

    For the first time, Cochliobolus lunatus strain CHR4D, a marine-derived ascomycete fungus isolated from historically contaminated crude oil polluted shoreline of Alang-Sosiya ship-breaking yard, at Bhavnagar coast, Gujarat has been reported showing the rapid and enhanced biodegradation of chrysene, a four ringed high molecular weight (HMW) polycyclic aromatic hydrocarbon (PAH). Mineral Salt Broth (MSB) components such as ammonium tartrate and glucose along with chrysene, pH and trace metal solution have been successfully optimized by Response Surface Methodology (RSM) using central composite design (CCD). A validated, two-step optimization protocol has yielded a substantial 93.10% chrysene degradation on the 4(th) day, against unoptimized 56.37% degradation on the 14(th) day. The results depict 1.65 fold increase in chrysene degradation and 1.40 fold increase in biomass with a considerable decrement in time. Based on the successful laboratory experiments, C. lunatus strain CHR4D can thus be predicted as a potential candidate for mycoremediation of HMW PAHs impacted environments.

  4. Systematic method for resource rating with two applications to potential wilderness areas

    International Nuclear Information System (INIS)

    Voelker, A.H.; Wedow, H.; Oakes, E.; Scheffler, P.K.

    1979-09-01

    A versatile method was developed to rate the energy- and mineral-resource potentials of areas in which land-management and resource-development decisions must be reached with a minimum expenditure of money and time. The method surveys published and personal information on resources in the region being assessed, selects the most appropriate information, synthesizes the information into map overlays and tract descriptions, rates the potential of tracts for particular resources, rates the overall importance of each tract for resource development, and documents the ratings and their significance. Basic criteria considered by the assessment team include the favorability and certainty ratings, the overall availability of each rated resource within this country, the size of a given tract, economic factors, and the number of resources in a tract. The method was applied to two separate but roughly similar geologic regions, the Idaho-Wyoming-Utah thrust belt and the central Appalachians. Undeveloped tracts of national forestland in these regions that are being considered for possible designation under the Roadless Area Review and Evaluation (RARE II) planning process were rated for their resource value. Results support earlier indications that the 63 tracts comprising the western thrust belt possess a high potential for future resource development. Nearly one-half of these tracts were rated either 3 or 4. However, the wide spread of the importance ratings between 1 and 4 suggests that some tracts or portions of tracts can be added to the National Wilderness System without compromising resource development. The 72 eastern thrust belt tracts were given lower ratings, which indicates the reduced significance of the few remaining roadless areas in this region in satisfying the nation's near-term resource needs

  5. A Bayes linear Bayes method for estimation of correlated event rates.

    Science.gov (United States)

    Quigley, John; Wilson, Kevin J; Walls, Lesley; Bedford, Tim

    2013-12-01

    Typically, full Bayesian estimation of correlated event rates can be computationally challenging since estimators are intractable. When estimation of event rates represents one activity within a larger modeling process, there is an incentive to develop more efficient inference than provided by a full Bayesian model. We develop a new subjective inference method for correlated event rates based on a Bayes linear Bayes model under the assumption that events are generated from a homogeneous Poisson process. To reduce the elicitation burden we introduce homogenization factors to the model and, as an alternative to a subjective prior, an empirical method using the method of moments is developed. Inference under the new method is compared against estimates obtained under a full Bayesian model, which takes a multivariate gamma prior, where the predictive and posterior distributions are derived in terms of well-known functions. The mathematical properties of both models are presented. A simulation study shows that the Bayes linear Bayes inference method and the full Bayesian model provide equally reliable estimates. An illustrative example, motivated by a problem of estimating correlated event rates across different users in a simple supply chain, shows how ignoring the correlation leads to biased estimation of event rates. © 2013 Society for Risk Analysis.

  6. Suicide epidemics: the impact of newly emerging methods on overall suicide rates - a time trends study

    Directory of Open Access Journals (Sweden)

    Chang Shu-Sen

    2011-05-01

    Full Text Available Abstract Background The impact of newly emerging, popular suicide methods on overall rates of suicide has not previously been investigated systematically. Understanding these effects may have important implications for public health surveillance. We examine the emergence of three novel methods of suicide by gassing in the 20th and 21st centuries and determine the impact of emerging methods on overall suicide rates. Methods We studied the epidemic rises in domestic coal gas (1919-1935, England and Wales, motor vehicle exhaust gas (1975-1992, England and Wales and barbecue charcoal gas (1999-2006, Taiwan suicide using Poisson and joinpoint regression models. Joinpoint regression uses contiguous linear segments and join points (points at which trends change to describe trends in incidence. Results Epidemic increases in the use of new methods of suicide were generally associated with rises in overall suicide rates of between 23% and 71%. The recent epidemic of barbecue charcoal suicides in Taiwan was associated with the largest rise in overall rates (40-50% annual rise, whereas the smallest rise was seen for car exhaust gassing in England and Wales (7% annual rise. Joinpoint analyses were only feasible for car exhaust and charcoal burning suicides; these suggested an impact of the emergence of car exhaust suicides on overall suicide rates in both sexes in England and Wales. However there was no statistical evidence of a change in the already increasing overall suicide trends when charcoal burning suicides emerged in Taiwan, possibly due to the concurrent economic recession. Conclusions Rapid rises in the use of new sources of gas for suicide were generally associated with increases in overall suicide rates. Suicide prevention strategies should include strengthening local and national surveillance for early detection of novel suicide methods and implementation of effective media guidelines and other appropriate interventions to limit the spread of

  7. Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

    Directory of Open Access Journals (Sweden)

    Maria Balcova

    2016-04-01

    Full Text Available Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm and Mus m. domesticus (Mmd, it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2 genomic locus on Chromosome X (Chr X by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s responsible for variation in the global recombination rate between closely related mouse subspecies.

  8. Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

    Science.gov (United States)

    Balcova, Maria; Faltusova, Barbora; Gergelits, Vaclav; Bhattacharyya, Tanmoy; Mihola, Ondrej; Trachtulec, Zdenek; Knopf, Corinna; Fotopulosova, Vladana; Chvatalova, Irena; Gregorova, Sona; Forejt, Jiri

    2016-04-01

    Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm) and Mus m. domesticus (Mmd), it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2) genomic locus on Chromosome X (Chr X) by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s) responsible for variation in the global recombination rate between closely related mouse subspecies.

  9. Research on criticality analysis method of CNC machine tools components under fault rate correlation

    Science.gov (United States)

    Gui-xiang, Shen; Xian-zhuo, Zhao; Zhang, Ying-zhi; Chen-yu, Han

    2018-02-01

    In order to determine the key components of CNC machine tools under fault rate correlation, a system component criticality analysis method is proposed. Based on the fault mechanism analysis, the component fault relation is determined, and the adjacency matrix is introduced to describe it. Then, the fault structure relation is hierarchical by using the interpretive structure model (ISM). Assuming that the impact of the fault obeys the Markov process, the fault association matrix is described and transformed, and the Pagerank algorithm is used to determine the relative influence values, combined component fault rate under time correlation can obtain comprehensive fault rate. Based on the fault mode frequency and fault influence, the criticality of the components under the fault rate correlation is determined, and the key components are determined to provide the correct basis for equationting the reliability assurance measures. Finally, taking machining centers as an example, the effectiveness of the method is verified.

  10. Measurement of disintegration rates of 60Co volume sources by the sum-peak method

    International Nuclear Information System (INIS)

    Kawano, Takao; Ebihara, Hiroshi

    1991-01-01

    The sum-peak method has been applied to the determination of the disintegration rates of 60 Co volume sources (1.05 x 10 4 Bq, 1.05 x 10 3 Bq and 1.05 x 10 2 Bq, in 100-ml polyethylene bottles) by using a NaI(Tl) detector of a diameter of 50 mm and a height of 50 mm. The experimental results showed that decreasing the disintegration rates resulted in enlarged underestimation in comparison with the true disintegration rates. It was presumed that the underestimations of the disintegration rates determined by the sum-peak method resulted from the overestimations of the areas under the sum peaks caused by the overlap of the area under the Compton scattering of the γ-ray (2614 keV) emitted from a naturally occurring radionuclide 208 Tl under the sum peaks. (author)

  11. Neutron Scattering in Hydrogenous Moderators, Studied by Time Dependent Reaction Rate Method

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, L G; Moeller, E; Purohit, S N

    1966-03-15

    The moderation and absorption of a neutron burst in water, poisoned with the non-1/v absorbers cadmium and gadolinium, has been followed on the time scale by multigroup calculations, using scattering kernels for the proton gas and the Nelkin model. The time dependent reaction rate curves for each absorber display clear differences for the two models, and the separation between the curves does not depend much on the absorber concentration. An experimental method for the measurement of infinite medium reaction rate curves in a limited geometry has been investigated. This method makes the measurement of the time dependent reaction rate generally useful for thermalization studies in a small geometry of a liquid hydrogenous moderator, provided that the experiment is coupled to programs for the calculation of scattering kernels and time dependent neutron spectra. Good agreement has been found between the reaction rate curve, measured with cadmium in water, and a calculated curve, where the Haywood kernel has been used.

  12. System and Method for Determining Rate of Rotation Using Brushless DC Motor

    Science.gov (United States)

    Howard, David E. (Inventor); Smith, Dennis A. (Inventor)

    2000-01-01

    A system and method are provided for measuring rate of rotation. A brushless DC motor is rotated and produces a back electromagnetic force (emf) on each winding thereof. Each winding's back-emf is squared. The squared outputs associated with each winding are combined, with the square root being taken of such combination, to produce a DC output proportional only to the rate of rotation of the motor's shaft.

  13. Investigation of the existing methodology of value estimation and methods of discount rate estimation

    OpenAIRE

    Plikus, Iryna

    2017-01-01

    The subject of research is the current practice of determining the fair value of assets and liabilities at the present (discounted) cost. One of the most problematic places is the determination of the discount rate, which belongs to the jurisdiction of a professional accountant judgment.The methods of formalization, hypothetical assumption, system approach and scientific abstraction in substantiating the formation of accounting policy with respect to the choice of the discount rate are used i...

  14. Intracavitary after loading techniques, advantages and disadvantages with high and low dose-rate methods

    International Nuclear Information System (INIS)

    Walstam, Rune

    1980-01-01

    Even though suggested as early as 1903, it is only when suitable sealed gamma sources became available, afterloading methods could be developed for interstitial as well as intracavitary work. Manual afterloading technique can be used only for low dose rate irradiation, while remote controlled afterloading technique can be used for both low and high dose-rate irradiation. Afterloading units used at the Karolinska Institute, Stockholm, are described, and experience of their use is narrated briefly. (M.G.B.)

  15. The log mean heat transfer rate method of heat exchanger considering the influence of heat radiation

    International Nuclear Information System (INIS)

    Wong, K.-L.; Ke, M.-T.; Ku, S.-S.

    2009-01-01

    The log mean temperature difference (LMTD) method is conventionally used to calculate the total heat transfer rate of heat exchangers. Because the heat radiation equation contains the 4th order exponential of temperature which is very complicate in calculations, thus LMTD method neglects the influence of heat radiation. From the recent investigation of a circular duct in some practical situations, it is found that even in the situation of the temperature difference between outer duct surface and surrounding is low to 1 deg. C, the heat radiation effect can not be ignored in the situations of lower ambient convective heat coefficient and greater surface emissivities. In this investigation, the log mean heat transfer rate (LMHTR) method which considering the influence of heat radiation, is developed to calculate the total heat transfer rate of heat exchangers.

  16. Engineering Mathematical Analysis Method for Productivity Rate in Linear Arrangement Serial Structure Automated Flow Assembly Line

    Directory of Open Access Journals (Sweden)

    Tan Chan Sin

    2015-01-01

    Full Text Available Productivity rate (Q or production rate is one of the important indicator criteria for industrial engineer to improve the system and finish good output in production or assembly line. Mathematical and statistical analysis method is required to be applied for productivity rate in industry visual overviews of the failure factors and further improvement within the production line especially for automated flow line since it is complicated. Mathematical model of productivity rate in linear arrangement serial structure automated flow line with different failure rate and bottleneck machining time parameters becomes the basic model for this productivity analysis. This paper presents the engineering mathematical analysis method which is applied in an automotive company which possesses automated flow assembly line in final assembly line to produce motorcycle in Malaysia. DCAS engineering and mathematical analysis method that consists of four stages known as data collection, calculation and comparison, analysis, and sustainable improvement is used to analyze productivity in automated flow assembly line based on particular mathematical model. Variety of failure rate that causes loss of productivity and bottleneck machining time is shown specifically in mathematic figure and presents the sustainable solution for productivity improvement for this final assembly automated flow line.

  17. Method and system of simulating nuclear power plant count rate for training purposes

    International Nuclear Information System (INIS)

    Alliston, W.H.; Koenig, R.H.

    1975-01-01

    A method and system are described for the real-time simulation of the dynamic operation of a nuclear power plant in which nuclear flux rate counters are provided for monitoring the rate of nuclear fission of the reactor. The system utilizes apparatus that includes digital computer means for calculating data relating to the rate of nuclear fission of a simulated reactor model, which rate is controlled in accordance with the operation of control panel devices. A digital number from the computer corresponding to the flux rate controls an oscillator driven counter means to produce a pulse after a predetermined count. This pulse controls an oscillator driven polynomial counter to count a random number that controls a third counter in accordance with pulse from the first counter to produce a random fission count for operating the meters. (U.S.)

  18. Survey of methods for the rating of psychiatric impairment in Australia.

    Science.gov (United States)

    Mendelson, George

    2004-05-01

    One of the enduring clinical issues in the assessment of plaintiffs in personal injury and workers' compensation claims, as well as applicants for social security and disablement benefits, is that of the evaluation of impairment and work incapacity. Many writers on this topic confuse the concepts of impairment and disability, and similar confusion is reflected in a number of the rating methods that purport to evaluate impairment but in reality assess disability. In Australia there are 20 distinct statutory schemes for workers' compensation, motor accident compensation, and social security and other benefits, which utilise a variety of methods for the rating of psychiatric impairment. Recent legislative changes designed to restrict access to personal injury compensation at common law, which in two Australian State jurisdictions require the use of impairment rating scales, also specify the rating methods to be used in the assessment of psychiatric impairment. This article discusses the concepts of impairment and disability as defined by the World Health Organisation, and reviews the various methods for the rating of psychiatric impairment that are specified by statute in the federal and State jurisdictions in Australia.

  19. Study (Prediction of Main Pipes Break Rates in Water Distribution Systems Using Intelligent and Regression Methods

    Directory of Open Access Journals (Sweden)

    Massoud Tabesh

    2011-07-01

    Full Text Available Optimum operation of water distribution networks is one of the priorities of sustainable development of water resources, considering the issues of increasing efficiency and decreasing the water losses. One of the key subjects in optimum operational management of water distribution systems is preparing rehabilitation and replacement schemes, prediction of pipes break rate and evaluation of their reliability. Several approaches have been presented in recent years regarding prediction of pipe failure rates which each one requires especial data sets. Deterministic models based on age and deterministic multi variables and stochastic group modeling are examples of the solutions which relate pipe break rates to parameters like age, material and diameters. In this paper besides the mentioned parameters, more factors such as pipe depth and hydraulic pressures are considered as well. Then using multi variable regression method, intelligent approaches (Artificial neural network and neuro fuzzy models and Evolutionary polynomial Regression method (EPR pipe burst rate are predicted. To evaluate the results of different approaches, a case study is carried out in a part ofMashhadwater distribution network. The results show the capability and advantages of ANN and EPR methods to predict pipe break rates, in comparison with neuro fuzzy and multi-variable regression methods.

  20. Neutron spectra determination methods using the measured reaction rates in SAPIS

    International Nuclear Information System (INIS)

    Bondars, Kh.Ya.; Lapenas, A.A.

    1980-01-01

    Mathematical basis of algorithms is given for methods of neutron spectra restoration in accordance with the measured reaction rates of the activation detectors included into the information-determination system SAIPS aimed at generalization of the most popular home and foreign neutron spectra determination methods as well as the establishment of their mutual relations. The following neutron spectra determination methods are described: SAND-II, CRYSTAL BALL, WINDOWS, SPECTRA, RESP, JUL; polynominal and directed divergence methods. The algorithms have been realized on the ES computer

  1. THE EFFECT OF EXCHANGE RATE ON THE CONSTRUCTION PROJECTS AND PROTECTION METHODS

    Directory of Open Access Journals (Sweden)

    Handan AKSUYEK,

    2017-02-01

    Full Text Available As with all sectors, recent extreme changes occurred in the exchange rates have substantially affected the construction operations. While the rise in foreign exchange rates leads to harmful effects in the negative direction at the operations having foreign exchange – based debt or it provides also advantageous effect in the positive direction at the construction companies having foreign exchange – indexed investments. In this context, this sudden change in foreign exchange rates which cannot be predicted beforehand and emerges as a result of speculative events. As with all operations carrying out foreign exchange – based tasks, these fluctuations in the foreign exchange rate head first among the factors which affect the achievement or failure of the cost or profit targets previously determined by the construction companies as well. Therefore, the companies whose costs and profits consist of different units of currency in their construction agreements should apply to the hedging methods in order to be protected against the exchange rate. As for the main tools of protection method are the derivative products such as forward, futures, swap and optional contracts. In this study, the effect of exchange rate fluctuations on the completion costs of construction projects is scrutinized. Moreover, the tools which may be employed by the construction companies in order to get rid of exchange rate which adversely influence the building companies in both directions have been comparatively evaluated.

  2. Comparison on different repetition rate locking methods in Er-doped fiber laser

    Science.gov (United States)

    Yang, Kangwen; Zhao, Peng; Luo, Jiang; Huang, Kun; Hao, Qiang; Zeng, Heping

    2018-05-01

    We demonstrate a systematic comparative research on the all-optical, mechanical and opto-mechanical repetition rate control methods in an Er-doped fiber laser. A piece of Yb-doped fiber, a piezoelectric transducer and an electronic polarization controller are simultaneously added in the laser cavity as different cavity length modulators. By measuring the cavity length tuning ranges, the output power fluctuations, the temporal and frequency repetition rate stability, we show that all-optical method introduces the minimal disturbances under current experimental condition.

  3. Method of measuring the mass flow rate of a substance entering a cocurrent fluid stream

    International Nuclear Information System (INIS)

    Cochran, H.D. Jr.

    1978-01-01

    An improved method of monitoring the mass flow rate of a substance entering a coherent fluid stream is described. The method very basically consists of heating equal sections of the fluid stream above and below the point of entry of the substance to be monitored, and measuring and comparing the resulting change in temperature of the sections. Advantage is taken of the difference in thermal characteristics of the fluid and the substance to be measured to correlate temperature differences in the sections above and below the substance feed point for providing an indication of the mass flow rate of the substance

  4. A Globally Convergent Matrix-Free Method for Constrained Equations and Its Linear Convergence Rate

    Directory of Open Access Journals (Sweden)

    Min Sun

    2014-01-01

    Full Text Available A matrix-free method for constrained equations is proposed, which is a combination of the well-known PRP (Polak-Ribière-Polyak conjugate gradient method and the famous hyperplane projection method. The new method is not only derivative-free, but also completely matrix-free, and consequently, it can be applied to solve large-scale constrained equations. We obtain global convergence of the new method without any differentiability requirement on the constrained equations. Compared with the existing gradient methods for solving such problem, the new method possesses linear convergence rate under standard conditions, and a relax factor γ is attached in the update step to accelerate convergence. Preliminary numerical results show that it is promising in practice.

  5. Precise method for correcting count-rate losses in scintillation cameras

    International Nuclear Information System (INIS)

    Madsen, M.T.; Nickles, R.J.

    1986-01-01

    Quantitative studies performed with scintillation detectors often require corrections for lost data because of the finite resolving time of the detector. Methods that monitor losses by means of a reference source or pulser have unacceptably large statistical fluctuations associated with their correction factors. Analytic methods that model the detector as a paralyzable system require an accurate estimate of the system resolving time. Because the apparent resolving time depends on many variables, including the window setting, source distribution, and the amount of scattering material, significant errors can be introduced by relying on a resolving time obtained from phantom measurements. These problems can be overcome by curve-fitting the data from a reference source to a paralyzable model in which the true total count rate in the selected window is estimated from the observed total rate. The resolving time becomes a free parameter in this method which is optimized to provide the best fit to the observed reference data. The fitted curve has the inherent accuracy of the reference source method with the precision associated with the observed total image count rate. Correction factors can be simply calculated from the ratio of the true reference source rate and the fitted curve. As a result, the statistical uncertainty of the data corrected by this method is not significantly increased

  6. 76 FR 38282 - Federal Employees Health Benefits Program: New Premium Rating Method for Most Community Rated Plans

    Science.gov (United States)

    2011-06-29

    ... set but prior to January 1 of the plan year, including book rates filed with the state. Once SSSGs... after rates were set but before January 1 of the plan year, such as new book rates filed in the state in.... OPM's intention is to keep FEHB premiums stable and sustainable using this more transparent...

  7. Estimation of turbulence dissipation rate by Large eddy PIV method in an agitated vessel

    Directory of Open Access Journals (Sweden)

    Kysela Bohuš

    2015-01-01

    Full Text Available The distribution of turbulent kinetic energy dissipation rate is important for design of mixing apparatuses in chemical industry. Generally used experimental methods of velocity measurements for measurement in complex geometries of an agitated vessel disallow measurement in resolution of small scales close to turbulence dissipation ones. Therefore, Particle image velocity (PIV measurement method improved by large eddy Ply approach was used. Large eddy PIV method is based on modeling of smallest eddies by a sub grid scale (SGS model. This method is similar to numerical calculations using Large Eddy Simulation (LES and the same SGS models are used. In this work the basic Smagorinsky model was employed and compared with power law approximation. Time resolved PIV data were processed by Large Eddy PIV approach and the obtained results of turbulent kinetic dissipation rate were compared in selected points for several operating conditions (impeller speed, operating liquid viscosity.

  8. Simplified method of ''push-pull'' test data analysis for determining in situ reaction rate coefficients

    International Nuclear Information System (INIS)

    Haggerty, R.; Schroth, M.H.; Istok, J.D.

    1998-01-01

    The single-well, ''''push-pull'''' test method is useful for obtaining information on a wide variety of aquifer physical, chemical, and microbiological characteristics. A push-pull test consists of the pulse-type injection of a prepared test solution into a single monitoring well followed by the extraction of the test solution/ground water mixture from the same well. The test solution contains a conservative tracer and one or more reactants selected to investigate a particular process. During the extraction phase, the concentrations of tracer, reactants, and possible reaction products are measured to obtain breakthrough curves for all solutes. This paper presents a simplified method of data analysis that can be used to estimate a first-order reaction rate coefficient from these breakthrough curves. Rate coefficients are obtained by fitting a regression line to a plot of normalized concentrations versus elapsed time, requiring no knowledge of aquifer porosity, dispersivity, or hydraulic conductivity. A semi-analytical solution to the advective-dispersion equation is derived and used in a sensitivity analysis to evaluate the ability of the simplified method to estimate reaction rate coefficients in simulated push-pull tests in a homogeneous, confined aquifer with a fully-penetrating injection/extraction well and varying porosity, dispersivity, test duration, and reaction rate. A numerical flow and transport code (SUTRA) is used to evaluate the ability of the simplified method to estimate reaction rate coefficients in simulated push-pull tests in a heterogeneous, unconfined aquifer with a partially penetrating well. In all cases the simplified method provides accurate estimates of reaction rate coefficients; estimation errors ranged from 0.1 to 8.9% with most errors less than 5%

  9. Determination of the Absolute Disintegration Rate of Cs-137 sources by the Tracer Method

    Energy Technology Data Exchange (ETDEWEB)

    Hellstroem, S; Brune, D

    1963-07-15

    {sup 137}Cs - sources were absolutely measured by the 'tracer method', with {sup 82}Br as a tracer nuclide and with application of the 4{pi} {beta}-{gamma} coincidence technique. A self-absorption of 6 % was found in sources obtained from a solution with a carrier-content of 400 {mu}g/ml. The precision of the method for the determination of the {beta}-emission rate was estimated to {+-} 1 %. The results were compared with those of other works.

  10. Time-trends in method-specific suicide rates compared with the availability of specific compounds

    DEFF Research Database (Denmark)

    Nordentoft, Merete; Qin, Ping; Helweg-Larsen, Karin

    2006-01-01

    Restriction of means for suicide is an important part of suicide preventive strategies in different countries. All suicides in Denmark between 1970 and 2000 were examined with regard to method used for suicide. Overall suicide mortality and method-specific suicide mortality was compared...... in the number of suicides by self-poisoning with these compounds. Restricted access occurred concomittantly with a 55% decrease in suicide rate....

  11. Determination of the Absolute Disintegration Rate of Cs-137 sources by the Tracer Method

    International Nuclear Information System (INIS)

    Hellstroem, S.; Brune, D.

    1963-07-01

    137 Cs - sources were absolutely measured by the 'tracer method', with 82 Br as a tracer nuclide and with application of the 4π β-γ coincidence technique. A self-absorption of 6 % was found in sources obtained from a solution with a carrier-content of 400 μg/ml. The precision of the method for the determination of the β-emission rate was estimated to ± 1 %. The results were compared with those of other works

  12. Predicting hepatitis B monthly incidence rates using weighted Markov chains and time series methods.

    Science.gov (United States)

    Shahdoust, Maryam; Sadeghifar, Majid; Poorolajal, Jalal; Javanrooh, Niloofar; Amini, Payam

    2015-01-01

    Hepatitis B (HB) is a major global mortality. Accurately predicting the trend of the disease can provide an appropriate view to make health policy disease prevention. This paper aimed to apply three different to predict monthly incidence rates of HB. This historical cohort study was conducted on the HB incidence data of Hamadan Province, the west of Iran, from 2004 to 2012. Weighted Markov Chain (WMC) method based on Markov chain theory and two time series models including Holt Exponential Smoothing (HES) and SARIMA were applied on the data. The results of different applied methods were compared to correct percentages of predicted incidence rates. The monthly incidence rates were clustered into two clusters as state of Markov chain. The correct predicted percentage of the first and second clusters for WMC, HES and SARIMA methods was (100, 0), (84, 67) and (79, 47) respectively. The overall incidence rate of HBV is estimated to decrease over time. The comparison of results of the three models indicated that in respect to existing seasonality trend and non-stationarity, the HES had the most accurate prediction of the incidence rates.

  13. Variation of strain rate sensitivity index of a superplastic aluminum alloy in different testing methods

    Science.gov (United States)

    Majidi, Omid; Jahazi, Mohammad; Bombardier, Nicolas; Samuel, Ehab

    2017-10-01

    The strain rate sensitivity index, m-value, is being applied as a common tool to evaluate the impact of the strain rate on the viscoplastic behaviour of materials. The m-value, as a constant number, has been frequently taken into consideration for modeling material behaviour in the numerical simulation of superplastic forming processes. However, the impact of the testing variables on the measured m-values has not been investigated comprehensively. In this study, the m-value for a superplastic grade of an aluminum alloy (i.e., AA5083) has been investigated. The conditions and the parameters that influence the strain rate sensitivity for the material are compared with three different testing methods, i.e., monotonic uniaxial tension test, strain rate jump test and stress relaxation test. All tests were conducted at elevated temperature (470°C) and at strain rates up to 0.1 s-1. The results show that the m-value is not constant and is highly dependent on the applied strain rate, strain level and testing method.

  14. Universal Rate Model Selector: A Method to Quickly Find the Best-Fit Kinetic Rate Model for an Experimental Rate Profile

    Science.gov (United States)

    2017-08-01

    k2 – k1) 3.3 Universal Kinetic Rate Platform Development Kinetic rate models range from pure chemical reactions to mass transfer...14 8. The rate model that best fits the experimental data is a first-order or homogeneous catalytic reaction ...Avrami (7), and intraparticle diffusion (6) rate equations to name a few. A single fitting algorithm (kinetic rate model ) for a reaction does not

  15. Water vapor mass balance method for determining air infiltration rates in houses

    Science.gov (United States)

    David R. DeWalle; Gordon M. Heisler

    1980-01-01

    A water vapor mass balance technique that includes the use of common humidity-control equipment can be used to determine average air infiltration rates in buildings. Only measurements of the humidity inside and outside the home, the mass of vapor exchanged by a humidifier/dehumidifier, and the volume of interior air space are needed. This method gives results that...

  16. A method to increase optical timing spectra measurement rates using a multi-hit TDC

    International Nuclear Information System (INIS)

    Moses, W.W.

    1993-01-01

    A method is presented for using a modern time to digital converter (TDC) to increase the data collection rate for optical timing measurements such as scintillator decay times. It extends the conventional delayed coincidence method, where a synchronization signal ''starts'' a TDC and a photomultiplier tube (PMT) sampling the optical signal ''stops'' the TDC. Data acquisition rates are low with the conventional method because ε, the light collection efficiency of the ''stop'' PMT, is artificially limited to ε∼0.01 photons per ''start'' signal to reduce the probability of detecting more than one photon during the sampling period. With conventional TDCs, these multiple photon events bias the time spectrum since only the first ''stop'' pulse is digitized. The new method uses a modern TDC to detect whether additional ''stop'' signals occur during the sampling period, and actively reject these multiple photon events. This allows ε to be increased to almost 1 photon per ''start'' signal, which maximizes the data acquisition rate at a value nearly 20 times higher. Multi-hit TDCs can digitize the arrival times of n ''stop'' signals per ''start'' signal, which allows ε to be increased to ∼3n/4. While overlap of the ''stop'' signals prevents the full gain in data collection rate to be realized, significant improvements are possible for most applications. (orig.)

  17. A method to quench and recharge avalanche photo diodes for use in high rate situations

    International Nuclear Information System (INIS)

    Regan, T.O.; Fenker, H.C.; Thomas, J.; Oliver, J.

    1992-06-01

    We present a new method of using Avalanche Photo Diodes (APDS) for low level light detection in Geiger mode in high rate situations such as those encountered at the Superconducting Super Collider (SSC). The new technique is readily adaptable to implementation in CMOS VLSI

  18. Effects of nitrogen rate and application method on early production and fruit quality in highbush blueberry

    Science.gov (United States)

    A field study was conducted to examine the effects of nitrogen (N) rate and method of N fertilizer application on growth, yield, and fruit quality in highbush blueberry (Vaccinium corymbosum L.) during the first 4 years after planting in south-coastal BC. Nitrogen was applied at 0-150% of current pr...

  19. Building America Guidance for Identifying and Overcoming Code, Standard, and Rating Method Barriers

    Energy Technology Data Exchange (ETDEWEB)

    Cole, P. C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Halverson, M. A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2013-09-01

    This guidance document was prepared using the input from the meeting summarized in the draft CSI Roadmap to provide Building America research teams and partners with specific information and approaches to identifying and overcoming potential barriers to Building America innovations arising in and/or stemming from codes, standards, and rating methods.

  20. Machine cost analysis using the traditional machine-rate method and ChargeOut!

    Science.gov (United States)

    E. M. (Ted) Bilek

    2009-01-01

    Forestry operations require ever more use of expensive capital equipment. Mechanization is frequently necessary to perform cost-effective and safe operations. Increased capital should mean more sophisticated capital costing methodologies. However the machine rate method, which is the costing methodology most frequently used, dates back to 1942. CHARGEOUT!, a recently...

  1. A method for studying post-fledging survival rates using data from ringing recoveries

    NARCIS (Netherlands)

    Thomson, D.L.; Baillie, S.R.; Peach, W.J.

    1999-01-01

    We present a method for studying post-fledging survival rates from data on national ringing recoveries. The approach extends the classical two-age-class models of Brownie et al. (1985) to include a third age-class of birds ringed as nestlings. The models can incorporate age-class-specific and

  2. A modified Gaussian integration method for thermal reaction rate calculation in U- and Pu-isotopes

    International Nuclear Information System (INIS)

    Bosevski, T.; Fredin, B.

    1966-01-01

    An advanced multi-group cell calculations a lot of data information is very often necessary, and hence the data administration will be elaborate, and the spectrum calculation will be time consuming. We think it is possible to reduce the necessary data information by using an effective reaction rate integration method well suited for U- and Pu-absorptions (author)

  3. A method of inferring k-infinity from reaction rate measurements in thermal reactor systems

    International Nuclear Information System (INIS)

    Newmarch, D.A.

    1967-05-01

    A scheme is described for inferring a value of k-infinity from reaction rate measurements. The method is devised with the METHUSELAH group structure in mind and was developed for the analysis of S.G.H.W. reactor experiments; the underlying principles, however, are general. (author)

  4. The Relationship Between Method of Viewing Lectures, Course Ratings, and Course Timing.

    Science.gov (United States)

    Burton, William B; Ma, Terence P; Grayson, Martha S

    2017-01-01

    In recent years, medical schools have provided students access to video recordings of course lectures, but few studies have investigated the impact of this on ratings of courses and teachers. This study investigated whether the method of viewing lectures was related to student ratings of the course and its components and whether the method used changed over time. Preclinical medical students indicated whether ratings of course lectures were based primarily on lecture attendance, video capture, or both. Students were categorized into Lecture, Video, or Both groups based on their responses to this question. The data consisted of 7584 student evaluations collected over 2 years. Students who attended live lectures rated the course and its components higher than students who only viewed the video or used both methods, although these differences were very small. Students increasingly watched lectures exclusively by video over time: in comparison with first-year students, second-year students were more likely to watch lectures exclusively by video; in comparison with students in the first half of the academic year, students in the second half of the academic year were more likely to watch lectures exclusively by video. With the increase in use of lecture video recordings across medical schools, attention must be paid to student attitudes regarding these methods.

  5. Concurrent Driving Method with Fast Scan Rate for Large Mutual Capacitance Touch Screens

    Directory of Open Access Journals (Sweden)

    Mohamed Gamal Ahmed Mohamed

    2015-01-01

    Full Text Available A novel touch screen control technique is introduced, which scans each frame in two steps of concurrent multichannel driving and differential sensing. The proposed technique substantially increases the scan rate and reduces the ambient noise effectively. It is also extended to a multichip architecture to support excessively large touch screens with great scan rate improvement. The proposed method has been implemented using 0.18 μm CMOS TowerJazz process and tested with FPGA and AFE board connecting a 23-inch touch screen. Experimental results show a scan rate improvement of up to 23.8 times and an SNR improvement of 24.6 dB over the conventional method.

  6. Identification of strain-rate and thermal sensitive material model with an inverse method

    CERN Document Server

    Peroni, L; Peroni, M

    2010-01-01

    This paper describes a numerical inverse method to extract material strength parameters from the experimental data obtained via mechanical tests at different strain-rates and temperatures. It will be shown that this procedure is particularly useful to analyse experimental results when the stress-strain fields in the specimen cannot be correctly described via analytical models. This commonly happens in specimens with no regular shape, in specimens with a regular shape when some instability phenomena occur (for example the necking phenomena in tensile tests that create a strongly heterogeneous stress-strain fields) or in dynamic tests (where the strain-rate field is not constant due to wave propagation phenomena). Furthermore the developed procedure is useful to take into account thermal phenomena generally affecting high strain-rate tests due to the adiabatic overheating related to the conversion of plastic work. The method presented requires strong effort both from experimental and numerical point of view, an...

  7. Measurements of μ capture rates in liquid hydrogen by the lifetime method

    International Nuclear Information System (INIS)

    Martino, Jacques.

    1982-04-01

    The μ capture reaction is a weak interaction. It can be observed as a result of the formation of muonic atoms for which the overlopping of the wave functions of the muon and nucleus is a maximum in the 1s state. The production of this (μp) bound state leads to a capture rate in relatively favorable competition with the disintegration rate. The capture rate for a pulsed muon beam (from the Saclay linear accelerator) was measured in liquid hydrogen by the lifetime method. The method and experimental equipment used for the lifetime measurements are described together with the different sources of systematic error and the results obtained. The interpretation of these results is discussed [fr

  8. Open charcoal chamber method for mass measurements of radon exhalation rate from soil surface

    International Nuclear Information System (INIS)

    Tsapalov, Andrey; Kovler, Konstantin; Miklyaev, Peter

    2016-01-01

    Radon exhalation rate from the soil surface can serve as an important criterion in the evaluation of radon hazard of the land. Recently published international standard ISO 11665-7 (2012) is based on the accumulation of radon gas in a closed container. At the same time since 1998 in Russia, as a part of engineering and environmental studies for the construction, radon flux measurements are made using an open charcoal chamber for a sampling duration of 3–5 h. This method has a well-defined metrological justification and was tested in both favorable and unfavorable conditions. The article describes the characteristics of the method, as well as the means of sampling and measurement of the activity of radon absorbed. The results of the metrological study suggest that regardless of the sampling conditions (weather, the mechanism and rate of radon transport in the soil, soil properties and conditions), uncertainty of method does not exceed 20%, while the combined standard uncertainty of radon exhalation rate measured from the soil surface does not exceed 30%. The results of the daily measurements of radon exhalation rate from the soil surface at the experimental site during one year are reported. - Highlights: • Radon exhalation rate from the soil surface area of 32 cm"2 can be measured at level of 10 mBq/(m"2s) at the uncertainty ≤30%. • The method has a metrological justification. • No need to consider climate conditions, soil properties and conditions, mechanism and rate of radon transport in the soil.

  9. Method and apparatus for obtaining enhanced production rate of thermal chemical reactions

    Science.gov (United States)

    Tonkovich, Anna Lee Y [Pasco, WA; Wang, Yong [Richland, WA; Wegeng, Robert S [Richland, WA; Gao, Yufei [Kennewick, WA

    2003-04-01

    The present invention is a method and apparatus (vessel) for providing a heat transfer rate from a reaction chamber through a wall to a heat transfer chamber substantially matching a local heat transfer rate of a catalytic thermal chemical reaction. The key to the invention is a thermal distance defined on a cross sectional plane through the vessel inclusive of a heat transfer chamber, reaction chamber and a wall between the chambers. The cross sectional plane is perpendicular to a bulk flow direction of the reactant stream, and the thermal distance is a distance between a coolest position and a hottest position on the cross sectional plane. The thermal distance is of a length wherein the heat transfer rate from the reaction chamber to the heat transfer chamber substantially matches the local heat transfer rate.

  10. A finite element modeling method for predicting long term corrosion rates

    International Nuclear Information System (INIS)

    Fu, J.W.; Chan, S.

    1984-01-01

    For the analyses of galvanic corrosion, pitting and crevice corrosion, which have been identified as possible corrosion processes for nuclear waste isolation, a finite element method has been developed for the prediction of corrosion rates. The method uses a finite element mesh to model the corrosive environment and the polarization curves of metals are assigned as the boundary conditions to calculate the corrosion cell current distribution. A subroutine is used to calculate the chemical change with time in the crevice or the pit environments. In this paper, the finite element method is described along with experimental confirmation

  11. Comparison of survival rates among different treatment methods of transcatheter hepatic arterial chemoembolization for hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Shim, Yong Woon; Lee, Jong Tae; Yoo, Hyung Sik; Lee, Do Yun; Jun, Pyoung Jun; Chang, So Yong [Yonsei Univ. College of Medicine, Seoul (Korea, Republic of)

    1996-06-01

    To compare the survival rates of patients with hepatoma using different methods of transcatheter arterial chemoemblization(THAE). Four hundred and eighty three patients with hepatoma diagnosed by biopsy, serum alpha-fetoprotein, abdominal CT scan, abdominal ultrasonography or hepatic angiography were included, but not all had received surgical treatment. They were divided onto two groups according to Child's classification and into subgroups according to different methods of THAE. Five-tear survival rates among these groups were retrospectively compared. The patients were aged between 24 and 85(mean, 58) ; male to female ratio was 324 : 61 for those who received THAE (369 : 87 when only hepatic angiography was considered.). In the group with more than a single episode of chemoembolization, regardless of Child's classification, a better survival rate compared to the other groups with or without concommitant radiotherapy or without chemoembolization was noted. There was no difference in the survival rate of patients with multiple chemoembolization. moreover, no difference in this rate was observed no matter what chemotherapeutic agents, including Adriamycin, Cis-Diaminedichloroplatinum of I-131-Lipiodol, were used. Amortization by gelfoam in conjuction with Adriamycin resulted in no difference in survival rate regardless of frequency of chemoembolization. An improved survival rate was seen when multiple episodes of chemoembolization were applied, but no difference was seen when there was concomitant application of either gelfoam or radiotherapy. Two different chemotherapeutic agents, Adriamycin and Cis-Diaminedichloroplatinum, were used, but there was no difference between them in their effect on survival rates.

  12. Pleural liquid clearance rate measured in awake sheep by the volume of dilution method

    International Nuclear Information System (INIS)

    Broaddus, V.C.; Wiener-Kronish, J.P.; Berthiaume, Y.; Staub, N.C.

    1986-01-01

    The authors reported 24h clearance of mock pleural effusions measured terminally in sheep. To measure effusion volume at different times in the same sheep, they injected 111 In-transferrin and measured its dilution. In 5 sheep with effusions of known sizes, the method was accurate to +/-10%. In 5 awake sheep, the authors injected 10 ml/kg of a 1% protein solution via a non-penetrating rib capsule. At 6h, the authors measured the volume by the dilution method and at 24h by direct recovery. The clearance rate in each animal was constant at 2.9-6.0%/h (average 4.8 +/- 1.3%/h). This new method gives a reliable two point clearance rate and requires fewer animals

  13. NDT method in determining the rate of corrosion applicable to risk based inspection

    International Nuclear Information System (INIS)

    Mohamed Hairul Hasmoni; Mohamad Pauzi Ismail; Ab Razak Hamzah

    2004-01-01

    Corrosion is a major problem in oil and gas industries, refineries and chemical process plants as the equipment is often exposed to corrosive environments or elevated temperature. Important equipment need to operate safely and reliably to avoid injuries to personnel and the public, and to prevent loss time and cost incurred due to loss of production and shutdown. The paper assess the approach in evaluating the technique of non-destructive testing (NDT) using Ultrasonic Testing (UT) in determining the rate of corrosion and remaining life of equipment applicable to Risk Based Inspection (RBI). Methods in determining the corrosion rate are presented using analytical method. Examples and data from MINT chiller water pipeline are presented to illustrate the application of these methods. (Author)

  14. Development of An Optimization Method for Determining Automation Rate in Nuclear Power Plants

    International Nuclear Information System (INIS)

    Lee, Seung Min; Seong, Poong Hyun; Kim, Jong Hyun

    2014-01-01

    Since automation was introduced in various industrial fields, it has been known that automation provides positive effects like greater efficiency and fewer human errors, and negative effect defined as out-of-the-loop (OOTL). Thus, before introducing automation in nuclear field, the estimation of the positive and negative effects of automation on human operators should be conducted. In this paper, by focusing on CPS, the optimization method to find an appropriate proportion of automation is suggested by integrating the suggested cognitive automation rate and the concepts of the level of ostracism. The cognitive automation rate estimation method was suggested to express the reduced amount of human cognitive loads, and the level of ostracism was suggested to express the difficulty in obtaining information from the automation system and increased uncertainty of human operators' diagnosis. The maximized proportion of automation that maintains the high level of attention for monitoring the situation is derived by an experiment, and the automation rate is estimated by the suggested automation rate estimation method. It is expected to derive an appropriate inclusion proportion of the automation system avoiding the OOTL problem and having maximum efficacy at the same time

  15. A 'college of astrology and medicine'? Charles V, Gervais Chrétien, and the scientific manuscripts of Maître Gervais's College.

    Science.gov (United States)

    Boudet, Jean-Patrice

    2010-06-01

    Considered an institution mainly devoted to astrology and medicine by Simon de Phares and by some historians who believe that he was reliable, the college founded in 1371 by Charles V's first physician, Gervais Chrétien, was in fact primarily dedicated to theological students. It was not before 1377 that there were created there two bursaries for scholares regis, specialising in 'licit mathematical sciences', and two medical fellowships. Yet the influence of the activity of these fellows seems to have been rather moderate and-as far as we can learn from the material still extant, notably from manuscripts that belonged to Maître Gervais' College and to some of its members-this institution was devoted much more to theological studies than to medicine and the quadrivium.

  16. Model for determining vapor equilibrium rates in the hanging drop method for protein crystal growth

    Science.gov (United States)

    Baird, James K.; Frieden, Richard W.; Meehan, E. J., Jr.; Twigg, Pamela J.; Howard, Sandra B.; Fowlis, William A.

    1987-01-01

    An engineering analysis of the rate of evaporation of solvent in the hanging drop method of protein crystal growth is presented. Results are applied to 18 drop and well arrangements commonly encountered in the laboratory. The chemical nature of the salt, drop size and shape, drop concentration, well size, well concentration, and temperature are taken into account. The rate of evaporation increases with temperature, drop size, and the salt concentration difference between the drop and the well. The evaporation in this model possesses no unique half-life. Once the salt in the drop achieves 80 percent of its final concentration, further evaporation suffers from the law of diminishing returns.

  17. Rapid and accurate processing method for amide proton exchange rate measurement in proteins

    International Nuclear Information System (INIS)

    Koskela, Harri; Heikkinen, Outi; Kilpelaeinen, Ilkka; Heikkinen, Sami

    2007-01-01

    Exchange between protein backbone amide hydrogen and water gives relevant information about solvent accessibility and protein secondary structure stability. NMR spectroscopy provides a convenient tool to study these dynamic processes with saturation transfer experiments. Processing of this type of NMR spectra has traditionally required peak integration followed by exponential fitting, which can be tedious with large data sets. We propose here a computer-aided method that applies inverse Laplace transform in the exchange rate measurement. With this approach, the determination of exchange rates can be automated, and reliable results can be acquired rapidly without a need for manual processing

  18. Chronic Depressive Symptomatology in Mild Cognitive Impairment Is Associated with Frontal Atrophy Rate which Hastens Conversion to Alzheimer Dementia.

    Science.gov (United States)

    Sacuiu, Simona; Insel, Philip S; Mueller, Susanne; Tosun, Duygu; Mattsson, Niklas; Jack, Clifford R; DeCarli, Charles; Petersen, Ronald; Aisen, Paul S; Weiner, Michael W; Mackin, R Scott

    2016-02-01

    Investigate the association of chronic depressive symptomatology (chrDS) with cortical atrophy rates and conversion to Alzheimer dementia (AD) over 3 years in mild cognitive impairment (MCI). In a multicenter, clinic-based study, MCI elderly participants were selected from the Alzheimer's Disease Neuroimaging Initiative repository, based on availability of both serial structural magnetic resonance imaging and chrDS endorsed on three depression-related items from the Neuropsychiatric Inventory Questionnaire (chrDS N = 32 or no depressive symptoms N = 62) throughout follow-up. Clinical and laboratory investigations were performed every 6 months during the first 2 years and yearly thereafter (median follow-up: 3 years; interquartile range: 1.5-4.0 years). Cortical atrophy rates in 16 predefined frontotemporoparietal regions affected in major depression and AD and the rate of incident AD at follow-up. ChrDS in a single domain amnestic MCI sample were associated with accelerated cortical atrophy in the frontal lobe and anterior cingulate but not with atrophy rates in temporomedial or other AD-affected regions. During follow-up, 38 participants (42.7%) developed AD. Participants with chrDS had 60% shorter conversion time to AD than those without depressive symptoms. This association remained significant in survival models adjusted for temporomedial atrophy rates and showed the same trend in models adjusted for frontal cortical atrophy rate, which all increased the risk of AD. Our results suggest that chrDS associated with progressive atrophy of frontal regions may represent an additional risk factor for conversion to dementia in MCI as opposite to representing typical prodromal AD symptomatology. Published by Elsevier Inc.

  19. Explaining transgression in respiratory rate observation methods in the emergency department: A classic grounded theory analysis.

    Science.gov (United States)

    Flenady, Tracy; Dwyer, Trudy; Applegarth, Judith

    2017-09-01

    Abnormal respiratory rates are one of the first indicators of clinical deterioration in emergency department(ED) patients. Despite the importance of respiratory rate observations, this vital sign is often inaccurately recorded on ED observation charts, compromising patient safety. Concurrently, there is a paucity of research reporting why this phenomenon occurs. To develop a substantive theory explaining ED registered nurses' reasoning when they miss or misreport respiratory rate observations. This research project employed a classic grounded theory analysis of qualitative data. Seventy-nine registered nurses currently working in EDs within Australia. Data collected included detailed responses from individual interviews and open-ended responses from an online questionnaire. Classic grounded theory (CGT) research methods were utilised, therefore coding was central to the abstraction of data and its reintegration as theory. Constant comparison synonymous with CGT methods were employed to code data. This approach facilitated the identification of the main concern of the participants and aided in the generation of theory explaining how the participants processed this issue. The main concern identified is that ED registered nurses do not believe that collecting an accurate respiratory rate for ALL patients at EVERY round of observations is a requirement, and yet organizational requirements often dictate that a value for the respiratory rate be included each time vital signs are collected. The theory 'Rationalising Transgression', explains how participants continually resolve this problem. The study found that despite feeling professionally conflicted, nurses often erroneously record respiratory rate observations, and then rationalise this behaviour by employing strategies that adjust the significance of the organisational requirement. These strategies include; Compensating, when nurses believe they are compensating for errant behaviour by enhancing the patient's outcome

  20. Wavelet denoising method; application to the flow rate estimation for water level control

    International Nuclear Information System (INIS)

    Park, Gee Young; Park, Jin Ho; Lee, Jung Han; Kim, Bong Soo; Seong, Poong Hyun

    2003-01-01

    The wavelet transform decomposes a signal into time- and frequency-domain signals and it is well known that a noise-corrupted signal could be reconstructed or estimated when a proper denoising method is involved in the wavelet transform. Among the wavelet denoising methods proposed up to now, the wavelets by Mallat and Zhong can reconstruct best the pure transient signal from a highly corrupted signal. But there has been no systematic way of discriminating the original signal from the noise in a dyadic wavelet transform. In this paper, a systematic method is proposed for noise discrimination, which could be implemented easily into a digital system. For demonstrating the potential role of the wavelet denoising method in the nuclear field, this method is applied to the steam or feedwater flow rate estimation of the secondary loop. And the configuration of the S/G water level control system is proposed for incorporating the wavelet denoising method in estimating the flow rate value at low operating powers

  1. Advanced methods comparisons of reaction rates in the Purdue Fast Breeder Blanket Facility

    International Nuclear Information System (INIS)

    Hill, R.N.; Ott, K.O.

    1988-01-01

    A review of worldwide results revealed that reaction rates in the blanket region are generally underpredicted with the discrepancy increasing with penetration; however, these results vary widely. Experiments in the large uniform Purdue Fast Breeder Blanket Facility (FBBF) blanket yield an accurate quantification of this discrepancy. Using standard production code methods (diffusion theory with 50 group cross sections), a consistent Calculated/Experimental (C/E) drop-off was observed for various reaction rates. A 50% increase in the calculated results at the outer edge of the blanket is necessary for agreement with experiments. The usefulness of refined group constant generation utilizing specialized weighting spectra and transport theory methods in correcting this discrepancy was analyzed. Refined group constants reduce the discrepancy to half that observed using the standard method. The surprising result was that transport methods had no effect on the blanket deviations; thus, transport theory considerations do not constitute or even contribute to an explanation of the blanket discrepancies. The residual blanket C/E drop-off (about half the standard drop-off) using advanced methods must be caused by some approximations which are applied in all current methods. 27 refs., 3 figs., 1 tab

  2. The assessment of cognitive errors using an observer-rated method.

    Science.gov (United States)

    Drapeau, Martin

    2014-01-01

    Cognitive Errors (CEs) are a key construct in cognitive behavioral therapy (CBT). Integral to CBT is that individuals with depression process information in an overly negative or biased way, and that this bias is reflected in specific depressotypic CEs which are distinct from normal information processing. Despite the importance of this construct in CBT theory, practice, and research, few methods are available to researchers and clinicians to reliably identify CEs as they occur. In this paper, the author presents a rating system, the Cognitive Error Rating Scale, which can be used by trained observers to identify and assess the cognitive errors of patients or research participants in vivo, i.e., as they are used or reported by the patients or participants. The method is described, including some of the more important rating conventions to be considered when using the method. This paper also describes the 15 cognitive errors assessed, and the different summary scores, including valence of the CEs, that can be derived from the method.

  3. Error baseline rates of five sample preparation methods used to characterize RNA virus populations.

    Directory of Open Access Journals (Sweden)

    Jeffrey R Kugelman

    Full Text Available Individual RNA viruses typically occur as populations of genomes that differ slightly from each other due to mutations introduced by the error-prone viral polymerase. Understanding the variability of RNA virus genome populations is critical for understanding virus evolution because individual mutant genomes may gain evolutionary selective advantages and give rise to dominant subpopulations, possibly even leading to the emergence of viruses resistant to medical countermeasures. Reverse transcription of virus genome populations followed by next-generation sequencing is the only available method to characterize variation for RNA viruses. However, both steps may lead to the introduction of artificial mutations, thereby skewing the data. To better understand how such errors are introduced during sample preparation, we determined and compared error baseline rates of five different sample preparation methods by analyzing in vitro transcribed Ebola virus RNA from an artificial plasmid-based system. These methods included: shotgun sequencing from plasmid DNA or in vitro transcribed RNA as a basic "no amplification" method, amplicon sequencing from the plasmid DNA or in vitro transcribed RNA as a "targeted" amplification method, sequence-independent single-primer amplification (SISPA as a "random" amplification method, rolling circle reverse transcription sequencing (CirSeq as an advanced "no amplification" method, and Illumina TruSeq RNA Access as a "targeted" enrichment method. The measured error frequencies indicate that RNA Access offers the best tradeoff between sensitivity and sample preparation error (1.4-5 of all compared methods.

  4. Method for measuring the disintegration rate of a beta-emitting radionuclide in a liquid sample

    International Nuclear Information System (INIS)

    1977-01-01

    A method of measuring the distintegration rate of a beta-emitting radionuclide in a liquid sample by counting at least two differently quenched versions of the sample. In each counting operation the sample is counted in the presence of and in the absence of a standard radioactive source. A pulse height (PH) corresponding to a unique point on the pulse height spectrum generated in the presence of the standard is determined. A zero threshold sample count rate (CPM) is derived by counting the sample once in a counting window having a zero threshold lower limit. Normalized values of the measured pulse heights (PH) are developed and correlated with the corresponding counts (CPM) to determine the pulse count for a normalized pulse height value of zero and hence the sample disintegration rate

  5. Count rate balance method of measuring sediment transport of sand beds by radioactive tracers

    International Nuclear Information System (INIS)

    Sauzay, G.

    1968-01-01

    Radioactive tracers are applied to the direct measurement of the sediment transport rate of sand beds. The theoretical measurement formula is derived: the variation of the count rate balance is inverse of that of the transport thickness. Simultaneously the representativeness of the tracer is critically studied. The minimum quantity of tracer which has to be injected in order to obtain a correct statistical definition of count rate given by a low number of grains 'seen' by the detector is then studied. A field experiment was made and has let to study the technological conditions for applying this method: only the treatment of results is new, the experiment itself is carried out with conventional techniques applied with great care. (author) [fr

  6. A study on measurement on artificial radiation dose rate using the response matrix method

    International Nuclear Information System (INIS)

    Kidachi, Hiroshi; Ishikawa, Yoichi; Konno, Tatsuya

    2004-01-01

    We examined accuracy and stability of estimated artificial dose contribution which is distinguished from natural background gamma-ray dose rate using Response Matrix method. Irradiation experiments using artificial gamma-ray sources indicated that there was a linear relationship between observed dose rate and estimated artificial dose contribution, when irradiated artificial gamma-ray dose rate was higher than about 2 nGy/h. Statistical and time-series analyses of long term data made it clear that estimated artificial contribution showed almost constant values under no artificial influence from the nuclear power plants. However, variations of estimated artificial dose contribution were infrequently observed due to of rainfall, detector maintenance operation and occurrence of calibration error. Some considerations on the factors to these variations were made. (author)

  7. A method for estimating failure rates for low probability events arising in PSA

    International Nuclear Information System (INIS)

    Thorne, M.C.; Williams, M.M.R.

    1995-01-01

    The authors develop a method for predicting failure rates and failure probabilities per event when, over a given test period or number of demands, no failures have occurred. A Bayesian approach is adopted to calculate a posterior probability distribution for the failure rate or failure probability per event subsequent to the test period. This posterior is then used to estimate effective failure rates or probabilities over a subsequent period of time or number of demands. In special circumstances, the authors results reduce to the well-known rules of thumb, viz: 1/N and 1/T, where N is the number of demands during the test period for no failures and T is the test period for no failures. However, the authors are able to give strict conditions on the validity of these rules of thumb and to improve on them when necessary

  8. Efficient quantum-classical method for computing thermal rate constant of recombination: application to ozone formation.

    Science.gov (United States)

    Ivanov, Mikhail V; Babikov, Dmitri

    2012-05-14

    Efficient method is proposed for computing thermal rate constant of recombination reaction that proceeds according to the energy transfer mechanism, when an energized molecule is formed from reactants first, and is stabilized later by collision with quencher. The mixed quantum-classical theory for the collisional energy transfer and the ro-vibrational energy flow [M. Ivanov and D. Babikov, J. Chem. Phys. 134, 144107 (2011)] is employed to treat the dynamics of molecule + quencher collision. Efficiency is achieved by sampling simultaneously (i) the thermal collision energy, (ii) the impact parameter, and (iii) the incident direction of quencher, as well as (iv) the rotational state of energized molecule. This approach is applied to calculate third-order rate constant of the recombination reaction that forms the (16)O(18)O(16)O isotopomer of ozone. Comparison of the predicted rate vs. experimental result is presented.

  9. Method of measuring the disinteration rate of beta-emitting radionuclide in a liquid sample

    International Nuclear Information System (INIS)

    Horrocks, D.L.

    1977-01-01

    A method of measuring the disintegration rate of a beta-emitting radionuclide in a liquid sample by counting at least two differently quenched versions of the sample is described. In each counting operation the sample is counted in the presence of and in the absence of a standard radioactive source. A pulse height (PH) corresponding to a unique point on the pulse height spectrum generated in the presence of the standard is determined. A zero threshold sample count rate (CPM) is derived by counting the sample once in a counting window having a zero threshold lower limit. Normalized values of the measured pulse heights (PH) are developed and correlated with the corresponding pulse counts (CPM) to determine the pulse count for a normalized pulse height value of zero and hence the sample disintegration rate

  10. Evaluation and comparison of estimation methods for failure rates and probabilities

    Energy Technology Data Exchange (ETDEWEB)

    Vaurio, Jussi K. [Fortum Power and Heat Oy, P.O. Box 23, 07901 Loviisa (Finland)]. E-mail: jussi.vaurio@fortum.com; Jaenkaelae, Kalle E. [Fortum Nuclear Services, P.O. Box 10, 00048 Fortum (Finland)

    2006-02-01

    An updated parametric robust empirical Bayes (PREB) estimation methodology is presented as an alternative to several two-stage Bayesian methods used to assimilate failure data from multiple units or plants. PREB is based on prior-moment matching and avoids multi-dimensional numerical integrations. The PREB method is presented for failure-truncated and time-truncated data. Erlangian and Poisson likelihoods with gamma prior are used for failure rate estimation, and Binomial data with beta prior are used for failure probability per demand estimation. Combined models and assessment uncertainties are accounted for. One objective is to compare several methods with numerical examples and show that PREB works as well if not better than the alternative more complex methods, especially in demanding problems of small samples, identical data and zero failures. False claims and misconceptions are straightened out, and practical applications in risk studies are presented.

  11. Meta-analytic methods for pooling rates when follow-up duration varies: a case study

    Directory of Open Access Journals (Sweden)

    Wolf Fredric M

    2004-07-01

    Full Text Available Abstract Background Meta-analysis can be used to pool rate measures across studies, but challenges arise when follow-up duration varies. Our objective was to compare different statistical approaches for pooling count data of varying follow-up times in terms of estimates of effect, precision, and clinical interpretability. Methods We examined data from a published Cochrane Review of asthma self-management education in children. We selected two rate measures with the largest number of contributing studies: school absences and emergency room (ER visits. We estimated fixed- and random-effects standardized weighted mean differences (SMD, stratified incidence rate differences (IRD, and stratified incidence rate ratios (IRR. We also fit Poisson regression models, which allowed for further adjustment for clustering by study. Results For both outcomes, all methods gave qualitatively similar estimates of effect in favor of the intervention. For school absences, SMD showed modest results in favor of the intervention (SMD -0.14, 95% CI -0.23 to -0.04. IRD implied that the intervention reduced school absences by 1.8 days per year (IRD -0.15 days/child-month, 95% CI -0.19 to -0.11, while IRR suggested a 14% reduction in absences (IRR 0.86, 95% CI 0.83 to 0.90. For ER visits, SMD showed a modest benefit in favor of the intervention (SMD -0.27, 95% CI: -0.45 to -0.09. IRD implied that the intervention reduced ER visits by 1 visit every 2 years (IRD -0.04 visits/child-month, 95% CI: -0.05 to -0.03, while IRR suggested a 34% reduction in ER visits (IRR 0.66, 95% CI 0.59 to 0.74. In Poisson models, adjustment for clustering lowered the precision of the estimates relative to stratified IRR results. For ER visits but not school absences, failure to incorporate study indicators resulted in a different estimate of effect (unadjusted IRR 0.77, 95% CI 0.59 to 0.99. Conclusions Choice of method among the ones presented had little effect on inference but affected the

  12. Shutdown Dose Rate Analysis Using the Multi-Step CADIS Method

    International Nuclear Information System (INIS)

    Ibrahim, Ahmad M.; Peplow, Douglas E.; Peterson, Joshua L.; Grove, Robert E.

    2015-01-01

    The Multi-Step Consistent Adjoint Driven Importance Sampling (MS-CADIS) hybrid Monte Carlo (MC)/deterministic radiation transport method was proposed to speed up the shutdown dose rate (SDDR) neutron MC calculation using an importance function that represents the neutron importance to the final SDDR. This work applied the MS-CADIS method to the ITER SDDR benchmark problem. The MS-CADIS method was also used to calculate the SDDR uncertainty resulting from uncertainties in the MC neutron calculation and to determine the degree of undersampling in SDDR calculations because of the limited ability of the MC method to tally detailed spatial and energy distributions. The analysis that used the ITER benchmark problem compared the efficiency of the MS-CADIS method to the traditional approach of using global MC variance reduction techniques for speeding up SDDR neutron MC calculation. Compared to the standard Forward-Weighted-CADIS (FW-CADIS) method, the MS-CADIS method increased the efficiency of the SDDR neutron MC calculation by 69%. The MS-CADIS method also increased the fraction of nonzero scoring mesh tally elements in the space-energy regions of high importance to the final SDDR

  13. An experimental comparison of three wire beam electrode based methods for determining corrosion rates and patterns

    International Nuclear Information System (INIS)

    Tan, Y.-J.

    2005-01-01

    Laboratory experiments have been carried out to examine the advantages and limitations of three wire beam electrode (WBE) based techniques, including the noise resistance R n -WBE method, the overpotential-galvanic current method, and the galvanic current method, in determining corrosion rates and patterns. These techniques have been applied simultaneously to several selected corrosion systems of different characteristics. It has been found that the R n -WBE method has advantages over other WBE based methods when applying to WBE surfaces under uniform corrosion. However, the R n -WBE method has been found to be unsuitable for low noise level corrosion systems. It has also been found that both R n -WBE and overpotential-galvanic current methods are similarly applicable to WBE surfaces under nonuniform corrosion. However, the galvanic current method has been found to be suitable only for WBE surfaces under highly localised corrosion. Some related issues regarding R n calculation such as trend removal and its effects on corrosion mapping have also been discussed

  14. Ultrasonic 3-D Vector Flow Method for Quantitative In Vivo Peak Velocity and Flow Rate Estimation

    DEFF Research Database (Denmark)

    Holbek, Simon; Ewertsen, Caroline; Bouzari, Hamed

    2017-01-01

    Current clinical ultrasound (US) systems are limited to show blood flow movement in either 1-D or 2-D. In this paper, a method for estimating 3-D vector velocities in a plane using the transverse oscillation method, a 32×32 element matrix array, and the experimental US scanner SARUS is presented...... is validated in two phantom studies, where flow rates are measured in a flow-rig, providing a constant parabolic flow, and in a straight-vessel phantom ( ∅=8 mm) connected to a flow pump capable of generating time varying waveforms. Flow rates are estimated to be 82.1 ± 2.8 L/min in the flow-rig compared...

  15. Efficient kinetic Monte Carlo method for reaction-diffusion problems with spatially varying annihilation rates

    Science.gov (United States)

    Schwarz, Karsten; Rieger, Heiko

    2013-03-01

    We present an efficient Monte Carlo method to simulate reaction-diffusion processes with spatially varying particle annihilation or transformation rates as it occurs for instance in the context of motor-driven intracellular transport. Like Green's function reaction dynamics and first-passage time methods, our algorithm avoids small diffusive hops by propagating sufficiently distant particles in large hops to the boundaries of protective domains. Since for spatially varying annihilation or transformation rates the single particle diffusion propagator is not known analytically, we present an algorithm that generates efficiently either particle displacements or annihilations with the correct statistics, as we prove rigorously. The numerical efficiency of the algorithm is demonstrated with an illustrative example.

  16. Increasing recruitment rates in an inpatient clinical research study using quality improvement methods.

    Science.gov (United States)

    Sauers, Hadley S; Beck, Andrew F; Kahn, Robert S; Simmons, Jeffrey M

    2014-11-01

    One important benefit of successful patient recruitment is increased generalizability of findings. We sought to optimize enrollment of children admitted with asthma as part of a population-based, prospective, observational cohort study with the goal of enrolling at least 60% of all eligible and staffed patients. Quality improvement methods were used to improve cohort recruitment. Weekly meetings with study staff and study leadership were held to plan and discuss how to maximize recruitment rates. Significant initial variability in recruitment success prompted the team to use small-scale tests of change to increase recruitment numbers. A number of tests were trialed, focusing primarily on reducing patient refusals and improving recruitment process efficiency. Recruitment rates were calculated by dividing eligible by enrolled patients and displayed using annotated Shewhart control charts. Control charts were used to illustrate week-to-week variability while also enabling differentiation of common-cause and special-cause variation. The study enrolled 774 patients, representing 54% of all eligible and 59% of those eligible for whom staff were available to enroll. Our mean weekly recruitment rate increased from 55% during the first 3 months of the study to a statistically significant sustained rate of 61%. This was sustained given numerous obstacles, such as departing and hiring of staff and adding a second recruitment location. Implementing quality improvement methods within a larger research study led to an increase in the rate of recruitment as well as the stability in recruitment rates from week-to-week. Copyright © 2014 by the American Academy of Pediatrics.

  17. Classical Wigner method with an effective quantum force: application to reaction rates.

    Science.gov (United States)

    Poulsen, Jens Aage; Li, Huaqing; Nyman, Gunnar

    2009-07-14

    We construct an effective "quantum force" to be used in the classical molecular dynamics part of the classical Wigner method when determining correlation functions. The quantum force is obtained by estimating the most important short time separation of the Feynman paths that enter into the expression for the correlation function. The evaluation of the force is then as easy as classical potential energy evaluations. The ideas are tested on three reaction rate problems. The resulting transmission coefficients are in much better agreement with accurate results than transmission coefficients from the ordinary classical Wigner method.

  18. Testing an Adapted Modified Delphi Method: Synthesizing Multiple Stakeholder Ratings of Health Care Service Effectiveness.

    Science.gov (United States)

    Escaron, Anne L; Chang Weir, Rosy; Stanton, Petra; Vangala, Sitaram; Grogan, Tristan R; Clarke, Robin M

    2016-03-01

    The Affordable Care Act incentivizes health systems for better meeting patient needs, but often guidance about patient preferences for particular health services is limited. All too often vulnerable patient populations are excluded from these decision-making settings. A community-based participatory approach harnesses the in-depth knowledge of those experiencing barriers to health care. We made three modifications to the RAND-UCLA appropriateness method, a modified Delphi approach, involving patients, adding an advisory council group to characterize existing knowledge in this little studied area, and using effectiveness rather than "appropriateness" as the basis for rating. As a proof of concept, we tested this method by examining the broadly delivered but understudied nonmedical services that community health centers provide. This method created discrete, new knowledge about these services by defining 6 categories and 112 unique services and by prioritizing among these services based on effectiveness using a 9-point scale. Consistent with the appropriateness method, we found statistical convergence of ratings among the panelists. Challenges include time commitment and adherence to a clear definition of effectiveness of services. This diverse stakeholder engagement method efficiently addresses gaps in knowledge about the effectiveness of health care services to inform population health management. © 2015 Society for Public Health Education.

  19. A GPS Satellite Clock Offset Prediction Method Based on Fitting Clock Offset Rates Data

    Directory of Open Access Journals (Sweden)

    WANG Fuhong

    2016-12-01

    Full Text Available It is proposed that a satellite atomic clock offset prediction method based on fitting and modeling clock offset rates data. This method builds quadratic model or linear model combined with periodic terms to fit the time series of clock offset rates, and computes the model coefficients of trend with the best estimation. The clock offset precisely estimated at the initial prediction epoch is directly adopted to calculate the model coefficient of constant. The clock offsets in the rapid ephemeris (IGR provided by IGS are used as modeling data sets to perform certain experiments for different types of GPS satellite clocks. The results show that the clock prediction accuracies of the proposed method for 3, 6, 12 and 24 h achieve 0.43, 0.58, 0.90 and 1.47 ns respectively, which outperform the traditional prediction method based on fitting original clock offsets by 69.3%, 61.8%, 50.5% and 37.2%. Compared with the IGU real-time clock products provided by IGS, the prediction accuracies of the new method have improved about 15.7%, 23.7%, 27.4% and 34.4% respectively.

  20. A prediction method for the wax deposition rate based on a radial basis function neural network

    Directory of Open Access Journals (Sweden)

    Ying Xie

    2017-06-01

    Full Text Available The radial basis function neural network is a popular supervised learning tool based on machinery learning technology. Its high precision having been proven, the radial basis function neural network has been applied in many areas. The accumulation of deposited materials in the pipeline may lead to the need for increased pumping power, a decreased flow rate or even to the total blockage of the line, with losses of production and capital investment, so research on predicting the wax deposition rate is significant for the safe and economical operation of an oil pipeline. This paper adopts the radial basis function neural network to predict the wax deposition rate by considering four main influencing factors, the pipe wall temperature gradient, pipe wall wax crystal solubility coefficient, pipe wall shear stress and crude oil viscosity, by the gray correlational analysis method. MATLAB software is employed to establish the RBF neural network. Compared with the previous literature, favorable consistency exists between the predicted outcomes and the experimental results, with a relative error of 1.5%. It can be concluded that the prediction method of wax deposition rate based on the RBF neural network is feasible.

  1. A Comparison of Affect Ratings Obtained with Ecological Momentary Assessment and the Day Reconstruction Method

    Science.gov (United States)

    Dockray, Samantha; Grant, Nina; Stone, Arthur A.; Kahneman, Daniel; Wardle, Jane

    2010-01-01

    Measurement of affective states in everyday life is of fundamental importance in many types of quality of life, health, and psychological research. Ecological momentary assessment (EMA) is the recognized method of choice, but the respondent burden can be high. The day reconstruction method (DRM) was developed by Kahneman and colleagues (Science, 2004, 306, 1776–1780) to assess affect, activities and time use in everyday life. We sought to validate DRM affect ratings by comparison with contemporaneous EMA ratings in a sample of 94 working women monitored over work and leisure days. Six EMA ratings of happiness, tiredness, stress, and anger/frustration were obtained over each 24 h period, and were compared with DRM ratings for the same hour, recorded retrospectively at the end of the day. Similar profiles of affect intensity were recorded with the two techniques. The between-person correlations adjusted for attenuation ranged from 0.58 (stress, working day) to 0.90 (happiness, leisure day). The strength of associations was not related to age, educational attainment, or depressed mood. We conclude that the DRM provides reasonably reliable estimates both of the intensity of affect and variations in affect over the day, so is a valuable instrument for the measurement of everyday experience in health and social research. PMID:21113328

  2. Combining Unsupervised and Supervised Statistical Learning Methods for Currency Exchange Rate Forecasting

    OpenAIRE

    Vasiljeva, Polina

    2016-01-01

    In this thesis we revisit the challenging problem of forecasting currency exchange rate. We combine machine learning methods such as agglomerative hierarchical clustering and random forest to construct a two-step approach for predicting movements in currency exchange prices of the Swedish krona and the US dollar. We use a data set with over 200 predictors comprised of different financial and macro-economic time series and their transformations. We perform forecasting for one week ahead with d...

  3. Taguchi Method for Development of Mass Flow Rate Correlation Using Hydrocarbon Refrigerant Mixture in Capillary Tube

    OpenAIRE

    Sulaimon, Shodiya; Nasution, Henry; Aziz, Azhar Abdul; Abdul-Rahman, Abdul-Halim; Darus, Amer N

    2014-01-01

    The capillary tube is an important control device used in small vapor compression refrigeration systems such as window air-conditioners, household refrigerators and freezers. This paper develops a non-dimensional correlation based on the test results of the adiabatic capillary tube for the mass flow rate through the tube using a hydrocarbon refrigerant mixture of 89.3% propane and 10.7% butane (HCM). The Taguchi method, a statistical experimental design approach, was employed. This approach e...

  4. Covariance methodology applied to 35S disintegration rate measurements by the CIEMAT/NIST method

    International Nuclear Information System (INIS)

    Koskinas, M.F.; Nascimento, T.S.; Yamazaki, I.M.; Dias, M.S.

    2014-01-01

    The Nuclear Metrology Laboratory (LMN) at IPEN is carrying out measurements in a LSC (Liquid Scintillation Counting system), applying the CIEMAT/NIST method. In this context 35 S is an important radionuclide for medical applications and it is difficult to be standardized by other primary methods due to low beta ray energy. The CIEMAT/NIST is a standard technique used by most metrology laboratories in order to improve accuracy and speed up beta emitter standardization. The focus of the present work was to apply the covariance methodology for determining the overall uncertainty in the 35 S disintegration rate. All partial uncertainties involved in the measurements were considered, taking into account all possible correlations between each pair of them. - Highlights: ► 35 S disintegration rate measured in Liquid Scintillator system using CIEMAT/NIST method. ► Covariance methodology applied to the overall uncertainty in the 35 S disintegration rate. ► Monte Carlo simulation was applied to determine 35 S activity in the 4πβ(PC)-γ coincidence system

  5. Identification of strain-rate and thermal sensitive material model with an inverse method

    Directory of Open Access Journals (Sweden)

    Peroni M.

    2010-06-01

    Full Text Available This paper describes a numerical inverse method to extract material strength parameters from the experimental data obtained via mechanical tests at different strainrates and temperatures. It will be shown that this procedure is particularly useful to analyse experimental results when the stress-strain fields in the specimen cannot be correctly described via analytical models. This commonly happens in specimens with no regular shape, in specimens with a regular shape when some instability phenomena occur (for example the necking phenomena in tensile tests that create a strongly heterogeneous stress-strain fields or in dynamic tests (where the strain-rate field is not constant due to wave propagation phenomena. Furthermore the developed procedure is useful to take into account thermal phenomena generally affecting high strain-rate tests due to the adiabatic overheating related to the conversion of plastic work. The method presented requires strong effort both from experimental and numerical point of view, anyway it allows to precisely identify the parameters of different material models. This could provide great advantages when high reliability of the material behaviour is necessary. Applicability of this method is particularly indicated for special applications in the field of aerospace engineering, ballistic, crashworthiness studies or particle accelerator technologies, where materials could be submitted to strong plastic deformations at high-strain rate in a wide range of temperature. Thermal softening effect has been investigated in a temperature range between 20°C and 1000°C.

  6. Inverse method for determining radon diffusion coefficient and free radon production rate of fragmented uranium ore

    International Nuclear Information System (INIS)

    Ye, Yong-jun; Wang, Li-heng; Ding, De-xin; Zhao, Ya-li; Fan, Nan-bin

    2014-01-01

    The radon diffusion coefficient and the free radon production rate are important parameters for describing radon migration in the fragmented uranium ore. In order to determine the two parameters, the pure diffusion migration equation for radon was firstly established and its analytic solution with the two parameters to be determined was derived. Then, a self manufactured experimental column was used to simulate the pure diffusion of the radon, the improved scintillation cell method was used to measure the pore radon concentrations at different depths of the column loaded with the fragmented uranium ore, and the nonlinear least square algorithm was used to inversely determine the radon diffusion coefficient and the free radon production rate. Finally, the solution with the two inversely determined parameters was used to predict the pore radon concentrations at some depths of the column, and the predicted results were compared with the measured results. The results show that the predicted results are in good agreement with the measured results and the numerical inverse method is applicable to the determination of the radon diffusion coefficient and the free radon production rate for the fragmented uranium ore. - Highlights: • Inverse method for determining two transport parameters of radon is proposed. • A self-made experimental apparatus is used to simulate radon diffusion process. • Sampling volume and position for measuring radon concentration are optimized. • The inverse results of an experimental sample are verified

  7. Novel driver method to improve ordinary CCD frame rate for high-speed imaging diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Tong-Ding, E-mail: snuohui@126.com; Li, Bin-Kang; Yang, Shao-Hua; Guo, Ming-An; Yan, Ming

    2016-06-21

    The use of ordinary Charge-coupled-Device (CCD) imagers for the analysis of fast physical phenomenon is restricted because of the low-speed performance resulting from their long output times. Even though the form of Intensified-CCD (ICCD), coupled with a gated image intensifier, has extended their use for high speed imaging, the deficiency remains to be solved that ICDD could record only one image in a single shot. This paper presents a novel driver method designed to significantly improve the ordinary interline CCD burst frame rate for high-speed photography. This method is based on the use of vertical registers as storage, so that a small number of additional frames comprised of reduced-spatial-resolution images obtained via a specific sampling operation can be buffered. Hence, the interval time of the received series of images is related to the exposure and vertical transfer times only and, thus, the burst frame rate can be increased significantly. A prototype camera based on this method is designed as part of this study, exhibiting a burst rate of up to 250,000 frames per second (fps) and a capacity to record three continuous images. This device exhibits a speed enhancement of approximately 16,000 times compared with the conventional speed, with a spatial resolution reduction of only 1/4.

  8. Effect of the irradiation of bacteria upon their survival rate during conventional methods of meat preservation

    International Nuclear Information System (INIS)

    Szczawinska, M.

    1981-01-01

    The purpose of this paper is to define the effect of irradiation upon the survival rate of non-sporing bacteria (Staphylococcus aureus, Salmonella typhimurium, Escherichia coli, Pseudomonas fluorescens) during basic methods of meat preservation. The bacteria were irradiated in broth by X-rays at a dose that destroyed about 90% of the bacteria (D 10 ). The survival rate of unirradiated and irradiated bacteria during cooling and freezing, in solutions of sodium chloride, nitrates and liquid smoke, was defined. The number of microorganisms was determined directly after irradiation as well as 1, 3, 7, 14, 21 and 28 days after irradiation. The effect of irradiation upon heat resistance of the examined species of bacteria was also defined. The microorganisms were heated in broth, at 70 0 C for 1, 2 and 5 minutes. The obtained results were subjected to statistical analysis. On the basis of the research results, a faster dying rate of irradiated populations of S. aureus and E. coli during any type of preservation treatment, the lack of any reaction to irradiation regarding the survival rate of S. typhimurium, and the lack of any effect of irradiation upon the rate of deterioration of P. fluorescens during freezing and storage in a solution with 10% addition of NaCI, were observed. On the other hand, a pronounced effect of irradiation upon the lowering of the heat resistance of the bacteria, as well as delayed growth in other variants of the experiment, was determined. (author)

  9. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Niobium

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method describes procedures for measuring reaction rates by the activation reaction 93Nb(n,n′)93mNb. 1.2 This activation reaction is useful for monitoring neutrons with energies above approximately 0.5 MeV and for irradiation times up to about 30 years. 1.3 With suitable techniques, fast-neutron reaction rates for neutrons with energy distribution similar to fission neutrons can be determined in fast-neutron fluences above about 1016cm−2. In the presence of high thermal-neutron fluence rates (>1012cm−2·s−1), the transmutation of 93mNb due to neutron capture should be investigated. In the presence of high-energy neutron spectra such as are associated with fusion and spallation sources, the transmutation of 93mNb by reactions such as (n,2n) may occur and should be investigated. 1.4 Procedures for other fast-neutron monitors are referenced in Practice E 261. 1.5 Fast-neutron fluence rates can be determined from the reaction rates provided that the appropriate cross section information ...

  10. Semiempirical method of determining flow coefficients for pitot rake mass flow rate measurements

    Science.gov (United States)

    Trefny, C. J.

    1985-01-01

    Flow coefficients applicable to area-weighted pitot rake mass flow rate measurements are presented for fully developed, turbulent flow in an annulus. A turbulent velocity profile is generated semiempirically for a given annulus hub-to-tip radius ratio and integrated numerically to determine the ideal mass flow rate. The calculated velocities at each probe location are then summed, and the flow rate as indicated by the rake is obtained. The flow coefficient to be used with the particular rake geometry is subsequently obtained by dividing the ideal flow rate by the rake-indicated flow rate. Flow coefficients ranged from 0.903 for one probe placed at a radius dividing two equal areas to 0.984 for a 10-probe area-weighted rake. Flow coefficients were not a strong function of annulus hub-to-tip radius ratio for rakes with three or more probes. The semiempirical method used to generate the turbulent velocity profiles is described in detail.

  11. Method and apparatus for simultaneous determination of fluid mass flow rate, mean velocity and density

    International Nuclear Information System (INIS)

    Hamel, W.R.

    1984-01-01

    This invention relates to a new method and new apparatus for determining fluid mass flow rate and density. In one aspect of the invention, the fluid is passed through a straight cantilevered tube in which transient oscillation has been induced, thus generating Coriolis damping forces on the tube. The decay rate and frequency of the resulting damped oscillation are measured, and the fluid mass flow rate and density are determined therefrom. In another aspect of the invention, the fluid is passed through the cantilevered tube while an electrically powered device imparts steady-state harmonic excitation to the tube. This generates Coriolis tube-damping forces which are dependent on the mass flow rate of the fluid. Means are provided to respond to incipient flow-induced changes in the amplitude of vibration by changing the power input to the excitation device as required to sustain the original amplitude of vibration. The fluid mass flow rate and density are determined from the required change in power input. The invention provides stable, rapid, and accurate measurements. It does not require bending of the fluid flow

  12. Environmental dose rate assessment of ITER using the Monte Carlo method

    Directory of Open Access Journals (Sweden)

    Karimian Alireza

    2014-01-01

    Full Text Available Exposure to radiation is one of the main sources of risk to staff employed in reactor facilities. The staff of a tokamak is exposed to a wide range of neutrons and photons around the tokamak hall. The International Thermonuclear Experimental Reactor (ITER is a nuclear fusion engineering project and the most advanced experimental tokamak in the world. From the radiobiological point of view, ITER dose rates assessment is particularly important. The aim of this study is the assessment of the amount of radiation in ITER during its normal operation in a radial direction from the plasma chamber to the tokamak hall. To achieve this goal, the ITER system and its components were simulated by the Monte Carlo method using the MCNPX 2.6.0 code. Furthermore, the equivalent dose rates of some radiosensitive organs of the human body were calculated by using the medical internal radiation dose phantom. Our study is based on the deuterium-tritium plasma burning by 14.1 MeV neutron production and also photon radiation due to neutron activation. As our results show, the total equivalent dose rate on the outside of the bioshield wall of the tokamak hall is about 1 mSv per year, which is less than the annual occupational dose rate limit during the normal operation of ITER. Also, equivalent dose rates of radiosensitive organs have shown that the maximum dose rate belongs to the kidney. The data may help calculate how long the staff can stay in such an environment, before the equivalent dose rates reach the whole-body dose limits.

  13. Meta-analytic methods for pooling rates when follow-up duration varies: a case study.

    Science.gov (United States)

    Guevara, James P; Berlin, Jesse A; Wolf, Fredric M

    2004-07-12

    Meta-analysis can be used to pool rate measures across studies, but challenges arise when follow-up duration varies. Our objective was to compare different statistical approaches for pooling count data of varying follow-up times in terms of estimates of effect, precision, and clinical interpretability. We examined data from a published Cochrane Review of asthma self-management education in children. We selected two rate measures with the largest number of contributing studies: school absences and emergency room (ER) visits. We estimated fixed- and random-effects standardized weighted mean differences (SMD), stratified incidence rate differences (IRD), and stratified incidence rate ratios (IRR). We also fit Poisson regression models, which allowed for further adjustment for clustering by study. For both outcomes, all methods gave qualitatively similar estimates of effect in favor of the intervention. For school absences, SMD showed modest results in favor of the intervention (SMD -0.14, 95% CI -0.23 to -0.04). IRD implied that the intervention reduced school absences by 1.8 days per year (IRD -0.15 days/child-month, 95% CI -0.19 to -0.11), while IRR suggested a 14% reduction in absences (IRR 0.86, 95% CI 0.83 to 0.90). For ER visits, SMD showed a modest benefit in favor of the intervention (SMD -0.27, 95% CI: -0.45 to -0.09). IRD implied that the intervention reduced ER visits by 1 visit every 2 years (IRD -0.04 visits/child-month, 95% CI: -0.05 to -0.03), while IRR suggested a 34% reduction in ER visits (IRR 0.66, 95% CI 0.59 to 0.74). In Poisson models, adjustment for clustering lowered the precision of the estimates relative to stratified IRR results. For ER visits but not school absences, failure to incorporate study indicators resulted in a different estimate of effect (unadjusted IRR 0.77, 95% CI 0.59 to 0.99). Choice of method among the ones presented had little effect on inference but affected the clinical interpretability of the findings. Incidence rate

  14. Reproducibility of CSF quantitative culture methods for estimating rate of clearance in cryptococcal meningitis.

    Science.gov (United States)

    Dyal, Jonathan; Akampurira, Andrew; Rhein, Joshua; Morawski, Bozena M; Kiggundu, Reuben; Nabeta, Henry W; Musubire, Abdu K; Bahr, Nathan C; Williams, Darlisha A; Bicanic, Tihana; Larsen, Robert A; Meya, David B; Boulware, David R

    2016-05-01

    Quantitative cerebrospinal fluid (CSF) cultures provide a measure of disease severity in cryptococcal meningitis. The fungal clearance rate by quantitative cultures has become a primary endpoint for phase II clinical trials. This study determined the inter-assay accuracy of three different quantitative culture methodologies. Among 91 participants with meningitis symptoms in Kampala, Uganda, during August-November 2013, 305 CSF samples were prospectively collected from patients at multiple time points during treatment. Samples were simultaneously cultured by three methods: (1) St. George's 100 mcl input volume of CSF with five 1:10 serial dilutions, (2) AIDS Clinical Trials Group (ACTG) method using 1000, 100, 10 mcl input volumes, and two 1:100 dilutions with 100 and 10 mcl input volume per dilution on seven agar plates; and (3) 10 mcl calibrated loop of undiluted and 1:100 diluted CSF (loop). Quantitative culture values did not statistically differ between St. George-ACTG methods (P= .09) but did for St. George-10 mcl loop (Pmethods was high (r≥0.88). For detecting sterility, the ACTG-method had the highest negative predictive value of 97% (91% St. George, 60% loop), but the ACTG-method had occasional (∼10%) difficulties in quantification due to colony clumping. For CSF clearance rate, St. George-ACTG methods did not differ overall (mean -0.05 ± 0.07 log10CFU/ml/day;P= .14) on a group level; however, individual-level clearance varied. The St. George and ACTG quantitative CSF culture methods produced comparable but not identical results. Quantitative cultures can inform treatment management strategies. © The Author 2016. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency

    NARCIS (Netherlands)

    Prins, M.; van Leeuwen, M.W.; Teske, E.

    2009-01-01

    Tijdschr Diergeneeskd. 2009 Apr 1;134(7):272-8. Stability and reproducibility of ADVIA 120-measured red blood cell and platelet parameters in dogs, cats, and horses, and the use of reticulocyte haemoglobin content (CH(R)) in the diagnosis of iron deficiency. Prins M, van Leeuwen MW, Teske E.

  16. Improving the singles rate method for modeling accidental coincidences in high-resolution PET

    International Nuclear Information System (INIS)

    Oliver, Josep F; Rafecas, Magdalena

    2010-01-01

    Random coincidences ('randoms') are one of the main sources of image degradation in PET imaging. In order to correct for this effect, an accurate method to estimate the contribution of random events is necessary. This aspect becomes especially relevant for high-resolution PET scanners where the highest image quality is sought and accurate quantitative analysis is undertaken. One common approach to estimate randoms is the so-called singles rate method (SR) widely used because of its good statistical properties. SR is based on the measurement of the singles rate in each detector element. However, recent studies suggest that SR systematically overestimates the correct random rate. This overestimation can be particularly marked for low energy thresholds, below 250 keV used in some applications and could entail a significant image degradation. In this work, we investigate the performance of SR as a function of the activity, geometry of the source and energy acceptance window used. We also investigate the performance of an alternative method, which we call 'singles trues' (ST) that improves SR by properly modeling the presence of true coincidences in the sample. Nevertheless, in any real data acquisition the knowledge of which singles are members of a true coincidence is lost. Therefore, we propose an iterative method, STi, that provides an estimation based on ST but which only requires the knowledge of measurable quantities: prompts and singles. Due to inter-crystal scatter, for wide energy windows ST only partially corrects SR overestimations. While SR deviations are in the range 86-300% (depending on the source geometry), the ST deviations are systematically smaller and contained in the range 4-60%. STi fails to reproduce the ST results, although for not too high activities the deviation with respect to ST is only a few percent. For conventional energy windows, i.e. those without inter-crystal scatter, the ST method corrects the SR overestimations, and deviations from

  17. Application of accelerated evaluation method of alteration temperature and constant dose rate irradiation on bipolar linear regulator LM317

    International Nuclear Information System (INIS)

    Deng Wei; Wu Xue; Wang Xin; Zhang Jinxin; Zhang Xiaofu; Zheng Qiwen; Ma Wuying; Lu Wu; Guo Qi; He Chengfa

    2014-01-01

    With different irradiation methods including high dose rate irradiation, low dose rate irradiation, alteration temperature and constant dose rate irradiation, and US military standard constant high temperature and constant dose rate irradiation, the ionizing radiation responses of bipolar linear regulator LM317 from three different companies were investigated under the operating and zero biases. The results show that compared with constant high temperature and constant dose rate irradiation method, the alteration temperature and constant dose rate irradiation method can not only very rapidly and accurately evaluate the dose rate effect of three bipolar linear regulators, but also well simulate the damage of low dose rate irradiation. Experiment results make the alteration temperature and constant dose rate irradiation method successfully apply to bipolar linear regulator. (authors)

  18. 76 FR 36857 - Federal Employees Health Benefits Program: New Premium Rating Method for Most Community Rated Plans

    Science.gov (United States)

    2011-06-23

    ... contingency reserve accounts or factored into reduced premiums for enrollees in the following plan year. Under...-TCR community rated plans' contingency reserves. Issuers failing to meet the FEHB-specific MLR... definition of medical loss ratio by HHS in December 2010, upon which this rule relies. Further, plans have...

  19. 77 FR 19522 - Federal Employees Health Benefits Program: New Premium Rating Method for Most Community Rated Plans

    Science.gov (United States)

    2012-04-02

    ... reconciliation process itself once applied. Additionally, the commenter would like to understand the roles of OPM... methodology unless doing so conflicts with the FEHB contract. Changes Made Since the Interim Final Rule Was... Accounting and price adjustment. * * * * * (b) * * * (4) If rates are determined by comparison with the FEHB...

  20. Methods for monitoring corals and crustose coralline algae to quantify in-situ calcification rates

    Science.gov (United States)

    Morrison, Jennifer M.; Kuffner, Ilsa B.; Hickey, T. Don

    2013-01-01

    The potential effect of global climate change on calcifying marine organisms, such as scleractinian (reef-building) corals, is becoming increasingly evident. Understanding the process of coral calcification and establishing baseline calcification rates are necessary to detect future changes in growth resulting from climate change or other stressors. Here we describe the methods used to establish a network of calcification-monitoring stations along the outer Florida Keys Reef Tract in 2009. In addition to detailing the initial setup and periodic monitoring of calcification stations, we discuss the utility and success of our design and offer suggestions for future deployments. Stations were designed such that whole coral colonies were securely attached to fixed apparati (n = 10 at each site) on the seafloor but also could be easily removed and reattached as needed for periodic weighing. Corals were weighed every 6 months, using the buoyant weight technique, to determine calcification rates in situ. Sites were visited in May and November to obtain winter and summer rates, respectively, and identify seasonal patterns in calcification. Calcification rates of the crustose coralline algal community also were measured by affixing commercially available plastic tiles, deployed vertically, at each station. Colonization by invertebrates and fleshy algae on the tiles was low, indicating relative specificity for the crustose coralline algal community. We also describe a new, nonlethal technique for sampling the corals, used following the completion of the monitoring period, in which two slabs were obtained from the center of each colony. Sampled corals were reattached to the seafloor, and most corals had completely recovered within 6 months. The station design and sampling methods described herein provide an effective approach to assessing coral and crustose coralline algal calcification rates across time and space, offering the ability to quantify the potential effects of

  1. Direct risk standardisation: a new method for comparing casemix adjusted event rates using complex models.

    Science.gov (United States)

    Nicholl, Jon; Jacques, Richard M; Campbell, Michael J

    2013-10-29

    Comparison of outcomes between populations or centres may be confounded by any casemix differences and standardisation is carried out to avoid this. However, when the casemix adjustment models are large and complex, direct standardisation has been described as "practically impossible", and indirect standardisation may lead to unfair comparisons. We propose a new method of directly standardising for risk rather than standardising for casemix which overcomes these problems. Using a casemix model which is the same model as would be used in indirect standardisation, the risk in individuals is estimated. Risk categories are defined, and event rates in each category for each centre to be compared are calculated. A weighted sum of the risk category specific event rates is then calculated. We have illustrated this method using data on 6 million admissions to 146 hospitals in England in 2007/8 and an existing model with over 5000 casemix combinations, and a second dataset of 18,668 adult emergency admissions to 9 centres in the UK and overseas and a published model with over 20,000 casemix combinations and a continuous covariate. Substantial differences between conventional directly casemix standardised rates and rates from direct risk standardisation (DRS) were found. Results based on DRS were very similar to Standardised Mortality Ratios (SMRs) obtained from indirect standardisation, with similar standard errors. Direct risk standardisation using our proposed method is as straightforward as using conventional direct or indirect standardisation, always enables fair comparisons of performance to be made, can use continuous casemix covariates, and was found in our examples to have similar standard errors to the SMR. It should be preferred when there is a risk that conventional direct or indirect standardisation will lead to unfair comparisons.

  2. Methods for measuring specific rates of mercury methylation and degradation and their use in determining factors controlling net rates of mercury methylation

    International Nuclear Information System (INIS)

    Ramlal, P.S.; Rudd, J.W.M.; Hecky, R.E.

    1986-01-01

    A method was developed to estimate specific rates of demethylation of methyl mercury in aquatic samples by measuring the volatile 14 C end products of 14 CH 3 HgI demethylation. This method was used in conjuction with a 203 Hg 2+ radiochemical method which determines specific rates of mercury methylation. Together, these methods enabled us to examine some factors controlling the net rate of mercury methylation. The methodologies were field tested, using lake sediment samples from a recently flooded reservoir in the Southern Indian Lake system which had developed a mercury contamination problem in fish. Ratios of the specific rates of methylation/demethylation were calculated. The highest ratios of methylation/demethylation were calculated. The highest ratios of methylation/demethylation occurred in the flooded shorelines of Southern Indian Lake. These results provide an explanation for the observed increases in the methyl mercury concentrations in fish after flooding

  3. Input data preprocessing method for exchange rate forecasting via neural network

    Directory of Open Access Journals (Sweden)

    Antić Dragan S.

    2014-01-01

    Full Text Available The aim of this paper is to present a method for neural network input parameters selection and preprocessing. The purpose of this network is to forecast foreign exchange rates using artificial intelligence. Two data sets are formed for two different economic systems. Each system is represented by six categories with 70 economic parameters which are used in the analysis. Reduction of these parameters within each category was performed by using the principal component analysis method. Component interdependencies are established and relations between them are formed. Newly formed relations were used to create input vectors of a neural network. The multilayer feed forward neural network is formed and trained using batch training. Finally, simulation results are presented and it is concluded that input data preparation method is an effective way for preprocessing neural network data. [Projekat Ministarstva nauke Republike Srbije, br.TR 35005, br. III 43007 i br. III 44006

  4. Primal Decomposition-Based Method for Weighted Sum-Rate Maximization in Downlink OFDMA Systems

    Directory of Open Access Journals (Sweden)

    Weeraddana Chathuranga

    2010-01-01

    Full Text Available We consider the weighted sum-rate maximization problem in downlink Orthogonal Frequency Division Multiple Access (OFDMA systems. Motivated by the increasing popularity of OFDMA in future wireless technologies, a low complexity suboptimal resource allocation algorithm is obtained for joint optimization of multiuser subcarrier assignment and power allocation. The algorithm is based on an approximated primal decomposition-based method, which is inspired from exact primal decomposition techniques. The original nonconvex optimization problem is divided into two subproblems which can be solved independently. Numerical results are provided to compare the performance of the proposed algorithm to Lagrange relaxation based suboptimal methods as well as to optimal exhaustive search-based method. Despite its reduced computational complexity, the proposed algorithm provides close-to-optimal performance.

  5. Application to Determination of Scholarship Worthiness Using Simple Multi Attribute Rating Technique and Merkle Hellman Method

    Directory of Open Access Journals (Sweden)

    Dicky Nofriansyah

    2017-10-01

    Full Text Available This research was focused on explaining how the concept of simple multi attribute rating technique method in a decision support system based on desktop programming to solve multi-criteria selection problem, especially Scholarship. The Merkle Hellman method is used for securing the results of choices made by the Smart process. The determination of PPA and BBP-PPA scholarship recipients on STMIK Triguna Dharma becomes a problem because it takes a long time in determining the decision. By adopting the SMART method, the application can make decisions quickly and precisely. The expected result of this research is the application can facilitate in overcoming the problems that occur concerning the determination of PPA and BBP-PPA scholarship recipients as well as assisting Student Affairs STMIK Triguna Dharma in making decisions quickly and accurately

  6. Error baseline rates of five sample preparation methods used to characterize RNA virus populations

    Science.gov (United States)

    Kugelman, Jeffrey R.; Wiley, Michael R.; Nagle, Elyse R.; Reyes, Daniel; Pfeffer, Brad P.; Kuhn, Jens H.; Sanchez-Lockhart, Mariano; Palacios, Gustavo F.

    2017-01-01

    Individual RNA viruses typically occur as populations of genomes that differ slightly from each other due to mutations introduced by the error-prone viral polymerase. Understanding the variability of RNA virus genome populations is critical for understanding virus evolution because individual mutant genomes may gain evolutionary selective advantages and give rise to dominant subpopulations, possibly even leading to the emergence of viruses resistant to medical countermeasures. Reverse transcription of virus genome populations followed by next-generation sequencing is the only available method to characterize variation for RNA viruses. However, both steps may lead to the introduction of artificial mutations, thereby skewing the data. To better understand how such errors are introduced during sample preparation, we determined and compared error baseline rates of five different sample preparation methods by analyzing in vitro transcribed Ebola virus RNA from an artificial plasmid-based system. These methods included: shotgun sequencing from plasmid DNA or in vitro transcribed RNA as a basic “no amplification” method, amplicon sequencing from the plasmid DNA or in vitro transcribed RNA as a “targeted” amplification method, sequence-independent single-primer amplification (SISPA) as a “random” amplification method, rolling circle reverse transcription sequencing (CirSeq) as an advanced “no amplification” method, and Illumina TruSeq RNA Access as a “targeted” enrichment method. The measured error frequencies indicate that RNA Access offers the best tradeoff between sensitivity and sample preparation error (1.4−5) of all compared methods. PMID:28182717

  7. Dose Rate Experiment at JET for Benchmarking the Calculation Direct One Step Method

    International Nuclear Information System (INIS)

    Angelone, M.; Petrizzi, L.; Pillon, M.; Villari, R.; Popovichev, S.

    2006-01-01

    Neutrons produced by D-D and D-T plasmas induce the activation of tokamak materials and of components. The development of reliable methods to assess dose rates is a key issue for maintenance and operating nuclear machines, in normal and off-normal conditions. In the frame of the EFDA Fusion Technology work programme, a computational tool based upon MCNP Monte Carlo code has been developed to predict the dose rate after shutdown: it is called Direct One Step Method (D1S). The D1S is an innovative approach in which the decay gammas are coupled to the neutrons as in the prompt case and they are transported in one single step in the same run. Benchmarking of this new tool with experimental data taken in a complex geometry like that of a tokamak is a fundamental step to test the reliability of the D1S method. A dedicated benchmark experiment was proposed for the 2005-2006 experimental campaign of JET. Two irradiation positions have been selected for the benchmark: one inner position inside the vessel, not far from the plasma, called the 2 upper irradiation end (IE2), where neutron fluence is relatively high. The second position is just outside a vertical port in an external position (EX). Here the neutron flux is lower and the dose rate to be measured is not very far from the residual background. Passive detectors are used for in-vessel measurements: the high sensitivity Thermo Luminescent Dosimeters (TLDs) GR-200A (natural LiF), which ensure measurements down to environmental dose level. An active detector of Geiger-Muller (GM) type is used for out of vessel dose rate measurement. Before their use the detectors were calibrated in a secondary gamma-ray standard (Cs-137 and Co-60) facility in term of air-kerma. The background measurement was carried-out in the period July -September 2005 in the outside position EX using the GM tube and in September 2005 inside the vacuum vessel using TLD detectors located in the 2 Upper irradiation end IE2. In the present work

  8. Assessment of Estimation Methods ForStage-Discharge Rating Curve in Rippled Bed Rivers

    Directory of Open Access Journals (Sweden)

    P. Maleki

    2016-02-01

    in a flume located at the hydraulic laboratory ofShahrekordUniversity, Iran. Bass (1993 [reported in Joep (1999], determined an empirical relation between median grain size, D50, and equilibrium ripple length, l: L=75.4 (logD50+197 Eq.(1 Where l and D50 are both given in millimeters. Raudkivi (1997 [reported in Joep (1999], proposed another empirical relation to estimate the ripple length that D50 is given in millimeters: L=245(D500.35 Eq. (2 Flemming (1988 [reported in Joep (1999], derived an empirical relation between mean ripple length and ripple height based on a large dataset: hm= 0.0677l 0.8098 Eq.(3 Where hm is the mean ripple height (m and l is the mean ripple length (m. Ikeda S. and Asaeda (1983 investigated the characteristics of flow over ripples. They found that there are separation areas and vortices at lee of ripples and maximum turbulent diffusion occurs in these areas. Materials and Methods: In this research, the effects of two different type of ripples onthe hydraulic characteristics of flow were experimentally studied in a flume located at the hydraulic laboratory of ShahrekordUniversity, Iran. The flume has the dimensions of 0.4 m wide and depth and 12 m long. Generally 48 tests variety slopes of 0.0005 to 0.003 and discharges of 10 to 40 lit/s, were conducted. Velocity and the shear stress were measured by using an Acoustic Doppler Velocimeter (ADV. Two different types of ripples (parallel and flake ripples were used. The stage- discharge rating curve was then estimated in different ways, such as Einstein - Barbarvsa, shen and White et al. Results and Discussion: In order to investigateresult of the tests, were usedst atistical methods.White method as amaximum valueofα, RMSE, and average absolute error than other methods. Einstein method offitting the discharge under estimated. Evaluation of stage- discharge rating curve methods based on the obtained results from this research showed that Shen method had the highest accuracy for developing the

  9. Life cycle and population growth rate of Caenorhabditis elegans studied by a new method.

    Science.gov (United States)

    Muschiol, Daniel; Schroeder, Fabian; Traunspurger, Walter

    2009-05-16

    The free-living nematode Caenorhabditis elegans is the predominant model organism in biological research, being used by a huge number of laboratories worldwide. Many researchers have evaluated life-history traits of C. elegans in investigations covering quite different aspects such as ecotoxicology, inbreeding depression and heterosis, dietary restriction/supplement, mutations, and ageing. Such traits include juvenile growth rates, age at sexual maturity, adult body size, age-specific fecundity/mortality, total reproduction, mean and maximum lifespan, and intrinsic population growth rates. However, we found that in life-cycle experiments care is needed regarding protocol design. Here, we test a recently developed method that overcomes some problems associated with traditional cultivation techniques. In this fast and yet precise approach, single individuals are maintained within hanging drops of semi-fluid culture medium, allowing the simultaneous investigation of various life-history traits at any desired degree of accuracy. Here, the life cycles of wild-type C. elegans strains N2 (Bristol, UK) and MY6 (Münster, Germany) were compared at 20 degrees C with 5 x 10(9) Escherichia coli ml-1 as food source. High-resolution life tables and fecundity schedules of the two strains are presented. Though isolated 700 km and 60 years apart from each other, the two strains barely differed in life-cycle parameters. For strain N2 (n = 69), the intrinsic rate of natural increase (r m d(-1)), calculated according to the Lotka equation, was 1.375, the net reproductive rate (R 0) 291, the mean generation time (T) 90 h, and the minimum generation time (T min) 73.0 h. The corresponding values for strain MY6 (n = 72) were r m = 1.460, R0 = 289, T = 84 h, and T min = 67.3 h. Peak egg-laying rates in both strains exceeded 140 eggs d(-1). Juvenile and early adulthood mortality was negligible. Strain N2 lived, on average, for 16.7 d, while strain MY6 died 2 days earlier; however

  10. Life cycle and population growth rate of Caenorhabditis elegans studied by a new method

    Directory of Open Access Journals (Sweden)

    Schroeder Fabian

    2009-05-01

    Full Text Available Abstract Background The free-living nematode Caenorhabditis elegans is the predominant model organism in biological research, being used by a huge number of laboratories worldwide. Many researchers have evaluated life-history traits of C. elegans in investigations covering quite different aspects such as ecotoxicology, inbreeding depression and heterosis, dietary restriction/supplement, mutations, and ageing. Such traits include juvenile growth rates, age at sexual maturity, adult body size, age-specific fecundity/mortality, total reproduction, mean and maximum lifespan, and intrinsic population growth rates. However, we found that in life-cycle experiments care is needed regarding protocol design. Here, we test a recently developed method that overcomes some problems associated with traditional cultivation techniques. In this fast and yet precise approach, single individuals are maintained within hanging drops of semi-fluid culture medium, allowing the simultaneous investigation of various life-history traits at any desired degree of accuracy. Here, the life cycles of wild-type C. elegans strains N2 (Bristol, UK and MY6 (Münster, Germany were compared at 20°C with 5 × 109 Escherichia coli ml-1 as food source. Results High-resolution life tables and fecundity schedules of the two strains are presented. Though isolated 700 km and 60 years apart from each other, the two strains barely differed in life-cycle parameters. For strain N2 (n = 69, the intrinsic rate of natural increase (rmd-1, calculated according to the Lotka equation, was 1.375, the net reproductive rate (R0 291, the mean generation time (T 90 h, and the minimum generation time (Tmin 73.0 h. The corresponding values for strain MY6 (n = 72 were rm = 1.460, R0 = 289, T = 84 h, and Tmin = 67.3 h. Peak egg-laying rates in both strains exceeded 140 eggs d-1. Juvenile and early adulthood mortality was negligible. Strain N2 lived, on average, for 16.7 d, while strain MY6 died 2 days

  11. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Titanium

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by the activation reactions 46Ti(n,p) 46Sc + 47Ti(n, np)46Sc. Note 1—Since the cross section for the (n,np) reaction is relatively small for energies less than 12 MeV and is not easily distinguished from that of the (n,p) reaction, this test method will refer to the (n,p) reaction only. 1.2 The reaction is useful for measuring neutrons with energies above approximately 4.4 MeV and for irradiation times up to about 250 days (for longer irradiations, see Practice E 261). 1.3 With suitable techniques, fission-neutron fluence rates above 109 cm–2·s–1 can be determined. However, in the presence of a high thermal-neutron fluence rate, 46Sc depletion should be investigated. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all...

  12. ANSI/ASHRAE/IES Standard 90.1-2010 Performance Rating Method Reference Manual

    Energy Technology Data Exchange (ETDEWEB)

    Goel, Supriya [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Rosenberg, Michael I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-05-01

    This document is intended to be a reference manual for the Appendix G Performance Rating Method (PRM) of ANSI/ASHRAE/IES Standard 90.1- 2010 (Standard 90.1-2010).The PRM is used for rating the energy efficiency of commercial and high-rise residential buildings with designs that exceed the requirements of Standard 90.1. The procedures and processes described in this manual are designed to provide consistency and accuracy by filling in gaps and providing additional details needed by users of the PRM. It should be noted that this document is created independently from ASHRAE and SSPC 90.1 and is not sanctioned nor approved by either of those entities . Potential users of this manual include energy modelers, software developers and implementers of “beyond code” energy programs. Energy modelers using ASHRAE Standard 90.1-2010 for beyond code programs can use this document as a reference manual for interpreting requirements of the Performance Rating method. Software developers, developing tools for automated creation of the baseline model can use this reference manual as a guideline for developing the rules for the baseline model.

  13. The Role of Noble Metal Addition Methods on BWR Shut Down Dose Rates

    International Nuclear Information System (INIS)

    Cowan, Robert L.; Garcia Susan, E.

    2012-09-01

    Noble metal addition technology was developed for the BWR as a means of establishing low electrochemical corrosion potentials (ECP) on structural materials to mitigate intergranular stress corrosion cracking (IGSCC). When the reactor water molar ratio of H 2 / (O 2 +H 2 O 2 ) is > 2 on noble metal treated surfaces, the resulting ECP is near -500 mV (SHE), well into the mitigation range. This ratio can be achieved in most areas of the reactor with feedwater hydrogen additions in the range of 0.2 mg/kg, a condition that does not increase the radiation level in the main steam, a side effect of conventional hydrogen water chemistry (HWC). The resulting low ECP on the surface of stainless steel piping and components results in a change in form of the stable corrosion film to a spinel structure. Since it is the 60 Co incorporated into the corrosion film that is the primary source term of shutdown dose rates in BWRs, the structure and composition of the film can have a large influence in the resulting dose rates. The results of the first generation of noble metal technology, noble metal chemical addition (NMCA), showed that the reactor water ratio of 60 Co (s)/Zn (s) was a key parameter in determining shut down dose rate values. This paper will review that history and provide mechanistic understanding of how initial post NMCA dose rates are established and change with time. On-line noble metal chemical addition (OLNC) is the second generation of noble metal technology. The method utilizes the on-line injection of dilute Na 2 Pt (OH) 6 into the feedwater over a period of approximately 10 days. The first application of OLNC occurred at a European reactor in July of 2005 and to date over 20 BWRs have applied the technology, with many more applications scheduled. It is expected that OLNC will become the de facto standard because it eliminates 60 hours of outage application time and it addresses the crack flanking concerns that can arise under certain conditions. Because both

  14. Sedimentation rate estimates in Sorsogon Bay, Philippines using 210Pb method

    International Nuclear Information System (INIS)

    Madrid, Jordan F.; Sta. Maria, Efren J.; Olivares, Ryan U.; Aniago, Ryan Joseph; Asa Anie Day DC; Dayaon, Jennyvi P.; Bulos, Adelina DM; Sombrito, Elvira Z.

    2011-01-01

    Sorsogon Bay has experienced a long history of recurring harmful algal blooms over the past few years. In an attempt to establish a chronology of events in the sediment layer, lead-210 ( 210 Pb) dating method has been utilized in estimating sedimentation rates from three selected areas along the bay. Based on the unsupported 210 Pb data and by applying the Constant Initial Concentration (CIC) model, the calculated sedimentation rates were 0.8, 1.3 and 1.8 cm yr 1 for sediment cores collected near the coastal areas of Castilla (SO-01), Sorsogon City (SO-07) and Cadacan River (SO-03), respectively. High sedimentation rates were measured in sediment cores believed to be affected from frequent volcanic ash releases and from areas near human settlement combined with intensive farming and agricultural activities. The collected sediments exhibited non-uniform down core values of dry bulk density and moisture content. This variation in measurements may indicate the general quality and composition of the sediment samples, i.e., amount of organic matter and grain size. The calculated sedimentation rates obtained provided an overview of the sedimentation processes and reflect the land use pattern around the bay which may help in understanding the history and distribution of materials and nutrient input relative to the occurrence of harmful algal bloom in the sediment columns. (author)

  15. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Aluminum

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2011-01-01

    1.1 This test method covers procedures measuring reaction rates by the activation reaction 27Al(n,α)24Na. 1.2 This activation reaction is useful for measuring neutrons with energies above approximately 6.5 MeV and for irradiation times up to about 2 days (for longer irradiations, see Practice E261). 1.3 With suitable techniques, fission-neutron fluence rates above 106 cm−2·s−1 can be determined. 1.4 Detailed procedures for other fast neutron detectors are referenced in Practice E261. 1.5 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  16. Model Reference Adaptive Control of the Air Flow Rate of Centrifugal Compressor Using State Space Method

    International Nuclear Information System (INIS)

    Han, Jaeyoung; Jung, Mooncheong; Yu, Sangseok; Yi, Sun

    2016-01-01

    In this study, a model reference adaptive controller is developed to regulate the outlet air flow rate of centrifugal compressor for automotive supercharger. The centrifugal compressor is developed using the analytical based method to predict the transient behavior of operating and the designed model is validated with experimental data to confirm the system accuracy. The model reference adaptive control structure consists of a compressor model and a MRAC(model reference adaptive control) mechanism. The feedback control do not robust with variation of system parameter but the applied adaptive control is robust even if the system parameter is changed. As a result, the MRAC was regulated to reference air flow rate. Also MRAC was found to be more robust control compared with the feedback control even if the system parameter is changed.

  17. Model Reference Adaptive Control of the Air Flow Rate of Centrifugal Compressor Using State Space Method

    Energy Technology Data Exchange (ETDEWEB)

    Han, Jaeyoung; Jung, Mooncheong; Yu, Sangseok [Chungnam Nat’l Univ., Daejeon (Korea, Republic of); Yi, Sun [North Carolina A and T State Univ., Raleigh (United States)

    2016-08-15

    In this study, a model reference adaptive controller is developed to regulate the outlet air flow rate of centrifugal compressor for automotive supercharger. The centrifugal compressor is developed using the analytical based method to predict the transient behavior of operating and the designed model is validated with experimental data to confirm the system accuracy. The model reference adaptive control structure consists of a compressor model and a MRAC(model reference adaptive control) mechanism. The feedback control do not robust with variation of system parameter but the applied adaptive control is robust even if the system parameter is changed. As a result, the MRAC was regulated to reference air flow rate. Also MRAC was found to be more robust control compared with the feedback control even if the system parameter is changed.

  18. ANSI/ASHRAE/IES Standard 90.1-2016 Performance Rating Method Reference Manual

    Energy Technology Data Exchange (ETDEWEB)

    Goel, Supriya [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Rosenberg, Michael I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Eley, Charles [Eley and Associates, Hobe Sound, FL (United States)

    2017-09-29

    This document is intended to be a reference manual for the Appendix G Performance Rating Method (PRM) of ANSI/ASHRAE/IES Standard 90.1-2016 (Standard 90.1-2016). The PRM can be used to demonstrate compliance with the standard and to rate the energy efficiency of commercial and high-rise residential buildings with designs that exceed the requirements of Standard 90.1. Use of the PRM for demonstrating compliance with Standard 90.1 is a new feature of the 2016 edition. The procedures and processes described in this manual are designed to provide consistency and accuracy by filling in gaps and providing additional details needed by users of the PRM.

  19. Effects of cooking methods and starch structures on starch hydrolysis rates of rice.

    Science.gov (United States)

    Reed, Michael O; Ai, Yongfeng; Leutcher, Josh L; Jane, Jay-lin

    2013-07-01

    This study aimed to understand effects of different cooking methods, including steamed, pilaf, and traditional stir-fried, on starch hydrolysis rates of rice. Rice grains of 3 varieties, japonica, indica, and waxy, were used for the study. Rice starch was isolated from the grain and characterized. Amylose contents of starches from japonica, indica, and waxy rice were 13.5%, 18.0%, and 0.9%, respectively. The onset gelatinization temperature of indica starch (71.6 °C) was higher than that of the japonica and waxy starch (56.0 and 56.8 °C, respectively). The difference was attributed to longer amylopectin branch chains of the indica starch. Starch hydrolysis rates and resistant starch (RS) contents of the rice varieties differed after they were cooked using different methods. Stir-fried rice displayed the least starch hydrolysis rate followed by pilaf rice and steamed rice for each rice variety. RS contents of freshly steamed japonica, indica, and waxy rice were 0.7%, 6.6%, and 1.3%, respectively; those of rice pilaf were 12.1%, 13.2%, and 3.4%, respectively; and the stir-fried rice displayed the largest RS contents of 15.8%, 16.6%, and 12.1%, respectively. Mechanisms of the large RS contents of the stir-fried rice were studied. With the least starch hydrolysis rate and the largest RS content, stir-fried rice would be a desirable way of preparing rice for food to reduce postprandial blood glucose and insulin responses and to improve colon health of humans. © 2013 Institute of Food Technologists®

  20. A Comparative Survey of Methods for Remote Heart Rate Detection From Frontal Face Videos

    Directory of Open Access Journals (Sweden)

    Chen Wang

    2018-05-01

    Full Text Available Remotely measuring physiological activity can provide substantial benefits for both the medical and the affective computing applications. Recent research has proposed different methodologies for the unobtrusive detection of heart rate (HR using human face recordings. These methods are based on subtle color changes or motions of the face due to cardiovascular activities, which are invisible to human eyes but can be captured by digital cameras. Several approaches have been proposed such as signal processing and machine learning. However, these methods are compared with different datasets, and there is consequently no consensus on method performance. In this article, we describe and evaluate several methods defined in literature, from 2008 until present day, for the remote detection of HR using human face recordings. The general HR processing pipeline is divided into three stages: face video processing, face blood volume pulse (BVP signal extraction, and HR computation. Approaches presented in the paper are classified and grouped according to each stage. At each stage, algorithms are analyzed and compared based on their performance using the public database MAHNOB-HCI. Results found in this article are limited on MAHNOB-HCI dataset. Results show that extracted face skin area contains more BVP information. Blind source separation and peak detection methods are more robust with head motions for estimating HR.

  1. Application of the constant rate of pressure change method to improve jet pump performance

    International Nuclear Information System (INIS)

    Long, X P; Yang, X L

    2012-01-01

    This paper adopts a new method named the constant rate of pressure change (CRPC) to improve the jet pump performance. The main contribution of this method is that the diffuser generates uniform pressure gradient. The performance of the jet pump with new diffusers designed by the CRPC method, obtained by CFD methods, was compared with that of the jet pump with traditional conical diffusers. It is found that the CRPC diffuser produces a linear pressure increase indeed. The higher friction loss and the separation decrease the CRPC diffuser efficiency and then lower the pump efficiency. The pump with shorter throats has higher efficiency at small flow ratio while its efficiency is lower than the original pump at lager flow ratio and the peak efficiency of the pumps with the throat length of 5-6 Dt is higher than that of the pumps with other throat length. When the throat length is less than 4 Dt, the CRPC diffuser efficiency is higher than the conical diffuser. The CRPC method could also be used to design the nozzle and other situations needing the pressure change gradually.

  2. Method and apparatus for controlling the flow rate of mercury in a flow system

    Science.gov (United States)

    Grossman, Mark W.; Speer, Richard

    1991-01-01

    A method for increasing the mercury flow rate to a photochemical mercury enrichment utilizing an entrainment system comprises the steps of passing a carrier gas over a pool of mercury maintained at a first temperature T1, wherein the carrier gas entrains mercury vapor; passing said mercury vapor entrained carrier gas to a second temperature zone T2 having temperature less than T1 to condense said entrained mercury vapor, thereby producing a saturated Hg condition in the carrier gas; and passing said saturated Hg carrier gas to said photochemical enrichment reactor.

  3. Reviewing and piloting methods for decreasing discount rates; someone, somewhere in time.

    Science.gov (United States)

    Parouty, Mehraj B Y; Krooshof, Daan G M; Westra, Tjalke A; Pechlivanoglou, Petros; Postma, Maarten J

    2013-08-01

    There has been substantial debate on the need for decreasing discounting for monetary and health gains in economic evaluations. Next to the discussion on differential discounting, a way to identify the need for such discounting strategies is through eliciting the time preferences for monetary and health outcomes. In this article, the authors investigate the perceived time preference for money and health gains through a pilot survey on Dutch university students using methods on functional forms previously suggested. Formal objectives of the study were to review such existing methods and to pilot them on a convenience sample using a questionnaire designed for this specific purpose. Indeed, a negative relation between the time of delay and the variance of the discounting rate for all models was observed. This study was intended as a pilot for a large-scale population-based investigation using the findings from this pilot on wording of the questionnaire, interpretation, scope and analytic framework.

  4. A Method for Harmonic Sources Detection based on Harmonic Distortion Power Rate

    Science.gov (United States)

    Lin, Ruixing; Xu, Lin; Zheng, Xian

    2018-03-01

    Harmonic sources detection at the point of common coupling is an essential step for harmonic contribution determination and harmonic mitigation. The harmonic distortion power rate index is proposed for harmonic source location based on IEEE Std 1459-2010 in the paper. The method only based on harmonic distortion power is not suitable when the background harmonic is large. To solve this problem, a threshold is determined by the prior information, when the harmonic distortion power is larger than the threshold, the customer side is considered as the main harmonic source, otherwise, the utility side is. A simple model of public power system was built in MATLAB/Simulink and field test results of typical harmonic loads verified the effectiveness of proposed method.

  5. Hybrid Methods and Atomistic Models to Explore Free Energies, Rates and Pathways of Protein Shape Changes

    DEFF Research Database (Denmark)

    Wang, Yong

    When I just joined the Lindor-Larsen group as a fresh PhD student, the Nobel Prize in Chemistry that year was awarded for the development of multiscale models for complex chemical systems" to prize the pioneering works of Martin Karplus, Michael Levitt and Arieh Warshel. As a computational......L), whose conformational dynamics however is still not fully understood. We found modern simulation methods and force elds are able to capture key aspects of how this protein changes its shape, paving the way for future studies for systems that are dicult to study experimentally. In Chapter 3, we...... revisited the problem of accurately quantifying the thermodynamics and kinetics, by following a novel route. In this route both of the forward and backward rates are calculated directly from MD simulations using a recently developed enhanced sampling method, called \\infrequent metadynamics...

  6. Standard Test Method for Measuring Heat-Transfer Rate Using a Thermal Capacitance (Slug) Calorimeter

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method describes the measurement of heat transfer rate using a thermal capacitance-type calorimeter which assumes one-dimensional heat conduction into a cylindrical piece of material (slug) with known physical properties. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use. 1.3 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. Note 1—For information see Test Methods E 285, E 422, E 458, E 459, and E 511.

  7. Dose rate evaluation of body phantom behind ITER bio-shield wall using Monte Carlo method

    International Nuclear Information System (INIS)

    Beheshti, A.; Jabbari, I.; Karimian, A.; Abdi, M.

    2012-01-01

    One of the most critical risks to humans in reactors environment is radiation exposure. Around the tokamak hall personnel are exposed to a wide range of particles, including neutrons and photons. International Thermonuclear Experimental Reactor (ITER) is a nuclear fusion research and engineering project, which is the most advanced experimental tokamak nuclear fusion reactor. Dose rates assessment and photon radiation due to the neutron activation of the solid structures in ITER is important from the radiological point of view. Therefore, the dosimetry considered in this case is based on the Deuterium-Tritium (DT) plasma burning with neutrons production rate at 14.1 MeV. The aim of this study is assessment the amount of radiation behind bio-shield wall that a human received during normal operation of ITER by considering neutron activation and delay gammas. To achieve the aim, the ITER system and its components were simulated by Monte Carlo method. Also to increase the accuracy and precision of the absorbed dose assessment a body phantom were considered in the simulation. The results of this research showed that total dose rates level near the outside of bio-shield wall of the tokamak hall is less than ten percent of the annual occupational dose limits during normal operation of ITER and It is possible to learn how long human beings can remain in that environment before the body absorbs dangerous levels of radiation. (authors)

  8. A Method for Medical Diagnosis Based on Optical Fluence Rate Distribution at Tissue Surface.

    Science.gov (United States)

    Hamdy, Omnia; El-Azab, Jala; Al-Saeed, Tarek A; Hassan, Mahmoud F; Solouma, Nahed H

    2017-09-20

    Optical differentiation is a promising tool in biomedical diagnosis mainly because of its safety. The optical parameters' values of biological tissues differ according to the histopathology of the tissue and hence could be used for differentiation. The optical fluence rate distribution on tissue boundaries depends on the optical parameters. So, providing image displays of such distributions can provide a visual means of biomedical diagnosis. In this work, an experimental setup was implemented to measure the spatially-resolved steady state diffuse reflectance and transmittance of native and coagulated chicken liver and native and boiled breast chicken skin at 635 and 808 nm wavelengths laser irradiation. With the measured values, the optical parameters of the samples were calculated in vitro using a combination of modified Kubelka-Munk model and Bouguer-Beer-Lambert law. The estimated optical parameters values were substituted in the diffusion equation to simulate the fluence rate at the tissue surface using the finite element method. Results were verified with Monte-Carlo simulation. The results obtained showed that the diffuse reflectance curves and fluence rate distribution images can provide discrimination tools between different tissue types and hence can be used for biomedical diagnosis.

  9. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Nickel

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by the activation reaction 58Ni(n,p)58Co. 1.2 This activation reaction is useful for measuring neutrons with energies above approximately 2.1 MeV and for irradiation times up to about 200 days in the absence of high thermal neutron fluence rates (for longer irradiations, see Practice E 261). 1.3 With suitable techniques fission-neutron fluence rates densities above 107 cm−2·s−1 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use. Note—The burnup corrections were com...

  10. Standard Test Method for Measuring Heat Transfer Rate Using a Thin-Skin Calorimeter

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 This test method covers the design and use of a thin metallic calorimeter for measuring heat transfer rate (also called heat flux). Thermocouples are attached to the unexposed surface of the calorimeter. A one-dimensional heat flow analysis is used for calculating the heat transfer rate from the temperature measurements. Applications include aerodynamic heating, laser and radiation power measurements, and fire safety testing. 1.2 Advantages 1.2.1 Simplicity of ConstructionThe calorimeter may be constructed from a number of materials. The size and shape can often be made to match the actual application. Thermocouples may be attached to the metal by spot, electron beam, or laser welding. 1.2.2 Heat transfer rate distributions may be obtained if metals with low thermal conductivity, such as some stainless steels, are used. 1.2.3 The calorimeters can be fabricated with smooth surfaces, without insulators or plugs and the attendant temperature discontinuities, to provide more realistic flow conditions for ...

  11. A Method for Medical Diagnosis Based on Optical Fluence Rate Distribution at Tissue Surface

    Directory of Open Access Journals (Sweden)

    Omnia Hamdy

    2017-09-01

    Full Text Available Optical differentiation is a promising tool in biomedical diagnosis mainly because of its safety. The optical parameters’ values of biological tissues differ according to the histopathology of the tissue and hence could be used for differentiation. The optical fluence rate distribution on tissue boundaries depends on the optical parameters. So, providing image displays of such distributions can provide a visual means of biomedical diagnosis. In this work, an experimental setup was implemented to measure the spatially-resolved steady state diffuse reflectance and transmittance of native and coagulated chicken liver and native and boiled breast chicken skin at 635 and 808 nm wavelengths laser irradiation. With the measured values, the optical parameters of the samples were calculated in vitro using a combination of modified Kubelka-Munk model and Bouguer-Beer-Lambert law. The estimated optical parameters values were substituted in the diffusion equation to simulate the fluence rate at the tissue surface using the finite element method. Results were verified with Monte-Carlo simulation. The results obtained showed that the diffuse reflectance curves and fluence rate distribution images can provide discrimination tools between different tissue types and hence can be used for biomedical diagnosis.

  12. Toward Capturing Momentary Changes of Heart Rate Variability by a Dynamic Analysis Method.

    Directory of Open Access Journals (Sweden)

    Haoshi Zhang

    Full Text Available The analysis of heart rate variability (HRV has been performed on long-term electrocardiography (ECG recordings (12~24 hours and short-term recordings (2~5 minutes, which may not capture momentary change of HRV. In this study, we present a new method to analyze the momentary HRV (mHRV. The ECG recordings were segmented into a series of overlapped HRV analysis windows with a window length of 5 minutes and different time increments. The performance of the proposed method in delineating the dynamics of momentary HRV measurement was evaluated with four commonly used time courses of HRV measures on both synthetic time series and real ECG recordings from human subjects and dogs. Our results showed that a smaller time increment could capture more dynamical information on transient changes. Considering a too short increment such as 10 s would cause the indented time courses of the four measures, a 1-min time increment (4-min overlapping was suggested in the analysis of mHRV in the study. ECG recordings from human subjects and dogs were used to further assess the effectiveness of the proposed method. The pilot study demonstrated that the proposed analysis of mHRV could provide more accurate assessment of the dynamical changes in cardiac activity than the conventional measures of HRV (without time overlapping. The proposed method may provide an efficient means in delineating the dynamics of momentary HRV and it would be worthy performing more investigations.

  13. Measurement of exhalation rate of radon and radon concentration in air using open vial method

    International Nuclear Information System (INIS)

    Horiuchi, Kimiko; Ishii, Tadashi.

    1991-01-01

    It was recognized that more than half of total exposure dose on human subject is caused by radon and its decay products which originate from naturally occurring radioactive substances (1988 UNSCEAR). Since then the exhalation of radon from the ground surface has received increasing attention. The authors have developed a new method for the determination of radon in natural water using toluene extraction of radon and applying a liquid scintillation counter of an integral counting technique which is able to get the absolute counting of radon. During these studies, the authors found out that when a counting vial containing of Liquid scintillator (LS)-toluene solution, without a lid, is exposed to the atmosphere for a while, dissolution of radon clearly occurs due to high solubility of radon into toluene layer. To extend this finding for the determination of radon in the atmosphere, the authors devised a new method to actively collect the atmosphere containing radon in a glass bottle by discharging a definite amount of water in it, which is named as open-vial dynamic method. The radon concentration can be easily calculated after the necessary corrections such as the partition coefficient and others. Applying proposed method to measure the radon exhalation rate from the ground surface and radon concentration in air of the dwelling environment, radioactive mineral spring zone and various geological formation such as granitic or sedimentary rocks. (author)

  14. In Silico Assessment of Literature Insulin Bolus Calculation Methods Accounting for Glucose Rate of Change.

    Science.gov (United States)

    Cappon, Giacomo; Marturano, Francesca; Vettoretti, Martina; Facchinetti, Andrea; Sparacino, Giovanni

    2018-05-01

    The standard formula (SF) used in bolus calculators (BCs) determines meal insulin bolus using "static" measurement of blood glucose concentration (BG) obtained by self-monitoring of blood glucose (SMBG) fingerprick device. Some methods have been proposed to improve efficacy of SF using "dynamic" information provided by continuous glucose monitoring (CGM), and, in particular, glucose rate of change (ROC). This article compares, in silico and in an ideal framework limiting the exposition to possibly confounding factors (such as CGM noise), the performance of three popular techniques devised for such a scope, that is, the methods of Buckingham et al (BU), Scheiner (SC), and Pettus and Edelman (PE). Using the UVa/Padova Type 1 diabetes simulator we generated data of 100 virtual subjects in noise-free, single-meal scenarios having different preprandial BG and ROC values. Meal insulin bolus was computed using SF, BU, SC, and PE. Performance was assessed with the blood glucose risk index (BGRI) on the 9 hours after meal. On average, BU, SC, and PE improve BGRI compared to SF. When BG is rapidly decreasing, PE obtains the best performance. In the other ROC scenarios, none of the considered methods prevails in all the preprandial BG conditions tested. Our study showed that, at least in the considered ideal framework, none of the methods to correct SF according to ROC is globally better than the others. Critical analysis of the results also suggests that further investigations are needed to develop more effective formulas to account for ROC information in BCs.

  15. A spectral chart method for estimating the mean turbulent kinetic energy dissipation rate

    Science.gov (United States)

    Djenidi, L.; Antonia, R. A.

    2012-10-01

    We present an empirical but simple and practical spectral chart method for determining the mean turbulent kinetic energy dissipation rate DNS spectra, points to this scaling being also valid at small Reynolds numbers, provided effects due to inhomogeneities in the flow are negligible. The methods avoid the difficulty associated with estimating time or spatial derivatives of the velocity fluctuations. It also avoids using the second hypothesis of K41, which implies the existence of a -5/3 inertial subrange only when the Taylor microscale Reynods number R λ is sufficiently large. The method is in fact applied to the lower wavenumber end of the dissipative range thus avoiding most of the problems due to inadequate spatial resolution of the velocity sensors and noise associated with the higher wavenumber end of this range.The use of spectral data (30 ≤ R λ ≤ 400) in both passive and active grid turbulence, a turbulent mixing layer and the turbulent wake of a circular cylinder indicates that the method is robust and should lead to reliable estimates of < \\varepsilon rangle in flows or flow regions where the first similarity hypothesis should hold; this would exclude, for example, the region near a wall.

  16. A gamma camera count rate saturation correction method for whole-body planar imaging

    Science.gov (United States)

    Hobbs, Robert F.; Baechler, Sébastien; Senthamizhchelvan, Srinivasan; Prideaux, Andrew R.; Esaias, Caroline E.; Reinhardt, Melvin; Frey, Eric C.; Loeb, David M.; Sgouros, George

    2010-02-01

    Whole-body (WB) planar imaging has long been one of the staple methods of dosimetry, and its quantification has been formalized by the MIRD Committee in pamphlet no 16. One of the issues not specifically addressed in the formalism occurs when the count rates reaching the detector are sufficiently high to result in camera count saturation. Camera dead-time effects have been extensively studied, but all of the developed correction methods assume static acquisitions. However, during WB planar (sweep) imaging, a variable amount of imaged activity exists in the detector's field of view as a function of time and therefore the camera saturation is time dependent. A new time-dependent algorithm was developed to correct for dead-time effects during WB planar acquisitions that accounts for relative motion between detector heads and imaged object. Static camera dead-time parameters were acquired by imaging decaying activity in a phantom and obtaining a saturation curve. Using these parameters, an iterative algorithm akin to Newton's method was developed, which takes into account the variable count rate seen by the detector as a function of time. The algorithm was tested on simulated data as well as on a whole-body scan of high activity Samarium-153 in an ellipsoid phantom. A complete set of parameters from unsaturated phantom data necessary for count rate to activity conversion was also obtained, including build-up and attenuation coefficients, in order to convert corrected count rate values to activity. The algorithm proved successful in accounting for motion- and time-dependent saturation effects in both the simulated and measured data and converged to any desired degree of precision. The clearance half-life calculated from the ellipsoid phantom data was calculated to be 45.1 h after dead-time correction and 51.4 h with no correction; the physical decay half-life of Samarium-153 is 46.3 h. Accurate WB planar dosimetry of high activities relies on successfully compensating

  17. A Real-Time Analysis Method for Pulse Rate Variability Based on Improved Basic Scale Entropy

    Directory of Open Access Journals (Sweden)

    Yongxin Chou

    2017-01-01

    Full Text Available Base scale entropy analysis (BSEA is a nonlinear method to analyze heart rate variability (HRV signal. However, the time consumption of BSEA is too long, and it is unknown whether the BSEA is suitable for analyzing pulse rate variability (PRV signal. Therefore, we proposed a method named sliding window iterative base scale entropy analysis (SWIBSEA by combining BSEA and sliding window iterative theory. The blood pressure signals of healthy young and old subjects are chosen from the authoritative international database MIT/PhysioNet/Fantasia to generate PRV signals as the experimental data. Then, the BSEA and the SWIBSEA are used to analyze the experimental data; the results show that the SWIBSEA reduces the time consumption and the buffer cache space while it gets the same entropy as BSEA. Meanwhile, the changes of base scale entropy (BSE for healthy young and old subjects are the same as that of HRV signal. Therefore, the SWIBSEA can be used for deriving some information from long-term and short-term PRV signals in real time, which has the potential for dynamic PRV signal analysis in some portable and wearable medical devices.

  18. Flow-rate measurement using radioactive tracers and transit time method

    International Nuclear Information System (INIS)

    Turtiainen, Heikki

    1986-08-01

    The transit time method is a flow measurement method based on tracer techniques. Measurement is done by injecting to the flow a pulse of tracer and measuring its transit time between two detection positions. From the transit time the mean flow velosity and - using the pipe cross section area - the volume flow rate can be calculated. When a radioisotope tracer is used the measurement can be done from outside the pipe and without disturbing the process (excluding the tracer injection). The use of the transit time method has been limited because of difficulties associated with handling and availability of radioactive tracers and lack of equipment suitable for routine use in industrial environments. The purpose of this study was to find out if these difficulties may be overcome by using a portable isotope generator as a tracer source and automating the measurement. In the study a test rig and measuring equipment based on the use of a ''1''3''7Cs/''1''3''7''''mBa isotope generator were constructed. They were used to study the accuracy and error sources of the method and to compare different algorithms to calculate the transit time. The usability of the method and the equipment in industrial environments were studied by carrying out over 20 flow measurements in paper and pulp mills. On the basis of the results of the study, a project for constructing a compact radiatracer flowmeter for industrial use has been started. The application range of this kind of meter is very large. The most obvious applications are in situ calibration of flowmeters, material and energy balance studies, process equipment analyses (e.g. pump efficiency analyses). At the moment tracer techniques are the only methods applicable to these measurements on-line and with sufficient accuracy

  19. Early detection of pharmacovigilance signals with automated methods based on false discovery rates: a comparative study.

    Science.gov (United States)

    Ahmed, Ismaïl; Thiessard, Frantz; Miremont-Salamé, Ghada; Haramburu, Françoise; Kreft-Jais, Carmen; Bégaud, Bernard; Tubert-Bitter, Pascale

    2012-06-01

    Improving the detection of drug safety signals has led several pharmacovigilance regulatory agencies to incorporate automated quantitative methods into their spontaneous reporting management systems. The three largest worldwide pharmacovigilance databases are routinely screened by the lower bound of the 95% confidence interval of proportional reporting ratio (PRR₀₂.₅), the 2.5% quantile of the Information Component (IC₀₂.₅) or the 5% quantile of the Gamma Poisson Shrinker (GPS₀₅). More recently, Bayesian and non-Bayesian False Discovery Rate (FDR)-based methods were proposed that address the arbitrariness of thresholds and allow for a built-in estimate of the FDR. These methods were also shown through simulation studies to be interesting alternatives to the currently used methods. The objective of this work was twofold. Based on an extensive retrospective study, we compared PRR₀₂.₅, GPS₀₅ and IC₀₂.₅ with two FDR-based methods derived from the Fisher's exact test and the GPS model (GPS(pH0) [posterior probability of the null hypothesis H₀ calculated from the Gamma Poisson Shrinker model]). Secondly, restricting the analysis to GPS(pH0), we aimed to evaluate the added value of using automated signal detection tools compared with 'traditional' methods, i.e. non-automated surveillance operated by pharmacovigilance experts. The analysis was performed sequentially, i.e. every month, and retrospectively on the whole French pharmacovigilance database over the period 1 January 1996-1 July 2002. Evaluation was based on a list of 243 reference signals (RSs) corresponding to investigations launched by the French Pharmacovigilance Technical Committee (PhVTC) during the same period. The comparison of detection methods was made on the basis of the number of RSs detected as well as the time to detection. Results comparing the five automated quantitative methods were in favour of GPS(pH0) in terms of both number of detections of true signals and

  20. PREDICTION OF RESERVOIR FLOW RATE OF DEZ DAM BY THE PROBABILITY MATRIX METHOD

    Directory of Open Access Journals (Sweden)

    Mohammad Hashem Kanani

    2012-12-01

    Full Text Available The data collected from the operation of existing storage reservoirs, could offer valuable information for the better allocation and management of fresh water rates for future use to mitigation droughts effect. In this paper the long-term Dez reservoir (IRAN water rate prediction is presented using probability matrix method. Data is analyzed to find the probability matrix of water rates in Dez reservoir based on the previous history of annual water entrance during the past and present years(40 years. The algorithm developed covers both, the overflow and non-overflow conditions in the reservoir. Result of this study shows that in non-overflow conditions the most exigency case is equal to 75%. This means that, if the reservoir is empty (the stored water is less than 100 MCM this year, it would be also empty by 75% next year. The stored water in the reservoir would be less than 300 MCM by 85% next year if the reservoir is empty this year. This percentage decreases to 70% next year if the water of reservoir is less than 300 MCM this year. The percentage also decreases to 5% next year if the reservoir is full this year. In overflow conditions the most exigency case is equal to 75% again. The reservoir volume would be less than 150 MCM by 90% next year, if it is empty this year. This percentage decreases to 70% if its water volume is less than 300 MCM and 55% if the water volume is less than 500 MCM this year. Result shows that too, if the probability matrix of water rates to a reservoir is multiplied by itself repeatedly; it converges to a constant probability matrix, which could be used to predict the long-term water rate of the reservoir. In other words, the probability matrix of series of water rates is changed to a steady probability matrix in the course of time, which could reflect the hydrological behavior of the watershed and could be easily used for the long-term prediction of water storage in the down stream reservoirs.

  1. Development of high-frame rate neutron radiography and quantitative measurement method for multiphase flow research

    International Nuclear Information System (INIS)

    Mishima, K.; Hibiki, T.

    1998-01-01

    Neutron radiography (NR) is one of the radiographic techniques which makes use of the difference in attenuation characteristics of neutrons in materials. Fluid measurement using the NR technique is a non-intrusive method which enables visualization of dynamic images of multiphase flow of opaque fluids and/or in a metallic duct. To apply the NR technique to multiphase flow research, high frame-rate NR was developed by combining up-to-date technologies for neutron sources, scintillator, high-speed video and image intensifier. This imaging system has several advantages such as a long recording time (up to 21 minutes), high-frame-rate (up to 1000 frames/s) imaging and there is no need for a triggering signal. Visualization studies of air-water two-phase flow in a metallic duct and molten metal-water interaction were performed at recording speeds of 250, 500 and 1000 frames/s. The qualities of the consequent images were sufficient to observe the flow pattern and behavior. It was also demonstrated that some characteristics of two-phase flow could be measured from these images in collaboration with image processing techniques. By utilizing geometrical information extracted from NR images, data on flow regime, bubble rise velocity, and wave height and interfacial area in annular flow were obtained. By utilizing attenuation characteristics of neutrons in materials, measurements of void profile and average void fraction were performed. It was confirmed that this new technique may have significant advantages both in visualizing and measuring high-speed fluid phenomena when other methods, such as an optical method and X-ray radiography, cannot be applied. (author)

  2. Impact of seeding rate, seeding date, rate and method of phosphorus application in faba bean (Vicia faba L. minor in the absence of moisture stress

    Directory of Open Access Journals (Sweden)

    Turk M.A.

    2002-01-01

    Full Text Available Field experiments were conducted during the winter seasons of 1998-1999, 1999-2000 and 2000-2001 at the semi-arid region in north of Jordan, to study the effect of seeding dates (14 January, 28 January and 12 February, seeding rates (50, 75 and 100 plants per metre, phosphorus levels (0, 17.5, 35.0 and 52.5 kg P per ha and two methods of P placement (banding and broadcast. Seeding rate, seeding date, and rate of phosphorus had a significant effect on most of the measured traits and the yield determinates. Method of phosphorus application had only a significant effect on seed yield and seed weight per plant. In general high yields were obtained by early seeding (14 January, high seeding rate (100-plant per square metre, and P application (52.5 kg P per ha drilled with the seed after cultivation (banded.

  3. Single- versus multiple-sample method to measure glomerular filtration rate.

    Science.gov (United States)

    Delanaye, Pierre; Flamant, Martin; Dubourg, Laurence; Vidal-Petiot, Emmanuelle; Lemoine, Sandrine; Cavalier, Etienne; Schaeffner, Elke; Ebert, Natalie; Pottel, Hans

    2018-01-08

    There are many different ways to measure glomerular filtration rate (GFR) using various exogenous filtration markers, each having their own strengths and limitations. However, not only the marker, but also the methodology may vary in many ways, including the use of urinary or plasma clearance, and, in the case of plasma clearance, the number of time points used to calculate the area under the concentration-time curve, ranging from only one (Jacobsson method) to eight (or more) blood samples. We collected the results obtained from 5106 plasma clearances (iohexol or 51Cr-ethylenediaminetetraacetic acid (EDTA)) using three to four time points, allowing GFR calculation using the slope-intercept method and the Bröchner-Mortensen correction. For each time point, the Jacobsson formula was applied to obtain the single-sample GFR. We used Bland-Altman plots to determine the accuracy of the Jacobsson method at each time point. The single-sample method showed within 10% concordances with the multiple-sample method of 66.4%, 83.6%, 91.4% and 96.0% at the time points 120, 180, 240 and ≥300 min, respectively. Concordance was poorer at lower GFR levels, and this trend is in parallel with increasing age. Results were similar in males and females. Some discordance was found in the obese subjects. Single-sample GFR is highly concordant with a multiple-sample strategy, except in the low GFR range (<30 mL/min). © The Author 2018. Published by Oxford University Press on behalf of ERA-EDTA. All rights reserved.

  4. A spectral chart method for estimating the mean turbulent kinetic energy dissipation rate

    Energy Technology Data Exchange (ETDEWEB)

    Djenidi, L.; Antonia, R.A. [The University of Newcastle, School of Engineering, Newcastle, NSW (Australia)

    2012-10-15

    We present an empirical but simple and practical spectral chart method for determining the mean turbulent kinetic energy dissipation rate left angle {epsilon}right angle in a variety of turbulent flows. The method relies on the validity of the first similarity hypothesis of Kolmogorov (C R (Doklady) Acad Sci R R SS, NS 30:301-305, 1941) (or K41) which implies that spectra of velocity fluctuations scale on the kinematic viscosity {nu} and left angle {epsilon}right angle at large Reynolds numbers. However, the evidence, based on the DNS spectra, points to this scaling being also valid at small Reynolds numbers, provided effects due to inhomogeneities in the flow are negligible. The methods avoid the difficulty associated with estimating time or spatial derivatives of the velocity fluctuations. It also avoids using the second hypothesis of K41, which implies the existence of a -5/3 inertial subrange only when the Taylor microscale Reynolds number R{sub {lambda}} is sufficiently large. The method is in fact applied to the lower wavenumber end of the dissipative range thus avoiding most of the problems due to inadequate spatial resolution of the velocity sensors and noise associated with the higher wavenumber end of this range.The use of spectral data (30 {<=} R{sub {lambda}}{<=} 400) in both passive and active grid turbulence, a turbulent mixing layer and the turbulent wake of a circular cylinder indicates that the method is robust and should lead to reliable estimates of left angle {epsilon}right angle in flows or flow regions where the first similarity hypothesis should hold; this would exclude, for example, the region near a wall. (orig.)

  5. Nonlinear Methods to Assess Changes in Heart Rate Variability in Type 2 Diabetic Patients

    Energy Technology Data Exchange (ETDEWEB)

    Bhaskar, Roy, E-mail: imbhaskarall@gmail.com [Indian Institute of Technology (India); University of Connecticut, Farmington, CT (United States); Ghatak, Sobhendu [Indian Institute of Technology (India)

    2013-10-15

    Heart rate variability (HRV) is an important indicator of autonomic modulation of cardiovascular function. Diabetes can alter cardiac autonomic modulation by damaging afferent inputs, thereby increasing the risk of cardiovascular disease. We applied nonlinear analytical methods to identify parameters associated with HRV that are indicative of changes in autonomic modulation of heart function in diabetic patients. We analyzed differences in HRV patterns between diabetic and age-matched healthy control subjects using nonlinear methods. Lagged Poincaré plot, autocorrelation, and detrended fluctuation analysis were applied to analyze HRV in electrocardiography (ECG) recordings. Lagged Poincare plot analysis revealed significant changes in some parameters, suggestive of decreased parasympathetic modulation. The detrended fluctuation exponent derived from long-term fitting was higher than the short-term one in the diabetic population, which was also consistent with decreased parasympathetic input. The autocorrelation function of the deviation of inter-beat intervals exhibited a highly correlated pattern in the diabetic group compared with the control group. The HRV pattern significantly differs between diabetic patients and healthy subjects. All three statistical methods employed in the study may prove useful to detect the onset and extent of autonomic neuropathy in diabetic patients.

  6. Nonlinear Methods to Assess Changes in Heart Rate Variability in Type 2 Diabetic Patients

    International Nuclear Information System (INIS)

    Bhaskar, Roy; Ghatak, Sobhendu

    2013-01-01

    Heart rate variability (HRV) is an important indicator of autonomic modulation of cardiovascular function. Diabetes can alter cardiac autonomic modulation by damaging afferent inputs, thereby increasing the risk of cardiovascular disease. We applied nonlinear analytical methods to identify parameters associated with HRV that are indicative of changes in autonomic modulation of heart function in diabetic patients. We analyzed differences in HRV patterns between diabetic and age-matched healthy control subjects using nonlinear methods. Lagged Poincaré plot, autocorrelation, and detrended fluctuation analysis were applied to analyze HRV in electrocardiography (ECG) recordings. Lagged Poincare plot analysis revealed significant changes in some parameters, suggestive of decreased parasympathetic modulation. The detrended fluctuation exponent derived from long-term fitting was higher than the short-term one in the diabetic population, which was also consistent with decreased parasympathetic input. The autocorrelation function of the deviation of inter-beat intervals exhibited a highly correlated pattern in the diabetic group compared with the control group. The HRV pattern significantly differs between diabetic patients and healthy subjects. All three statistical methods employed in the study may prove useful to detect the onset and extent of autonomic neuropathy in diabetic patients

  7. Excessive leakage measurement using pressure decay method in containment building local leakage rate test at nuclear power plant

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Won Kyu; Kim, Chang Soo; Kim, Wang Bae [KHNP, Central Research Institute, Daejeon (Korea, Republic of)

    2016-06-15

    There are two methods for conducting the containment local leakage rate test (LLRT) in nuclear power plants: the make-up flow rate method and the pressure decay method. The make-up flow rate method is applied first in most power plants. In this method, the leakage rate is measured by checking the flow rate of the make-up flow. However, when it is difficult to maintain the test pressure because of excessive leakage, the pressure decay method can be used as a complementary method, as the leakage rates at pressures lower than normal can be measured using this method. We studied the method of measuring over leakage using the pressure decay method for conducting the LLRT for the containment building at a nuclear power plant. We performed experiments under conditions similar to those during an LLRT conducted on-site. We measured the characteristics of the leakage rate under varies pressure decay conditions, and calculated the compensation ratio based on these data.

  8. A comparative analysis of signal processing methods for motion-based rate responsive pacing.

    Science.gov (United States)

    Greenhut, S E; Shreve, E A; Lau, C P

    1996-08-01

    Pacemakers that augment heart rate (HR) by sensing body motion have been the most frequently prescribed rate responsive pacemakers. Many comparisons between motion-based rate responsive pacemaker models have been published. However, conclusions regarding specific signal processing methods used for rate response (e.g., filters and algorithms) can be affected by device-specific features. To objectively compare commonly used motion sensing filters and algorithms, acceleration and ECG signals were recorded from 16 normal subjects performing exercise and daily living activities. Acceleration signals were filtered (1-4 or 15-Hz band-pass), then processed using threshold crossing (TC) or integration (IN) algorithms creating four filter/algorithm combinations. Data were converted to an acceleration indicated rate and compared to intrinsic HR using root mean square difference (RMSd) and signed RMSd. Overall, the filters and algorithms performed similarly for most activities. The only differences between filters were for walking at an increasing grade (1-4 Hz superior to 15-Hz) and for rocking in a chair (15-Hz superior to 1-4 Hz). The only differences between algorithms were for bicycling (TC superior to IN), walking at an increasing grade (IN superior to TC), and holding a drill (IN superior to TC). Performance of the four filter/algorithm combinations was also similar over most activities. The 1-4/IN (filter [Hz]/algorithm) combination performed best for walking at a grade, while the 15/TC combination was best for bicycling. However, the 15/TC combination tended to be most sensitive to higher frequency artifact, such as automobile driving, downstairs walking, and hand drilling. Chair rocking artifact was highest for 1-4/IN. The RMSd for bicycling and upstairs walking were large for all combinations, reflecting the nonphysiological nature of the sensor. The 1-4/TC combination demonstrated the least intersubject variability, was the only filter/algorithm combination

  9. La Fábula Ovidiana de Filomela revisada por la Edad Media: de Chrétien de Troyes a Alfonso x

    Directory of Open Access Journals (Sweden)

    Mario Martín Botero García

    2014-12-01

    Full Text Available En este trabajo se expone el contraste entre las dos traducciones al francés y al castellano de Filomela, una de las fábulas de las Metamorfosis de Ovidio, realizadas en los siglos xii y xiii por Chrétien de Troyes y Alfonso X. Por medio del análisis y cotejo de tres momentos narrativos, veremos la forma en que la materia antigua es tratada según el contexto determinado en el que se producen las traducciones. La versión francesa hace énfasis en una dimensión cortés en donde el personaje femenino es altamente valorado; por su parte, la versión castellana reivindica una racionalización de la fábula ovidiana, supeditada a una visión política e histórica. Se puede constatar así que las traducciones medievales no son serviles con respecto a la fuente latina sino que demuestran una gran libertad en la selección y combinación de elementos.

  10. Calculation method of rate and area of sedimentation, by non-conventional mathematical process of data treatment

    International Nuclear Information System (INIS)

    Cota, P.L.

    1987-01-01

    The used methods for calculating the rate and area of sedimentation are based in techniques of graphical resolution. The solution of the problem by a mathematical resolution, using computational methods, is more fast and more accuracy. The comparison between the results from this methods and the conventional method is shown. (E.G.) [pt

  11. Multi-rate cubature Kalman filter based data fusion method with residual compensation to adapt to sampling rate discrepancy in attitude measurement system.

    Science.gov (United States)

    Guo, Xiaoting; Sun, Changku; Wang, Peng

    2017-08-01

    This paper investigates the multi-rate inertial and vision data fusion problem in nonlinear attitude measurement systems, where the sampling rate of the inertial sensor is much faster than that of the vision sensor. To fully exploit the high frequency inertial data and obtain favorable fusion results, a multi-rate CKF (Cubature Kalman Filter) algorithm with estimated residual compensation is proposed in order to adapt to the problem of sampling rate discrepancy. During inter-sampling of slow observation data, observation noise can be regarded as infinite. The Kalman gain is unknown and approaches zero. The residual is also unknown. Therefore, the filter estimated state cannot be compensated. To obtain compensation at these moments, state error and residual formulas are modified when compared with the observation data available moments. Self-propagation equation of the state error is established to propagate the quantity from the moments with observation to the moments without observation. Besides, a multiplicative adjustment factor is introduced as Kalman gain, which acts on the residual. Then the filter estimated state can be compensated even when there are no visual observation data. The proposed method is tested and verified in a practical setup. Compared with multi-rate CKF without residual compensation and single-rate CKF, a significant improvement is obtained on attitude measurement by using the proposed multi-rate CKF with inter-sampling residual compensation. The experiment results with superior precision and reliability show the effectiveness of the proposed method.

  12. Statistical evaluation of the analytical method involved in French nuclear glasses leaching rate determination

    Energy Technology Data Exchange (ETDEWEB)

    Broudic, V.; Marques, C.; Bonnal, M

    2004-07-01

    Chemical durability studies of nuclear glasses involves a large number of water leaching experiments at different temperatures and pressures on both, glasses doped with fission products and actinides and non radioactive surrogates. The leaching rates of these glasses are evaluated through ICPAES analysis of the leachate over time. This work presents a statistical evaluation of the analysis method used to determine the concentrations of various vitreous matrix constituents: Si, B, Na, Al, Ca, Li as major elements and Ba, Cr, Fe, Mn, Mo, Ni, P, Sr, Zn, Zr as minor elements. Calibration characteristics, limits of detection, limits of quantification and uncertainties quantification are illustrated with different examples of analysis performed on surrogates and on radioactive leachates in glove box. (authors)

  13. Building America Guidance for Identifying and Overcoming Code, Standard, and Rating Method Barriers

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Pamala C.; Halverson, Mark A.

    2013-09-01

    The U.S. Department of Energy’s (DOE) Building America program implemented a new Codes and Standards Innovation (CSI) Team in 2013. The Team’s mission is to assist Building America (BA) research teams and partners in identifying and resolving conflicts between Building America innovations and the various codes and standards that govern the construction of residences. A CSI Roadmap was completed in September, 2013. This guidance document was prepared using the information in the CSI Roadmap to provide BA research teams and partners with specific information and approaches to identifying and overcoming potential barriers to Building America (BA) innovations arising in and/or stemming from codes, standards, and rating methods. For more information on the BA CSI team, please email: CSITeam@pnnl.gov

  14. Statistical evaluation of the analytical method involved in French nuclear glasses leaching rate determination

    International Nuclear Information System (INIS)

    Broudic, V.; Marques, C.; Bonnal, M.

    2004-01-01

    Chemical durability studies of nuclear glasses involves a large number of water leaching experiments at different temperatures and pressures on both, glasses doped with fission products and actinides and non radioactive surrogates. The leaching rates of these glasses are evaluated through ICPAES analysis of the leachate over time. This work presents a statistical evaluation of the analysis method used to determine the concentrations of various vitreous matrix constituents: Si, B, Na, Al, Ca, Li as major elements and Ba, Cr, Fe, Mn, Mo, Ni, P, Sr, Zn, Zr as minor elements. Calibration characteristics, limits of detection, limits of quantification and uncertainties quantification are illustrated with different examples of analysis performed on surrogates and on radioactive leachates in glove box. (authors)

  15. A method for radiobiological investigations in radiation fields with different LET and high dose rates

    International Nuclear Information System (INIS)

    Grundler, W.

    1976-01-01

    For investigations: 1. Performed in the field of radiobiology with different LET-radiation and a relatively high background dose rate of one component (e.g. investigations with fast and intermediate reactor neutrons) 2. Concerning radiation risk studies within a wide range 3. Of irradiations, covering a long time period (up to 100 days) a test system is necessary which on the one hand makes it possible to analyze the influence of different LET radiation and secondly shows a relative radiation resistant behaviour and allows a simple cell cycle regulation. A survey is given upon the installed device of a simple cell observation method, the biological test system used and the analysis of effects caused by dose, repair and LET. It is possible to analyze the behaviour of the nonsurvival cells and to demonstrate different reactions of the test parameters to the radiation of different LET. (author)

  16. [Heart rate variability as a method of assessing the autonomic nervous system in polycystic ovary syndrome].

    Science.gov (United States)

    de Sá, Joceline Cássia Ferezini; Costa, Eduardo Caldas; da Silva, Ester; Azevedo, George Dantas

    2013-09-01

    Polycystic ovary syndrome (PCOS) is an endocrine disorder associated with several cardiometabolic risk factors, such as central obesity, insulin resistance, type 2 diabetes, metabolic syndrome, and hypertension. These factors are associated with adrenergic overactivity, which is an important prognostic factor for the development of cardiovascular disorders. Given the common cardiometabolic disturbances occurring in PCOS women, over the last years studies have investigated the cardiac autonomic control of these patients, mainly based on heart rate variability (HRV). Thus, in this review, we will discuss the recent findings of the studies that investigated the HRV of women with PCOS, as well as noninvasive methods of analysis of autonomic control starting from basic indexes related to this methodology.

  17. Development and application of an on-line tritium production rate measuring method

    International Nuclear Information System (INIS)

    Yamaguchi, Seiya

    1989-06-01

    A highly sensitive on-line method for measuring the tritium production rate (TPR) of 6 Li was developed using the response difference of 6 Li and 7 Li-glass scintillators in a mixed neutron-gamma radiation field. A fitting method for subtracting the pulse height spectrum of 7 Li-glass from that of 6 Li-glass was introduced. The contribution of competing reactions such as 6 Li (n, n 'd) 4 He was estimated by kinematical analyses. An absolute value of the 6 Li content was determined by a chemical analysis. The thermal flux perturbation due to 6 Li-glass of various thickness and 6 Li contents was evaluated by measurement in a thermal neutron field and calculation by the modified Skyrme theory. A Monte Carlo calculation of the self-shielding effect was also made. The dependence of the self-shielding on neutron energy was examined by this Monte Carlo code. The edge effect, i.e., distortion of the pulse height spectrum due to partial energy deposition of the alpha and/or the triton, was investigated by measurement in a thermal neutron field and by a Monte Carlo simulation that was based on the scintillation mechanism and considered Bragg absorption and the ratio of contributions to luminescence by the alpha and the triton. The dependence of the edge effect on neutron energy was examined by this Monte Carlo code. This method was applied to the measurement of TPR distributions in simulated fusion blanket assemblies bombarded by D-T neutrons. Absolute values of the TPR were obtained with an experimental error of 3∼6 %. The measured results were compared with those of conventional β-counting methods and good agreement was obtained. An optical fiber system, using miniature lithium-glass scintillators, was fabricated for purpose of microminiaturization of detector size and adaption to strong electromagnetic field. Applicability of this system to a D-T neutron field was demonstrated. (author)

  18. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Iron

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2009-01-01

    DESIG: E 263 09 ^TITLE: Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Iron ^SIGNUSE: Refer to Guide E 844 for guidance on the selection, irradiation, and quality control of neutron dosimeters. Refer to Practice E 261 for a general discussion of the determination of fast-neutron fluence rate with threshold detectors. Pure iron in the form of foil or wire is readily available and easily handled. Fig. 1 shows a plot of cross section as a function of neutron energy for the fast-neutron reaction 54Fe(n,p)54Mn (1). This figure is for illustrative purposes only to indicate the range of response of the 54Fe(n,p)54Mn reaction. Refer to Guide E 1018 for descriptions of recommended tabulated dosimetry cross sections. 54Mn has a half-life of 312.13 days (3) (2) and emits a gamma ray with an energy of 834.845 keV (5). (2) Interfering activities generated by neutron activation arising from thermal or fast neutron interactions are 2.57878 (46)-h 56Mn, 44.95-d (8) 59Fe, and 5.27...

  19. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Copper

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2011-01-01

    1.1 This test method covers procedures for measuring reaction rates by the activation reaction 63Cu(n,α)60Co. The cross section for 60Co produced in this reaction increases rapidly with neutrons having energies greater than about 5 MeV. 60Co decays with a half-life of 1925.27 days (±0.29 days)(1) and emits two gamma rays having energies of 1.1732278 and 1.332492 MeV (1). The isotopic content of natural copper is 69.17 % 63Cu and 30.83 % 65Cu (2). The neutron reaction, 63Cu(n,γ)64Cu, produces a radioactive product that emits gamma rays which might interfere with the counting of the 60Co gamma rays. 1.2 With suitable techniques, fission-neutron fluence rates above 109 cm−2·s−1 can be determined. The 63Cu(n,α)60Co reaction can be used to determine fast-neutron fluences for irradiation times up to about 15 years (for longer irradiations, see Practice E261). 1.3 Detailed procedures for other fast-neutron detectors are referenced in Practice E261. 1.4 This standard does not purport to address all of the...

  20. Standard Test Method for Measuring Reaction Rates by Radioactivation of Uranium-238

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by assaying a fission product (F.P.) from the fission reaction 238U(n,f)F.P. 1.2 The reaction is useful for measuring neutrons with energies from approximately 1.5 to 7 MeV and for irradiation times up to 30 to 40 years. 1.3 Equivalent fission neutron fluence rates as defined in Practice E 261 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other unites of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  1. Standard Test Method for Measuring Reaction Rates by Radioactivation of Neptunium-237

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by assaying a fission product (F.P.) from the fission reaction 237Np(n,f)F.P. 1.2 The reaction is useful for measuring neutrons with energies from approximately 0.7 to 6 MeV and for irradiation times up to 30 to 40 years. 1.3 Equivalent fission neutron fluence rates as defined in Practice E 261 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  2. Effect of Irrigation Methods, Nitrogen and Phosphorus Fertilizer Rates on Sugar Beet Yield and Quality

    International Nuclear Information System (INIS)

    Janat, M.; Abudlkareem, J.

    2007-01-01

    The experiment was conducted at a research station near Adlib. Two irrigation methods, sprinkler irrigation and drip fertigation, two phosphorus rates and four nitrogen rates 0, 70, 140 and 210 kg N/ha were tested. All N fertilizers were injected for drip irrigation or broadcasted for the sprinkler-irrigated treatments in six equally split applications. Neutron probe Results revealed that the introduction of drip fertigation was not proved to be a water saving relative to sprinkler irrigation. Dry matter production was slightly increased for the drip-fertigated treatments relative to sprinkler irrigated treatments. Nitrogen use efficiency was not improved under drip fertigation relative to that of sprinkler irrigation. Application of phosphorus fertilizer improved sugar beet yield as well as N uptake. No significant differences in sugar beet yield were observed due to the application of N fertilizer under drip fertigation. On the other hand, there was a trend toward increasing sugar beet yield grown under sprinkler irrigation. Drip fertigation had no negative effects on sugar content and other related properties, furthermore some of those properties were enhanced due to the employment of drip fertigation. Field water-use efficiency followed a similar trend and was increased under sprinkler irrigation relative to drip-fertigation for sugar beet yield parameter.

  3. Highly Controlled Codeposition Rate of Organolead Halide Perovskite by Laser Evaporation Method.

    Science.gov (United States)

    Miyadera, Tetsuhiko; Sugita, Takeshi; Tampo, Hitoshi; Matsubara, Koji; Chikamatsu, Masayuki

    2016-10-05

    Organolead-halide perovskites can be promising materials for next-generation solar cells because of its high power conversion efficiency. The method of precise fabrication is required because both solution-process and vacuum-process fabrication of the perovskite have problems of controllability and reproducibility. Vacuum deposition process was expected to achieve precise control; however, vaporization of amine compound significantly degrades the controllability of deposition rate. Here we achieved the reduction of the vaporization by implementing the laser evaporation system for the codeposition of perovskite. Locally irradiated continuous-wave lasers on the source materials realized the reduced vaporization of CH 3 NH 3 I. The deposition rate was stabilized for several hours by adjusting the duty ratio of modulated laser based on proportional-integral control. Organic-photovoltaic-type perovskite solar cells were fabricated by codeposition of PbI 2 and CH 3 NH 3 I. A power-conversion efficiency of 16.0% with reduced hysteresis was achieved.

  4. An Improved in Vivo Deuterium Labeling Method for Measuring the Biosynthetic Rate of Cytokinins

    Directory of Open Access Journals (Sweden)

    Petr Tarkowski

    2010-12-01

    Full Text Available An improved method for determining the relative biosynthetic rate of isoprenoid cytokinins has been developed. A set of 11 relevant isoprenoid cytokinins, including zeatin isomers, was separated by ultra performance liquid chromatography in less than 6 min. The iP-type cytokinins were observed to give rise to a previously-unknown fragment at m/z 69; we suggest that the diagnostic (204-69 transition can be used to monitor the biosynthetic rate of isopentenyladenine. Furthermore, we found that by treating the cytokinin nucleotides with alkaline phosphatase prior to analysis, the sensitivity of the detection process could be increased. In addition, derivatization (propionylation improved the ESI-MS response by increasing the analytes' hydrophobicity. Indeed, the ESI-MS response of propionylated isopentenyladenosine was about 34% higher than that of its underivatized counterpart. Moreover, the response of the derivatized zeatin ribosides was about 75% higher than that of underivatized zeatin ribosides. Finally, we created a web-based calculator (IZOTOP that facilitates MS/MS data processing and offer it freely to the research community.

  5. Effect of milk sample delivery methods and arrival conditions on bacterial contamination rates.

    Science.gov (United States)

    Dinsmore, R P; English, P B; Matthews, J C; Sears, P M

    1990-07-01

    A cross sectional study was performed of factors believed to contribute to the contamination of bovine milk sample cultures submitted to the Ithaca Regional Laboratory of the Quality Milk Promotion Services/New York State Mastitis Control. Of 871 samples entered in the study, 137 (15.7%) were contaminated. There were interactions between the sample source (veterinarian vs dairyman), delivery method, and time between sample collection and arrival at the laboratory. If only those samples collected and hand delivered by the dairyman within 1 day of collection were compared to a like subset of samples collected and hand delivered by veterinarians, no statistically significant differences in milk sample contamination rate (MSCR) were found. Samples were delivered to the laboratory by hand, US Postal Service, United Parcel Service, via the New York State College of Veterinary Medicine Diagnostic Laboratory, or Northeast Dairy Herd Improvement Association Courier. The MSCR was only 7.6% for hand delivered samples, while 26% of Postal Service samples were contaminated. These rates differed significantly from other delivery methods (P less than 0.0001). The USPS samples arrived a longer time after sampling than did samples sent by other routes, and time had a significant effect on MSCR (0 to 1 day, 8.9%; greater than 1 day, 25.9%; P less than 0.01). Samples packaged with ice packs sent by routes other than the Postal Service had a lower MSCR than those not packaged with ice packs, but ice packs did not reduce the MSCR for samples sent by the Postal Service.(ABSTRACT TRUNCATED AT 250 WORDS)

  6. Household projections by the headship rates method: The case of Serbia

    Directory of Open Access Journals (Sweden)

    Vasić Petar

    2017-01-01

    Full Text Available The headship rates method (HRM of household projections based on the share of household heads in the total population of the same demographic characteristics (age, sex, nationality, marital status, etc. is the most commonly used method, especially by statistical institutes and planning institutions. The specific rates of household heads by age are calculated by dividing the number of household holders of a certain age with the total number of residents of the appropriate age. The future number of households is then simply projected on the basis of population projections by age and assumptions about the future changes of HR. The HRM is based on the projection of the future age structure of the population. In that sense, the choice of methods of population projection, as well as the method of projecting HR-s have determining impact on the outcome of household projections. Given the methodological inconsistency typical for official population projections in Serbia and significant differences in addressing uncertainty of the future population change between deterministic and probabilistic approach in making population projections, the decision to use a probabilistic projection of the population of Serbia as the basis for calculating the future number of house-holds and their structure according to the age of the household head proved to be a logical choice. However, as the basic aim of this article is to show the simple method of household projections, the above-mentioned stochastic projection is used in utterly deterministic manner. The median of the prediction interval of the population distributed across age is interpreted as the most probable future, or as a prognosis. The HR-s based on the age structure estimates and estimated number of households by age of the household head from Household budget survey (HBS are used for the purpose of HR projecting so that the number of observations would be large enough for calculating inclination parameters

  7. Ora et labora. Paradigmes du modèle monacal médiéval chez Chrétien de Troyes / Ora et labora. Paradigms of the Medieval Monastic Model in Chrétien de Troyes’s Work

    Directory of Open Access Journals (Sweden)

    Diana Gradu

    2015-05-01

    Full Text Available The medieval monachal model is marked out by the faith, by the power, by the morality. It is also shared between confidence and fear with regard to the power on the earth, but, certainly, all the clerks and the monks of the Middle Age know and assume the rule Redde Caesari quae sunt Cesaris and quae sunt Dei Deo. The medieval literature, the unfaithful mirror, is reflected in an incomplete and sometimes idealized way, the example of the hermit, but it constitutes in the essential source of its paradigm. I shall stop to Chrétien of Troyes and to its novels, they are the most glorious proof of the Renaissance of the 12th century.

  8. Initial radioiodine remnant ablation success rates compared by diagnostic scan methods: I123 versus I131

    International Nuclear Information System (INIS)

    Choi, W.; Choi, E.; Yoo, I.; Kim, S.; Han, E.; Lee, S.; Lee, W.

    2015-01-01

    Full text of publication follows. Objective: to see if diagnostic whole body scan (DxWBS) performed with I-131 prior diminishes the success rate of initial radioiodine remnant ablation (RRA) compared to I-123 DxWBS in differentiated thyroid cancer patients. Material and methods: consecutive thyroid cancer patients who received total thyroidectomy for differentiated thyroid cancer and then high dose RRA (either 100 mCi or 150 mCi) within 6 months were included. DxWBSs were performed with I-123 or with I-131. Prior to the DxWBSs, all patients followed strict low iodine diet for 2 weeks and withdrew hormone to stimulate TSH above 30 mIU/l. Patients with extra-thyroidal extension of tumor, lymph node metastasis, or distant metastasis were excluded. The initial RRA was defined as successful if the next DxWBS done 6 months to 1 year later was negative and stimulated thyroglobulin level was below 2 ng/ml. Results: of 71 patients who had I-123 DxWBSs, 31 patients went on to receive RRA with 100 mCi and 40 patients received 150 mCi. Of 73 patients who had I-131 DxWBSs, 66 received 100 mCi and 7 patients received 150 mCi. The overall success rate was 79% for patients who had I-123 DxWBS prior to RRA (68% for 100 mCi and 86% for 150 mCi), and 68% for patient who had I-131 DxWBSs (68% for 100 mCi and 71% for 150 mCi). Conclusion: for patients who received 100 mCi, the RRA success rate was the same for I-123 DxWBS and I-131 DxWBS. For patients treated with 150 mCi, the success rate may be lower in patients who receive RRA following DxWBS with I-131 compared to DxWBS with I-123. (authors)

  9. Quantitative Methods for Measuring Repair Rates and Innate-Immune Cell Responses in Wounded Mouse Skin.

    Science.gov (United States)

    Li, Zhi; Gothard, Elizabeth; Coles, Mark C; Ambler, Carrie A

    2018-01-01

    In skin wounds, innate-immune cells clear up tissue debris and microbial contamination, and also secrete cytokines and other growth factors that impact repair process such as re-epithelialization and wound closure. After injury, there is a rapid influx and efflux of immune cells at wound sites, yet the function of each innate cell population in skin repair is still under investigation. Flow cytometry is a valuable research tool for detecting and quantifying immune cells; however, in mouse back skin, the difficulty in extracting immune cells from small area of skin due to tissue complexity has made cytometric analysis an underutilized tool. In this paper, we provide detailed methods on the digestion of lesion-specific skin without disrupting antigen expression followed by multiplex cell staining that allows for identification of seven innate-immune populations, including rare subsets such as group-3 innate lymphoid cells (ILC3s), by flow-cytometry analysis. Furthermore, when studying the functions of immune cells to tissue repair an important metric to monitor is size of the wound opening. Normal wounds close steadily albeit at non-linear rates, while slow or stalled wound closure can indicate an underlying problem with the repair process. Calliper measurements are difficult and time-consuming to obtain and can require repeated sedation of experimental animals. We provide advanced methods for measuring of wound openness; digital 3D image capture and semi-automated image processing that allows for unbiased, reliable measurements that can be taken repeatedly over time.

  10. A method of estimating inspiratory flow rate and volume from an inhaler using acoustic measurements

    International Nuclear Information System (INIS)

    Holmes, Martin S; D'Arcy, Shona; O'Brien, Ultan; Reilly, Richard B; Seheult, Jansen N; Geraghty, Colm; Costello, Richard W; Crispino O'Connell, Gloria

    2013-01-01

    Inhalers are devices employed to deliver medication to the airways in the treatment of respiratory diseases such as asthma and chronic obstructive pulmonary disease. A dry powder inhaler (DPI) is a breath actuated inhaler that delivers medication in dry powder form. When used correctly, DPIs improve patients' clinical outcomes. However, some patients are unable to reach the peak inspiratory flow rate (PIFR) necessary to fully extract the medication. Presently clinicians have no reliable method of objectively measuring PIFR in inhalers. In this study, we propose a novel method of estimating PIFR and also the inspiratory capacity (IC) of patients' inhalations from a commonly used DPI, using acoustic measurements. With a recording device, the acoustic signal of 15 healthy subjects using a DPI over a range of varying PIFR and IC values was obtained. Temporal and spectral signal analysis revealed that the inhalation signal contains sufficient information that can be employed to estimate PIFR and IC. It was found that the average power (P ave ) in the frequency band 300–600 Hz had the strongest correlation with PIFR (R 2 = 0.9079), while the power in the same frequency band was also highly correlated with IC (R 2 = 0.9245). This study has several clinical implications as it demonstrates the feasibility of using acoustics to objectively monitor inhaler use. (paper)

  11. Standard Test Method for Measuring Reaction Rates by Analysis of Barium-140 From Fission Dosimeters

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method describes two procedures for the measurement of reaction rates by determining the amount of the fission product 140Ba produced by the non-threshold reactions 235U(n,f), 241Am(n,f), and 239Pu(n,f), and by the threshold reactions 238U(n,f), 237Np(n,f), and 232Th(n,f). 1.2 These reactions produce many fission products, among which is 140Ba, having a half-life of 12.752 days. 140Ba emits gamma rays of several energies; however, these are not easily detected in the presence of other fission products. Competing activity from other fission products requires that a chemical separation be employed or that the 140Ba activity be determined indirectly by counting its daughter product 140La. This test method describes both procedure (a), the nondestructive determination of 140Ba by the direct counting of 140La several days after irradiation, and procedure (b), the chemical separation of 140Ba and the subsequent counting of 140Ba or its daughter 140La. 1.3 With suitable techniques, fission neutron fl...

  12. Associations between changes in the pattern of suicide methods and rates in Korea, the US, and Finland

    Science.gov (United States)

    2014-01-01

    Background The lethality of the suicide method employed is a strong risk factor for the completion of suicide. We examined whether annual changes in the pattern of suicide methods is related to annual changes in suicide rates in South Korea, the United States (US), and Finland. Methods We analyzed annual data from 2000–2011 for South Korea and Finland, and 2000–2010 for the US in order to examine trends in the rates and methods of suicide. Data on suicide methods were obtained from the World Health Organization (WHO) mortality database. Results Along with an annual rapid increase in suicide rates, the incidence of hanging increased steadily while suicide by self-poisoning steadily decreased in South Korea. In the US, along with an annual increase in suicide rates, the proportion of suicides committed by hanging increased while those committed with the use of firearms steadily decreased. In Finland, annual changes in the suicide rate and suicide method were not statistically significant during the study period. Conclusions Our present findings suggest that the increased use of specific lethal methods for suicide, namely hanging, is reflected in the increased suicide rates in the Korean and the US populations. The most effective approach for reducing overall suicide rates may be the implementation of population-based initiatives that reduce both the accessibility (e.g., access to firearms) and the social acceptability (e.g., effective and responsible regulations for reporting suicide) of lethal methods of suicide. PMID:24949083

  13. La cinéphilie chrétienne : Amédée Ayfre (1922-1964), sulpicien et critique de cinéma1

    OpenAIRE

    Rocher, Philippe

    2012-01-01

    Prêtre français de saint Sulpice et chrétien cinéphile, Amédée Ayfre a défendu l’esthétique et le réalisme cinématographiques contre le cinéma religieux du « Cinéma catholique ». Le « réalisme cinématographique » est un instrument de révélation chrétienne du Prochain. Brusquement décédé, Amédée Ayfre n’a pas eu la possibilité de dépasser ses premiers « Jalons pour une théologie de l’image ». In the middle Twentieth century, Amédée Ayfre, French priest of the Society of saint Sulpice and Ch...

  14. Mapping cell-specific functional connections in the mouse brain using ChR2-evoked hemodynamics (Conference Presentation)

    Science.gov (United States)

    Bauer, Adam Q.; Kraft, Andrew; Baxter, Grant A.; Bruchas, Michael; Lee, Jin-Moo; Culver, Joseph P.

    2017-02-01

    Functional magnetic resonance imaging (fMRI) has transformed our understanding of the brain's functional organization. However, mapping subunits of a functional network using hemoglobin alone presents several disadvantages. Evoked and spontaneous hemodynamic fluctuations reflect ensemble activity from several populations of neurons making it difficult to discern excitatory vs inhibitory network activity. Still, blood-based methods of brain mapping remain powerful because hemoglobin provides endogenous contrast in all mammalian brains. To add greater specificity to hemoglobin assays, we integrated optical intrinsic signal(OIS) imaging with optogenetic stimulation to create an Opto-OIS mapping tool that combines the cell-specificity of optogenetics with label-free, hemoglobin imaging. Before mapping, titrated photostimuli determined which stimulus parameters elicited linear hemodynamic responses in the cortex. Optimized stimuli were then scanned over the left hemisphere to create a set of optogenetically-defined effective connectivity (Opto-EC) maps. For many sites investigated, Opto-EC maps exhibited higher spatial specificity than those determined using spontaneous hemodynamic fluctuations. For example, resting-state functional connectivity (RS-FC) patterns exhibited widespread ipsilateral connectivity while Opto-EC maps contained distinct short- and long-range constellations of ipsilateral connectivity. Further, RS-FC maps were usually symmetric about midline while Opto-EC maps displayed more heterogeneous contralateral homotopic connectivity. Both Opto-EC and RS-FC patterns were compared to mouse connectivity data from the Allen Institute. Unlike RS-FC maps, Thy1-based maps collected in awake, behaving mice closely recapitulated the connectivity structure derived using ex vivo anatomical tracer methods. Opto-OIS mapping could be a powerful tool for understanding cellular and molecular contributions to network dynamics and processing in the mouse brain.

  15. A test case of the deformation rate analysis (DRA) stress measurement method

    Energy Technology Data Exchange (ETDEWEB)

    Dight, P.; Hsieh, A. [Australian Centre for Geomechanics, Univ. of WA, Crawley (Australia); Johansson, E. [Saanio and Riekkola Oy, Helsinki (Finland); Hudson, J.A. [Rock Engineering Consultants (United Kingdom); Kemppainen, K.

    2012-01-15

    As part of Posiva's site and ONKALO investigations, the in situ rock stress has been measured by a variety of techniques, including hydraulic fracturing, overcoring, and convergence measurements. All these techniques involve direct measurements in a drillhole or at the rock surface. An alternative method is to test drillhole core in a way that enables estimation of the magnitudes and orientations of the in situ rock stress. The Kaiser Effect (KE) and Deformation Rate Analysis (DRA) are two ways to do this. In the work reported here, a 'blind' DRA test was conducted on core obtained from the POSE (Posiva's Olkiluoto Spalling Experiment) niche in the ONKALO. The term 'blind' means that the two first authors of this report, who conducted the tests at the Australian Centre for Geomechanics, did not know the depths below surface at which the cores had been obtained. The results of this DRA Test Case are presented, together with an explanation of the DRA procedure. Also, additional information that would help in such DRA testing and associated analysis is explained. One of the problems in comparing the DRA results with the known Olkiluoto stress field is that the latter is highly variable across the site, as experienced by the previous in situ stress measurements and as predicted by numerical analysis. The variability is mainly caused by the presence of the large brittle deformation zones which perturb the local stress state. However, this variability reduces with depth and the stress field becomes more stable at the {approx} 350 m at which the drillhole cores were obtained. Another compounding difficulty is that the stress quantity, being a second order tensor, requires six independent components for its specification. In other words, comparison of the DRA results and the known stress field requires comparison of six different quantities. In terms of the major principal stress orientation, the DRA results predict an orientation completely

  16. A test case of the deformation rate analysis (DRA) stress measurement method

    International Nuclear Information System (INIS)

    Dight, P.; Hsieh, A.; Johansson, E.; Hudson, J.A.; Kemppainen, K.

    2012-01-01

    As part of Posiva's site and ONKALO investigations, the in situ rock stress has been measured by a variety of techniques, including hydraulic fracturing, overcoring, and convergence measurements. All these techniques involve direct measurements in a drillhole or at the rock surface. An alternative method is to test drillhole core in a way that enables estimation of the magnitudes and orientations of the in situ rock stress. The Kaiser Effect (KE) and Deformation Rate Analysis (DRA) are two ways to do this. In the work reported here, a 'blind' DRA test was conducted on core obtained from the POSE (Posiva's Olkiluoto Spalling Experiment) niche in the ONKALO. The term 'blind' means that the two first authors of this report, who conducted the tests at the Australian Centre for Geomechanics, did not know the depths below surface at which the cores had been obtained. The results of this DRA Test Case are presented, together with an explanation of the DRA procedure. Also, additional information that would help in such DRA testing and associated analysis is explained. One of the problems in comparing the DRA results with the known Olkiluoto stress field is that the latter is highly variable across the site, as experienced by the previous in situ stress measurements and as predicted by numerical analysis. The variability is mainly caused by the presence of the large brittle deformation zones which perturb the local stress state. However, this variability reduces with depth and the stress field becomes more stable at the ∼ 350 m at which the drillhole cores were obtained. Another compounding difficulty is that the stress quantity, being a second order tensor, requires six independent components for its specification. In other words, comparison of the DRA results and the known stress field requires comparison of six different quantities. In terms of the major principal stress orientation, the DRA results predict an orientation completely different to the NW-SE regional

  17. Associations between changes in the pattern of suicide methods and rates in Korea, the US, and Finland

    OpenAIRE

    Park, Subin; Ahn, Myung Hee; Lee, Ahrong; Hong, Jin Pyo

    2014-01-01

    Background The lethality of the suicide method employed is a strong risk factor for the completion of suicide. We examined whether annual changes in the pattern of suicide methods is related to annual changes in suicide rates in South Korea, the United States (US), and Finland. Methods We analyzed annual data from 2000–2011 for South Korea and Finland, and 2000–2010 for the US in order to examine trends in the rates and methods of suicide. Data on suicide methods were obtained from the World ...

  18. Spent Fuel Pool Dose Rate Calculations Using Point Kernel and Hybrid Deterministic-Stochastic Shielding Methods

    International Nuclear Information System (INIS)

    Matijevic, M.; Grgic, D.; Jecmenica, R.

    2016-01-01

    This paper presents comparison of the Krsko Power Plant simplified Spent Fuel Pool (SFP) dose rates using different computational shielding methodologies. The analysis was performed to estimate limiting gamma dose rates on wall mounted level instrumentation in case of significant loss of cooling water. The SFP was represented with simple homogenized cylinders (point kernel and Monte Carlo (MC)) or cuboids (MC) using uranium, iron, water, and dry-air as bulk region materials. The pool is divided on the old and new section where the old one has three additional subsections representing fuel assemblies (FAs) with different burnup/cooling time (60 days, 1 year and 5 years). The new section represents the FAs with the cooling time of 10 years. The time dependent fuel assembly isotopic composition was calculated using ORIGEN2 code applied to the depletion of one of the fuel assemblies present in the pool (AC-29). The source used in Microshield calculation is based on imported isotopic activities. The time dependent photon spectra with total source intensity from Microshield multigroup point kernel calculations was then prepared for two hybrid deterministic-stochastic sequences. One is based on SCALE/MAVRIC (Monaco and Denovo) methodology and another uses Monte Carlo code MCNP6.1.1b and ADVANTG3.0.1. code. Even though this model is a fairly simple one, the layers of shielding materials are thick enough to pose a significant shielding problem for MC method without the use of effective variance reduction (VR) technique. For that purpose the ADVANTG code was used to generate VR parameters (SB cards in SDEF and WWINP file) for MCNP fixed-source calculation using continuous energy transport. ADVATNG employs a deterministic forward-adjoint transport solver Denovo which implements CADIS/FW-CADIS methodology. Denovo implements a structured, Cartesian-grid SN solver based on the Koch-Baker-Alcouffe parallel transport sweep algorithm across x-y domain blocks. This was first

  19. Accelerating finite-rate chemical kinetics with coprocessors: Comparing vectorization methods on GPUs, MICs, and CPUs

    Science.gov (United States)

    Stone, Christopher P.; Alferman, Andrew T.; Niemeyer, Kyle E.

    2018-05-01

    Accurate and efficient methods for solving stiff ordinary differential equations (ODEs) are a critical component of turbulent combustion simulations with finite-rate chemistry. The ODEs governing the chemical kinetics at each mesh point are decoupled by operator-splitting allowing each to be solved concurrently. An efficient ODE solver must then take into account the available thread and instruction-level parallelism of the underlying hardware, especially on many-core coprocessors, as well as the numerical efficiency. A stiff Rosenbrock and a nonstiff Runge-Kutta ODE solver are both implemented using the single instruction, multiple thread (SIMT) and single instruction, multiple data (SIMD) paradigms within OpenCL. Both methods solve multiple ODEs concurrently within the same instruction stream. The performance of these parallel implementations was measured on three chemical kinetic models of increasing size across several multicore and many-core platforms. Two separate benchmarks were conducted to clearly determine any performance advantage offered by either method. The first benchmark measured the run-time of evaluating the right-hand-side source terms in parallel and the second benchmark integrated a series of constant-pressure, homogeneous reactors using the Rosenbrock and Runge-Kutta solvers. The right-hand-side evaluations with SIMD parallelism on the host multicore Xeon CPU and many-core Xeon Phi co-processor performed approximately three times faster than the baseline multithreaded C++ code. The SIMT parallel model on the host and Phi was 13%-35% slower than the baseline while the SIMT model on the NVIDIA Kepler GPU provided approximately the same performance as the SIMD model on the Phi. The runtimes for both ODE solvers decreased significantly with the SIMD implementations on the host CPU (2.5-2.7 ×) and Xeon Phi coprocessor (4.7-4.9 ×) compared to the baseline parallel code. The SIMT implementations on the GPU ran 1.5-1.6 times faster than the baseline

  20. Management of marine cage aquaculture. Environmental carrying capacity method based on dry feed conversion rate.

    Science.gov (United States)

    Cai, Huiwen; Sun, Yinglan

    2007-11-01

    Marine cage aquaculture produces a large amount of waste that is released directly into the environment. To effectively manage the mariculture environment, it is important to determine the carrying capacity of an aquaculture area. In many Asian countries trash fish is dominantly used in marine cage aquaculture, which contains more water than pellet feed. The traditional nutrient loading analysis is for pellet feed not for trash fish feed. So, a more critical analysis is necessary in trash fish feed culturing areas. Corresponding to FCR (feed conversion rate), dry feed conversion rate (DFCR) was used to analyze the nutrient loadings from marine cage aquaculture where trash fish is used. Based on the hydrodynamic model and the mass transport model in Xiangshan Harbor, the relationship between the water quality and the waste discharged from cage aquaculture has been determined. The environmental carrying capacity of the aquaculture sea area was calculated by applying the models noted above. Nitrogen and phosphorus are the water quality parameters considered in this study. The simulated results show that the maximum nitrogen and phosphorus concentrations were 0.216 mg/L and 0.039 mg/L, respectively. In most of the sea area, the nutrient concentrations were higher than the water quality standard. The calculated environmental carrying capacity of nitrogen and phosphorus in Xiangshan Harbor were 1,107.37 t/yr and 134.35 t/yr, respectively. The waste generated from cage culturing in 2000 has already exceeded the environmental carrying capacity. Unconsumed feed has been identified as the most important origin of all pollutants in cage culturing systems. It suggests the importance of increasing the feed utilization and improving the feed composition on the basis of nutrient requirement. For the sustainable development of the aquaculture industry, it is an effective management measure to keep the stocking density and pollution loadings below the environmental carrying

  1. Dose rate estimates and spatial interpolation maps of outdoor gamma dose rate with geostatistical methods; A case study from Artvin, Turkey

    International Nuclear Information System (INIS)

    Yeşilkanat, Cafer Mert; Kobya, Yaşar; Taşkin, Halim; Çevik, Uğur

    2015-01-01

    In this study, compliance of geostatistical estimation methods is compared to ensure investigation and imaging natural Fon radiation using the minimum number of data. Artvin province, which has a quite hilly terrain and wide variety of soil and located in the north–east of Turkey, is selected as the study area. Outdoor gamma dose rate (OGDR), which is an important determinant of environmental radioactivity level, is measured in 204 stations. Spatial structure of OGDR is determined by anisotropic, isotropic and residual variograms. Ordinary kriging (OK) and universal kriging (UK) interpolation estimations were calculated with the help of model parameters obtained from these variograms. In OK, although calculations are made based on positions of points where samples are taken, in the UK technique, general soil groups and altitude values directly affecting OGDR are included in the calculations. When two methods are evaluated based on their performances, it has been determined that UK model (r = 0.88, p < 0.001) gives quite better results than OK model (r = 0.64, p < 0.001). In addition, as a result of the maps created at the end of the study, it was illustrated that local changes are better reflected by UK method compared to OK method and its error variance is found to be lower. - Highlights: • The spatial dispersion of gamma dose rates in Artvin, which possesses one of the roughest lands in Turkey were studied. • The performance of different Geostatistic methods (OK and UK methods) for dispersion of gamma dose rates were compared. • Estimation values were calculated for non-sampling points by using the geostatistical model, the results were mapped. • The general radiological structure was determined in much less time with lower costs compared to experimental methods. • When theoretical methods are evaluated, it was obtained that UK gives more descriptive results compared to OK.

  2. Point and interval forecasts of mortality rates and life expectancy: A comparison of ten principal component methods

    Directory of Open Access Journals (Sweden)

    Han Lin Shang

    2011-07-01

    Full Text Available Using the age- and sex-specific data of 14 developed countries, we compare the point and interval forecast accuracy and bias of ten principal component methods for forecasting mortality rates and life expectancy. The ten methods are variants and extensions of the Lee-Carter method. Based on one-step forecast errors, the weighted Hyndman-Ullah method provides the most accurate point forecasts of mortality rates and the Lee-Miller method is the least biased. For the accuracy and bias of life expectancy, the weighted Hyndman-Ullah method performs the best for female mortality and the Lee-Miller method for male mortality. While all methods underestimate variability in mortality rates, the more complex Hyndman-Ullah methods are more accurate than the simpler methods. The weighted Hyndman-Ullah method provides the most accurate interval forecasts for mortality rates, while the robust Hyndman-Ullah method provides the best interval forecast accuracy for life expectancy.

  3. Accurate and fast methods to estimate the population mutation rate from error prone sequences

    Directory of Open Access Journals (Sweden)

    Miyamoto Michael M

    2009-08-01

    Full Text Available Abstract Background The population mutation rate (θ remains one of the most fundamental parameters in genetics, ecology, and evolutionary biology. However, its accurate estimation can be seriously compromised when working with error prone data such as expressed sequence tags, low coverage draft sequences, and other such unfinished products. This study is premised on the simple idea that a random sequence error due to a chance accident during data collection or recording will be distributed within a population dataset as a singleton (i.e., as a polymorphic site where one sampled sequence exhibits a unique base relative to the common nucleotide of the others. Thus, one can avoid these random errors by ignoring the singletons within a dataset. Results This strategy is implemented under an infinite sites model that focuses on only the internal branches of the sample genealogy where a shared polymorphism can arise (i.e., a variable site where each alternative base is represented by at least two sequences. This approach is first used to derive independently the same new Watterson and Tajima estimators of θ, as recently reported by Achaz 1 for error prone sequences. It is then used to modify the recent, full, maximum-likelihood model of Knudsen and Miyamoto 2, which incorporates various factors for experimental error and design with those for coalescence and mutation. These new methods are all accurate and fast according to evolutionary simulations and analyses of a real complex population dataset for the California seahare. Conclusion In light of these results, we recommend the use of these three new methods for the determination of θ from error prone sequences. In particular, we advocate the new maximum likelihood model as a starting point for the further development of more complex coalescent/mutation models that also account for experimental error and design.

  4. Quantitative Methods for Measuring Repair Rates and Innate-Immune Cell Responses in Wounded Mouse Skin

    Directory of Open Access Journals (Sweden)

    Zhi Li

    2018-02-01

    Full Text Available In skin wounds, innate-immune cells clear up tissue debris and microbial contamination, and also secrete cytokines and other growth factors that impact repair process such as re-epithelialization and wound closure. After injury, there is a rapid influx and efflux of immune cells at wound sites, yet the function of each innate cell population in skin repair is still under investigation. Flow cytometry is a valuable research tool for detecting and quantifying immune cells; however, in mouse back skin, the difficulty in extracting immune cells from small area of skin due to tissue complexity has made cytometric analysis an underutilized tool. In this paper, we provide detailed methods on the digestion of lesion-specific skin without disrupting antigen expression followed by multiplex cell staining that allows for identification of seven innate-immune populations, including rare subsets such as group-3 innate lymphoid cells (ILC3s, by flow-cytometry analysis. Furthermore, when studying the functions of immune cells to tissue repair an important metric to monitor is size of the wound opening. Normal wounds close steadily albeit at non-linear rates, while slow or stalled wound closure can indicate an underlying problem with the repair process. Calliper measurements are difficult and time-consuming to obtain and can require repeated sedation of experimental animals. We provide advanced methods for measuring of wound openness; digital 3D image capture and semi-automated image processing that allows for unbiased, reliable measurements that can be taken repeatedly over time.

  5. Consumer preferences for hearing aid attributes: a comparison of rating and conjoint analysis methods.

    Science.gov (United States)

    Bridges, John F P; Lataille, Angela T; Buttorff, Christine; White, Sharon; Niparko, John K

    2012-03-01

    Low utilization of hearing aids has drawn increased attention to the study of consumer preferences using both simple ratings (e.g., Likert scale) and conjoint analyses, but these two approaches often produce inconsistent results. The study aims to directly compare Likert scales and conjoint analysis in identifying important attributes associated with hearing aids among those with hearing loss. Seven attributes of hearing aids were identified through qualitative research: performance in quiet settings, comfort, feedback, frequency of battery replacement, purchase price, water and sweat resistance, and performance in noisy settings. The preferences of 75 outpatients with hearing loss were measured with both a 5-point Likert scale and with 8 paired-comparison conjoint tasks (the latter being analyzed using OLS [ordinary least squares] and logistic regression). Results were compared by examining implied willingness-to-pay and Pearson's Rho. A total of 56 respondents (75%) provided complete responses. Two thirds of respondents were male, most had sensorineural hearing loss, and most were older than 50; 44% of respondents had never used a hearing aid. Both methods identified improved performance in noisy settings as the most valued attribute. Respondents were twice as likely to buy a hearing aid with better functionality in noisy environments (p < .001), and willingness to pay for this attribute ranged from US$2674 on the Likert to US$9000 in the conjoint analysis. The authors find a high level of concordance between the methods-a result that is in stark contrast with previous research. The authors conclude that their result stems from constraining the levels on the Likert scale.

  6. The discussion on a new measure method of radon chamber leak rate

    International Nuclear Information System (INIS)

    Zhang Junkui; Tang Bing

    2010-01-01

    Radon chamber is the third standard radon source. The leak rate is the key parameter for the radon chamber to naturally and safely operate. One way, that measure the leak rate is introduced. The experience result is that the way is simple and veracious to measure the leak rate. (authors)

  7. Taguchi Method for Development of Mass Flow Rate Correlation using Hydrocarbon Refrigerant Mixture in Capillary Tube

    Directory of Open Access Journals (Sweden)

    Shodiya Sulaimon

    2014-07-01

    Full Text Available The capillary tube is an important control device used in small vapor compression refrigeration systems such as window air-conditioners, household refrigerators and freezers. This paper develops a non-dimensional correlation based on the test results of the adiabatic capillary tube for the mass flow rate through the tube using a hydrocarbon refrigerant mixture of 89.3% propane and 10.7% butane (HCM. The Taguchi method, a statistical experimental design approach, was employed. This approach explores the economic benefit that lies in studies of this nature, where only a small number of experiments are required and yet valid results are obtained. Considering the effects of the capillary tube geometry and the inlet condition of the tube, dimensionless parameters were chosen. The new correlation was also based on the Buckingham Pi theorem. This correlation predicts 86.67% of the present experimental data within a relative deviation of -10% to +10%. The predictions by this correlation were also compared with results in published literature.

  8. Comparison of two different methods for the determination of erythrocyte sedimentation rate

    Directory of Open Access Journals (Sweden)

    Gülfer Öztürk

    2014-09-01

    Full Text Available Objective: Erythrocyte Sedimentation Rate (ESR can be used for the follow-up of number of diseases. In recent years, closed automated systems that measure ESR directly from a capped EDTA and citrate blood sample tube have been developed. In this study, we aimed to compare and evaluate the consistence of assay results of iSed Alcor Auto-instrument and Berkhun SDM60 Auto-instrument. Methods: K2EDTA and citrated blood samples were taken from 149 randomly selected outpatients. The ESR of blood samples in tubes containing K2EDTA was determined by iSed Alcor Auto-instrument whereas Berkhun SDM60 Auto-instrument was used to determine the ESR of blood samples in tubes containing citrate. Results: The mean ± SD ESR was 24.48 ± 23.10 mm/hr (95% CI for the mean was 20.54–28.02 mm/hr for iSed Alcor Auto-instrument and 23.94 ± 17.24 mm/hr (95% CI for the mean was 21.15–26.73 mm/hr for the Berkhun Auto-instrument. We found the mean difference between two methods as 0.336 mm/hr (95% CI for the mean was −2.06 to 1.39 mm/hr; P = 0.701. The obtained correlation coefficient was 0.90 (P = 0.0001. There was no evidence of systemic bias, equal to 0.3 mm/hr (limits of agreement, –20.6 to 21.2 mm/hr. Conclusion: iSed Alcor Auto-instrument and Berkhun SDM60 Auto-instrument might be used as alternative systems each other. However, it should be monitored carefully in especially high ESR (>50 mm/hr results and the results should be checked according to the Westergren method. J Clin Exp Invest 2014; 5 (3: 371-375

  9. Corrosion potential detection method, potential characteristic simulation method for reaction rate and plant monitoring system using the same

    International Nuclear Information System (INIS)

    Sakai, Masanori; Onaka, Noriyuki; Takahashi, Tatsuya; Yamanaka, Hiroshi.

    1995-01-01

    In a calculation controlling device for a plant monitoring system, concentrations of materials concerning reaction materials in a certain state of a reaction process, and an actually measured value for the potential of a material in this state are substituted into a reaction rate equation obtained in accordance with a reaction process model. With such procedures, a relation between the reaction rate (current value) and the potential of the material can be obtained. A potential at which the reaction rates of an anode reaction and a cathode reaction contained in a corrosion reaction are made equal is determined by a numerical value calculation, based on an electrochemical hybrid potential logic by using the reaction rate equation, the reaction rate information relative to the corrosion reaction of the material and the concentration of the material concerning the corrosion reaction is obtained by a numerical value calculation. Then, simulation for the corrosion potential is enabled based on the handling corresponding to the actual reaction. Further, even for a portion which can not be measured actually, the corrosion potential can be recognized by simulation. (N.H.)

  10. A New Method for Rating Hazard from Intense Sounds: Implications for Hearing Protection, Speech Intelligibility, and Situation Awareness

    National Research Council Canada - National Science Library

    Price, G. R

    2005-01-01

    The auditory hazard assessment algorithm for the human (AHAAH), developed by the U.S. Army Research Laboratory, is theoretically based and has been demonstrated to rate hazard from intense sounds much more accurately than existing methods...

  11. Analysis of the influence of the demand rate on the accident rate of a plant equipped with a single protective channel by Generalized Perturbation Theory (GPT) methods

    International Nuclear Information System (INIS)

    Franca Walter, F.L.; Alvim, A.C.M.; Silva, F.C. da; Melo e Frutuoso, P.F.

    1995-01-01

    The application of the GPT methodology to a reliability engineering problem of great practical interest is discussed: that of the analysis of the influence of the demand rate on the accident rate of a process plant equipped with a single protective channel. This problem has been solved in the literature by traditional methods, that is, for each demand rate value the system of differential equations that governs the system behavior (derived from a Markovian reliability model) is solved and the resulting points are employed to generate the desired curve. This sensitivity analysis has been performed by means of a GPT approach in order to show how it could simplify the calculations. Although an analytical solution is available for the above equations, the application of the GPT approach needed the solution of the system for a few points (reference solutions) and the results agree very well with those published. (author). 9 refs, 4 figs

  12. Evaluation method of gas leakage rate from transportation casks of radioactive materials (gas leakage rates from scratches on O-ring surface)

    International Nuclear Information System (INIS)

    Aritomi, Masanori; Li Ninghua; Asano, Ryoji; Kawa, Tsunemichi

    2004-01-01

    A sealing function is essential for transportation and/or storage casks of radioactive materials under both normal and accidental operating conditions in order to prevent radioactive materials from being released into the environment. In the safety analysis report, the release rate of radioactive materials into the environment is evaluated using the correlations specified in the ANSI N14.5, 1987. The purposes of the work are to reveal the underlying problems on the correlations specified in the ANSI N14.5 related to gas leakage rates from a scratch on O-ring surface and from multi-leak paths, to offer a data base to study the evaluation method of the leakage rate and to propose the evaluation method. In this paper, the following insights were obtained and clarified: 1. If a characteristic value of a leak path is defined as D 4 /a ('D' is the diameter and 'a' is the length), a scratch on the O-ring surface can be evaluated as a circular tube. 2. It is proper to use the width of O-ring groove on the flange as the leak path length for elastomer O-rings. 3. Gas leakage rates from multi leak paths of the transportation cask can be evaluated in the same manner as a single leak path if an effective D4/a is introduced. (author)

  13. Estimating Population Turnover Rates by Relative Quantification Methods Reveals Microbial Dynamics in Marine Sediment.

    Science.gov (United States)

    Kevorkian, Richard; Bird, Jordan T; Shumaker, Alexander; Lloyd, Karen G

    2018-01-01

    The difficulty involved in quantifying biogeochemically significant microbes in marine sediments limits our ability to assess interspecific interactions, population turnover times, and niches of uncultured taxa. We incubated surface sediments from Cape Lookout Bight, North Carolina, USA, anoxically at 21°C for 122 days. Sulfate decreased until day 68, after which methane increased, with hydrogen concentrations consistent with the predicted values of an electron donor exerting thermodynamic control. We measured turnover times using two relative quantification methods, quantitative PCR (qPCR) and the product of 16S gene read abundance and total cell abundance (FRAxC, which stands for "fraction of read abundance times cells"), to estimate the population turnover rates of uncultured clades. Most 16S rRNA reads were from deeply branching uncultured groups, and ∼98% of 16S rRNA genes did not abruptly shift in relative abundance when sulfate reduction gave way to methanogenesis. Uncultured Methanomicrobiales and Methanosarcinales increased at the onset of methanogenesis with population turnover times estimated from qPCR at 9.7 ± 3.9 and 12.6 ± 4.1 days, respectively. These were consistent with FRAxC turnover times of 9.4 ± 5.8 and 9.2 ± 3.5 days, respectively. Uncultured Syntrophaceae , which are possibly fermentative syntrophs of methanogens, and uncultured Kazan-3A-21 archaea also increased at the onset of methanogenesis, with FRAxC turnover times of 14.7 ± 6.9 and 10.6 ± 3.6 days. Kazan-3A-21 may therefore either perform methanogenesis or form a fermentative syntrophy with methanogens. Three genera of sulfate-reducing bacteria, Desulfovibrio , Desulfobacter , and Desulfobacterium , increased in the first 19 days before declining rapidly during sulfate reduction. We conclude that population turnover times on the order of days can be measured robustly in organic-rich marine sediment, and the transition from sulfate-reducing to methanogenic conditions stimulates

  14. CHR AL IDRISSI OF KENITRA

    African Journals Online (AJOL)

    lanez

    31 déc. 2014 ... prescription médicale, dans un objectif de diagnostic, dépistage, ... L'activité de cet emploi/métier s'exerce au sein de laboratoires (analyses médicales, recherche, ... Techniques de prélèvement biologique. Réaliser ... albicans, Pseudomonas, Syphilis, Les virus d'hépatite et le VIH) dans des prélèvements.

  15. Analytical methods of leakage rate estimation from a containment under a LOCA

    International Nuclear Information System (INIS)

    Chun, M.H.

    1981-01-01

    Three most outstanding maximum flow rate formulas are identified from many existing models. Outlines of the three limiting mass flow rate models are given along with computational procedures to estimate approximate amount of fission products released from a containment to environment for a given characteristic hole size for containment-isolation failure and containment pressure and temperature under a loss of coolant accident. Sample calculations are performed using the critical ideal gas flow rate model and the Moody's graphs for the maximum two-phase flow rates, and the results are compared with the values obtained from then mass leakage rate formula of CONTEMPT-LT code for converging nozzle and sonic flow. It is shown that the critical ideal gas flow rate formula gives almost comparable results as one can obtain from the Moody's model. It is also found that a more conservative approach to estimate leakage rate from a containment under a LOCA is to use the maximum ideal gas flow rate equation rather than the mass leakage rate formula of CONTEMPT-LT. (author)

  16. System and method for determining an ammonia generation rate in a three-way catalyst

    Science.gov (United States)

    Sun, Min; Perry, Kevin L; Kim, Chang H

    2014-12-30

    A system according to the principles of the present disclosure includes a rate determination module, a storage level determination module, and an air/fuel ratio control module. The rate determination module determines an ammonia generation rate in a three-way catalyst based on a reaction efficiency and a reactant level. The storage level determination module determines an ammonia storage level in a selective catalytic reduction (SCR) catalyst positioned downstream from the three-way catalyst based on the ammonia generation rate. The air/fuel ratio control module controls an air/fuel ratio of an engine based on the ammonia storage level.

  17. Comparison and limitations of three different bulk etch rate measurement methods used for gamma irradiated PM-355 detectors

    Energy Technology Data Exchange (ETDEWEB)

    Fazal-ur-Rehman E-mail: fazalr@kfupm.edu.sa; Abu-Jarad, F.; Al-Jarallah, M.I.; Farhat, M

    2001-06-01

    Samples of Nuclear Track Detectors (PM-355) were exposed to high gamma doses from 1x10{sup 5} Gy (10 Mrad) up to 1.2x10{sup 6} Gy (120 Mrad) at an incremental dose of 1x10{sup 5} Gy (10 Mrad). The gamma source was a 9.03 PBq (244 kCi) Co-60 source used for sterilization of medical syringes. The bulk etch rate (V{sub b}) was measured for various high gamma doses by three different methods: 1--thickness change method; 2--mass change method; 3--fission track diametric method. The study gives a comparison and limitations of these three methods used for bulk etch rate measurements in the detectors as a function of high gamma doses. The track etch rate (V{sub t}) and the sensitivity (V) of the detector were also measured using the fission track diametric method. It was observed that V{sub b} increases with the increase of the gamma absorbed dose at a fixed etching time in each bulk etch measuring method. The bulk etch rate decreases exponentially with the etching time at a fixed gamma absorbed dose in all three methods. The thickness change and mass change methods have successfully been applied to measure V{sub b} at higher gamma doses up to 1.2x10{sup 6} Gy (120 Mrad). The bulk etch rate determined by the mass change and thickness change methods was almost the same at a certain gamma dose and etching time whereas it was quite low in the case of the fission track diametric method due to its limitations at higher doses. Also in this method it was not possible to measure the fission fragment track diameters at higher doses due to the quick disappearance of the fission tracks and therefore the V{sub b} could not be estimated at higher gamma doses.

  18. Evaluation of trauma care using TRISS method: the role of adjusted misclassification rate and adjusted w-statistic

    Directory of Open Access Journals (Sweden)

    Bytyçi Cen I

    2009-01-01

    Full Text Available Abstract Background Major trauma is a leading cause of death worldwide. Evaluation of trauma care using Trauma Injury and Injury Severity Score (TRISS method is focused in trauma outcome (deaths and survivors. For testing TRISS method TRISS misclassification rate is used. Calculating w-statistic, as a difference between observed and TRISS expected survivors, we compare our trauma care results with the TRISS standard. Aim The aim of this study is to analyze interaction between misclassification rate and w-statistic and to adjust these parameters to be closer to the truth. Materials and methods Analysis of components of TRISS misclassification rate and w-statistic and actual trauma outcome. Results The component of false negative (FN (by TRISS method unexpected deaths has two parts: preventable (Pd and non-preventable (nonPd trauma deaths. Pd represents inappropriate trauma care of an institution; otherwise nonpreventable trauma deaths represents errors in TRISS method. Removing patients with preventable trauma deaths we get an Adjusted misclassification rate: (FP + FN - Pd/N or (b+c-Pd/N. Substracting nonPd from FN value in w-statistic formula we get an Adjusted w-statistic: [FP-(FN - nonPd]/N, respectively (FP-Pd/N, or (b-Pd/N. Conclusion Because adjusted formulas clean method from inappropriate trauma care, and clean trauma care from the methods error, TRISS adjusted misclassification rate and adjusted w-statistic gives more realistic results and may be used in researches of trauma outcome.

  19. Methods of neutron spectrum calculation from measured reaction rates in saips. Part 1. Review of mathematical methods

    International Nuclear Information System (INIS)

    Bondars, Kh.Ya.; Lapenas, A.A.

    1981-01-01

    We adapted or used on ES EhVM, operating under the control of OS ES, the currently most common algorithms for calculating neutron spectra from measured reaction rates. These programs, together with the neutron cross-section and spectrum libraries, are part of the computerized information system SAIPS. The present article descibes the basic mathematical concepts used in the algorithms of the SAIPS calculation programs

  20. The Impact of Accounting Methods on Cost Reduction Rates in Defense Aerospace Weapons System Programs

    Science.gov (United States)

    1988-12-01

    and adhered to in U.S. industry, allow some flexibility in accounting. Under GAAP , accounting areas such as depreciation , inventory, investment tax... depreciation , inventory and investment tax credit) in predicting cost reduction rates are studied. Of the three accounting variables, only inventory...RATES .. ................. ........... 5 1. Depreciation ........ ............... 6 2. Capitalizing or Expensing of Costs . . .. 6 3. Material Costs

  1. A Tractable Method for Describing Complex Couplings between Neurons and Population Rate.

    Science.gov (United States)

    Gardella, Christophe; Marre, Olivier; Mora, Thierry

    2016-01-01

    Neurons within a population are strongly correlated, but how to simply capture these correlations is still a matter of debate. Recent studies have shown that the activity of each cell is influenced by the population rate, defined as the summed activity of all neurons in the population. However, an explicit, tractable model for these interactions is still lacking. Here we build a probabilistic model of population activity that reproduces the firing rate of each cell, the distribution of the population rate, and the linear coupling between them. This model is tractable, meaning that its parameters can be learned in a few seconds on a standard computer even for large population recordings. We inferred our model for a population of 160 neurons in the salamander retina. In this population, single-cell firing rates depended in unexpected ways on the population rate. In particular, some cells had a preferred population rate at which they were most likely to fire. These complex dependencies could not be explained by a linear coupling between the cell and the population rate. We designed a more general, still tractable model that could fully account for these nonlinear dependencies. We thus provide a simple and computationally tractable way to learn models that reproduce the dependence of each neuron on the population rate.

  2. Constrained least squares methods for estimating reaction rate constants from spectroscopic data

    NARCIS (Netherlands)

    Bijlsma, S.; Boelens, H.F.M.; Hoefsloot, H.C.J.; Smilde, A.K.

    2002-01-01

    Model errors, experimental errors and instrumental noise influence the accuracy of reaction rate constant estimates obtained from spectral data recorded in time during a chemical reaction. In order to improve the accuracy, which can be divided into the precision and bias of reaction rate constant

  3. The sediment accumulation rates measured in Lake Poyang using 210Pb dating method

    International Nuclear Information System (INIS)

    Wang Xiuyu; Zeng Erkang; Wan Yusong; Liu Xiaosong

    1987-01-01

    The sediment accumulation rates were estimated from the vertical distribution of excess 210 Pb measured in sediment cores collected from Lake Poyang, Jiangxi Provence of China. These rates were various with the differences in hydrology. The sedimentation rates are the lowest in the middle region of the lake, in which the rates could not be determined from the two samples and the other one is 0.14 cm/a. The sedimentation rates are lower in the northeast basin section, averaging to 0.19 cm/a. The sediment rates in the diffusion area of the lake from which 5 rivers enter sand deposion is more than the rates in other areas of the lake (0.08 cm/a to 0.28 cm/a) and the hydrology factors are various. Because of the sand from the Yangzhi River the sedimentation rates are the highest in the water-way section of the lake, averaging from 0.23 to 0.62 cm/a

  4. The un-making of a method: From rating scales to the study of psychological processes

    DEFF Research Database (Denmark)

    Rosenbaum, Philip J.; Valsiner, Jaan

    2011-01-01

    Rating scales are standard instruments in psychology. They force the research participant to provide a numerical estimate of an assumed “degree” of some characteristic along a linear scale. We prove that such numerical estimates are artifacts based on unknown psychological processes that are used...... in terms of the study of microgenesis of rating processes allows psychology access to the reality of the workings of the human mind....... in the making of a rating. Psychology’s current use of rating scales entails reliance upon unexplored and abbreviated introspection. It superimposes upon the rater the use of real numbers for the subjective construction of the ratings. The axiomatic superimposition of the notion of “degree” of subjective...

  5. Effects of landforms on the erosion rate in a small watershed by the {sup 137}Cs tracing method

    Energy Technology Data Exchange (ETDEWEB)

    Li Mian, E-mail: hnli-mian@163.co [Yellow River Institute of Hydraulic Research, Key Laboratory of Sediment Research of Yellow River of Ministry of Water Resources, Zhengzhou, Henan 450003 (China); Yao Wenyi [Yellow River Institute of Hydraulic Research, Key Laboratory of Sediment Research of Yellow River of Ministry of Water Resources, Zhengzhou, Henan 450003 (China); Li Zhanbin [Xi' an University of Technology, Xi' an, Shaanxi 710048 (China); Institute of Soil and Water Conservation, Chinese Academy of Sciences and Ministry of Water Resources, Yangling, Shaanxi 712100 (China); Liu Puling [Institute of Soil and Water Conservation, Chinese Academy of Sciences and Ministry of Water Resources, Yangling, Shaanxi 712100 (China); Shen Zhenzhou [Yellow River Institute of Hydraulic Research, Key Laboratory of Sediment Research of Yellow River of Ministry of Water Resources, Zhengzhou, Henan 450003 (China)

    2010-05-15

    It's very important to analyze and evaluate quantitatively the effects of landforms on soil erosion for the prevention and treatment of soil loss in a small watershed. The objective of this study was to evaluate the effects of landform factors on erosion rate by the {sup 137}Cs tracing method in a small watershed in the Purple Hilly Area of China. The erosion rates under different slope lengths, slope gradients and slope aspects were estimated in Xiangshuitan watershed in the Purple Hilly Area in Sichuan Basin by the {sup 137}Cs tracing method. The results showed that the erosion rate decreased exponentially with downslope distance, and it increased with increasing slope gradient during the scope of 5 deg. - 16 deg. The slope aspect had great impact on the erosion rate, and the hillside on the sunny slope had larger erosion rate than that on the shady slope, particularly for the farmland.

  6. Effects of landforms on the erosion rate in a small watershed by the 137Cs tracing method

    International Nuclear Information System (INIS)

    Li Mian; Yao Wenyi; Li Zhanbin; Liu Puling; Shen Zhenzhou

    2010-01-01

    It's very important to analyze and evaluate quantitatively the effects of landforms on soil erosion for the prevention and treatment of soil loss in a small watershed. The objective of this study was to evaluate the effects of landform factors on erosion rate by the 137 Cs tracing method in a small watershed in the Purple Hilly Area of China. The erosion rates under different slope lengths, slope gradients and slope aspects were estimated in Xiangshuitan watershed in the Purple Hilly Area in Sichuan Basin by the 137 Cs tracing method. The results showed that the erosion rate decreased exponentially with downslope distance, and it increased with increasing slope gradient during the scope of 5 deg. - 16 deg. The slope aspect had great impact on the erosion rate, and the hillside on the sunny slope had larger erosion rate than that on the shady slope, particularly for the farmland.

  7. The survey of preconditioners used for accelerating the rate of convergence in the Gauss-Seidel method

    Science.gov (United States)

    Niki, Hiroshi; Harada, Kyouji; Morimoto, Munenori; Sakakihara, Michio

    2004-03-01

    Several preconditioned iterative methods reported in the literature have been used for improving the convergence rate of the Gauss-Seidel method. In this article, on the basis of nonnegative matrix, comparisons between some splittings for such preconditioned matrices are derived. Simple numerical examples are also given.

  8. Prenotification, Incentives, and Survey Modality: An Experimental Test of Methods to Increase Survey Response Rates of School Principals

    Science.gov (United States)

    Jacob, Robin Tepper; Jacob, Brian

    2012-01-01

    Teacher and principal surveys are among the most common data collection techniques employed in education research. Yet there is remarkably little research on survey methods in education, or about the most cost-effective way to raise response rates among teachers and principals. In an effort to explore various methods for increasing survey response…

  9. Low-dose-rate total lymphoid irradiation: a new method of rapid immunosuppression

    International Nuclear Information System (INIS)

    Blum, J.E.; de Silva, S.M.; Rachman, D.B.; Order, S.E.

    1988-01-01

    Total Lymphoid Irradiation (TLI) has been successful in inducing immunosuppression in experimental and clinical applications. However, both the experimental and clinical utility of TLI are hampered by the prolonged treatment courses required (23 days in rats and 30-60 days in humans). Low-dose-rate TLI has the potential of reducing overall treatment time while achieving comparable immunosuppression. This study examines the immunosuppressive activity and treatment toxicity of conventional-dose-rate (23 days) vs low-dose-rate (2-7 days) TLI. Seven groups of Lewis rats were given TLI with 60Co. One group was treated at conventional-dose-rates (80-110 cGy/min) and received 3400 cGy in 17 fractions over 23 days. Six groups were treated at low-dose-rate (7 cGy/min) and received total doses of 800, 1200, 1800, 2400, 3000, and 3400 cGy over 2-7 days. Rats treated at conventional-dose-rates over 23 days and at low-dose-rate over 2-7 days tolerated radiation with minimal toxicity. The level of immunosuppression was tested using allogeneic (Brown-Norway) skin graft survival. Control animals retained allogeneic skin grafts for a mean of 14 days (range 8-21 days). Conventional-dose-rate treated animals (3400 cGy in 23 days) kept their grafts 60 days (range 50-66 days) (p less than .001). Low-dose-rate treated rats (800 to 3400 cGy total dose over 2-7 days) also had prolongation of allogeneic graft survival times following TLI with a dose-response curve established. The graft survival time for the 3400 cGy low-dose-rate group (66 days, range 52-78 days) was not significantly different from the 3400 cGy conventional-dose-rate group (p less than 0.10). When the total dose given was equivalent, low-dose-rate TLI demonstrated an advantage of reduced overall treatment time compared to conventional-dose-rate TLI (7 days vs. 23 days) with no increase in toxicity

  10. A High-Spin Rate Measurement Method for Projectiles Using a Magnetoresistive Sensor Based on Time-Frequency Domain Analysis.

    Science.gov (United States)

    Shang, Jianyu; Deng, Zhihong; Fu, Mengyin; Wang, Shunting

    2016-06-16

    Traditional artillery guidance can significantly improve the attack accuracy and overall combat efficiency of projectiles, which makes it more adaptable to the information warfare of the future. Obviously, the accurate measurement of artillery spin rate, which has long been regarded as a daunting task, is the basis of precise guidance and control. Magnetoresistive (MR) sensors can be applied to spin rate measurement, especially in the high-spin and high-g projectile launch environment. In this paper, based on the theory of a MR sensor measuring spin rate, the mathematical relationship model between the frequency of MR sensor output and projectile spin rate was established through a fundamental derivation. By analyzing the characteristics of MR sensor output whose frequency varies with time, this paper proposed the Chirp z-Transform (CZT) time-frequency (TF) domain analysis method based on the rolling window of a Blackman window function (BCZT) which can accurately extract the projectile spin rate. To put it into practice, BCZT was applied to measure the spin rate of 155 mm artillery projectile. After extracting the spin rate, the impact that launch rotational angular velocity and aspect angle have on the extraction accuracy of the spin rate was analyzed. Simulation results show that the BCZT TF domain analysis method can effectively and accurately measure the projectile spin rate, especially in a high-spin and high-g projectile launch environment.

  11. Evaluation of trauma care using TRISS method: the role of adjusted misclassification rate and adjusted w-statistic.

    Science.gov (United States)

    Llullaku, Sadik S; Hyseni, Nexhmi Sh; Bytyçi, Cen I; Rexhepi, Sylejman K

    2009-01-15

    Major trauma is a leading cause of death worldwide. Evaluation of trauma care using Trauma Injury and Injury Severity Score (TRISS) method is focused in trauma outcome (deaths and survivors). For testing TRISS method TRISS misclassification rate is used. Calculating w-statistic, as a difference between observed and TRISS expected survivors, we compare our trauma care results with the TRISS standard. The aim of this study is to analyze interaction between misclassification rate and w-statistic and to adjust these parameters to be closer to the truth. Analysis of components of TRISS misclassification rate and w-statistic and actual trauma outcome. The component of false negative (FN) (by TRISS method unexpected deaths) has two parts: preventable (Pd) and non-preventable (nonPd) trauma deaths. Pd represents inappropriate trauma care of an institution; otherwise nonpreventable trauma deaths represents errors in TRISS method. Removing patients with preventable trauma deaths we get an Adjusted misclassification rate: (FP + FN - Pd)/N or (b+c-Pd)/N. Substracting nonPd from FN value in w-statistic formula we get an Adjusted w-statistic: [FP-(FN - nonPd)]/N, respectively (FP-Pd)/N, or (b-Pd)/N). Because adjusted formulas clean method from inappropriate trauma care, and clean trauma care from the methods error, TRISS adjusted misclassification rate and adjusted w-statistic gives more realistic results and may be used in researches of trauma outcome.

  12. An application of the variable-r method to subpopulation growth rates in a 19th century agricultural population

    Directory of Open Access Journals (Sweden)

    Corey Sparks

    2009-07-01

    Full Text Available This paper presents an analysis of the differential growth rates of the farming and non-farming segments of a rural Scottish community during the 19th and early 20th centuries using the variable-r method allowing for net migration. Using this method, I find that the farming population of Orkney, Scotland, showed less variability in their reproduction and growth rates than the non-farming population during a period of net population decline. I conclude by suggesting that the variable-r method can be used in general cases where the relative growth of subpopulations or subpopulation reproduction is of interest.

  13. Generalized Bregman distances and convergence rates for non-convex regularization methods

    International Nuclear Information System (INIS)

    Grasmair, Markus

    2010-01-01

    We generalize the notion of Bregman distance using concepts from abstract convexity in order to derive convergence rates for Tikhonov regularization with non-convex regularization terms. In particular, we study the non-convex regularization of linear operator equations on Hilbert spaces, showing that the conditions required for the application of the convergence rates results are strongly related to the standard range conditions from the convex case. Moreover, we consider the setting of sparse regularization, where we show that a rate of order δ 1/p holds, if the regularization term has a slightly faster growth at zero than |t| p

  14. Mellin Transform Method for European Option Pricing with Hull-White Stochastic Interest Rate

    Directory of Open Access Journals (Sweden)

    Ji-Hun Yoon

    2014-01-01

    Full Text Available Even though interest rates fluctuate randomly in the marketplace, many option-pricing models do not fully consider their stochastic nature owing to their generally limited impact on option prices. However, stochastic dynamics in stochastic interest rates may have a significant impact on option prices as we take account of issues of maturity, hedging, or stochastic volatility. In this paper, we derive a closed form solution for European options in Black-Scholes model with stochastic interest rate using Mellin transform techniques.

  15. Structural correlation method for model reduction and practical estimation of patient specific parameters illustrated on heart rate regulation

    DEFF Research Database (Denmark)

    Ottesen, Johnny T.; Mehlsen, Jesper; Olufsen, Mette

    2014-01-01

    We consider the inverse and patient specific problem of short term (seconds to minutes) heart rate regulation specified by a system of nonlinear ODEs and corresponding data. We show how a recent method termed the structural correlation method (SCM) can be used for model reduction and for obtaining...... a set of practically identifiable parameters. The structural correlation method includes two steps: sensitivity and correlation analysis. When combined with an optimization step, it is possible to estimate model parameters, enabling the model to fit dynamics observed in data. This method is illustrated...... in detail on a model predicting baroreflex regulation of heart rate and applied to analysis of data from a rat and healthy humans. Numerous mathematical models have been proposed for prediction of baroreflex regulation of heart rate, yet most of these have been designed to provide qualitative predictions...

  16. Improvement of life prediction accuracy by introduction of strain-rate effect into modified ductility exhaustion method

    International Nuclear Information System (INIS)

    Takahashi, Yukio

    1994-01-01

    It is important to use a reliable creep-fatigue damage evaluation method to prevent failures due to creep-fatigue damage accumulated during operation life in the structural design for fast breeder reactor plants. In this study, slow strain-rate fatigue tests were conducted for SUS316 steel for fast breeder application (316FR) and the improvement of creep-fatigue life estimation method was proposed based on test results. Main results can be summarized as follows: (1) In the slow strain-rate fatigue tests, life reduction caused by creep damage was observed as in the case of strain-hold creep-fatigue tests. (2) Strain-rate dependency of creep damage was introduced into the modified ductility exhaustion method previously proposed by the author. Good agreement of predicted lives with observed lives was achieved for SUS304 and 316FR steels with the method proposed here. (author)

  17. Comparison of hurricane exposure methods and associations with county fetal death rates, adjusting for environmental quality

    Science.gov (United States)

    Adverse effects of hurricanes are increasing as coastal populations grow and events become more severe. Hurricane exposure during pregnancy can influence fetal death rates through mechanisms related to healthcare, infrastructure disruption, nutrition, and injury. Estimation of hu...

  18. A rate-jump method for characterization of soft tissues using nanoindentation techniques

    KAUST Repository

    Tang, Bin; Ngan, Alfonso H W

    2012-01-01

    routinely used to analyze experimental data. In this article, a novel rate-jump protocol for treating viscoelasticity in nanomechanical data analysis is described. © 2012 The Royal Society of Chemistry.

  19. High power pulsed magnetron sputtering: A method to increase deposition rate

    International Nuclear Information System (INIS)

    Raman, Priya; McLain, Jake; Ruzic, David N; Shchelkanov, Ivan A.

    2015-01-01

    High power pulsed magnetron sputtering (HPPMS) is a state-of-the-art physical vapor deposition technique with several industrial applications. One of the main disadvantages of this process is its low deposition rate. In this work, the authors report a new magnetic field configuration, which produces deposition rates twice that of conventional magnetron's dipole magnetic field configuration. Three different magnet pack configurations are discussed in this paper, and an optimized magnet pack configuration for HPPMS that leads to a higher deposition rate and nearly full-face target erosion is presented. The discussed magnetic field produced by a specially designed magnet assembly is of the same size as the conventional magnet assembly and requires no external fields. Comparison of deposition rates with different power supplies and the electron trapping efficiency in complex magnetic field arrangements are discussed

  20. Verification on the use of the Inoue method for precisely determining glomerular filtration rate in Philippine pediatrics

    Science.gov (United States)

    Magcase, M. J. D. J.; Duyan, A. Q.; Carpio, J.; Carbonell, C. A.; Trono, J. D.

    2015-06-01

    The objective of this study is to validate the Inoue method so that it would be the preferential choice in determining glomerular filtration rate (GFR) in Philippine pediatrics. The study consisted of 36 patients ranging from ages 2 months to 19 years old. The subjects used were those who were previously subjected to in-vitro method. The scintigrams of the invitro method was obtained and processed for split percentage uptake and for parameters needed to obtain Inoue GFR. The result of this paper correlates the Inoue GFR and In-vitro method (r = 0.926). Thus, Inoue method is a viable, simple, and practical technique in determining GFR in pediatric patients.

  1. Calculation methods for dissolution rate of multicomponent alloys during electrochemical machining

    International Nuclear Information System (INIS)

    Dikusar, A.I.; Petrenko, V.I.; Dikusar, G.K.; Ehngel'gardt, G.R.; Michukova, N.Yu.

    1981-01-01

    The possibility of theoretical calculation of metal dissolution rate during electrochemical mashining is considered. Two calculation techniques are compared at the example of two-component W-Re, Ni-W, Mo-Re alloys, namely: ''charge superposition'' and ''weight percents''. It is concluded that the technique of ''charge superposition'' is the only grounded calculation technique of specific rates of dissolution for alloys [ru

  2. Inverse methods for the mechanical characterization of materials at high strain rates

    Directory of Open Access Journals (Sweden)

    Casas-Rodriguez J.P.

    2012-08-01

    Full Text Available Mechanical material characterization represents a research challenge. Furthermore, special attention is directed to material characterization at high strain rates as the mechanical properties of some materials are influenced by the rate of loading. Diverse experimental techniques at high strain rates are available, such as the drop-test, the Taylor impact test or the Split Hopkinson pressure bar among others. However, the determination of the material parameters associated to a given mathematical constitutive model from the experimental data is a complex and indirect problem. This paper presents a material characterization methodology to determine the material parameters of a given material constitutive model from a given high strain rate experiment. The characterization methodology is based on an inverse technique in which an inverse problem is formulated and solved as an optimization procedure. The input of the optimization procedure is the characteristic signal from the high strain rate experiment. The output of the procedure is the optimum set of material parameters determined by fitting a numerical simulation to the high strain rate experimental signal.

  3. Determination of Strain Rate Sensitivity of Micro-struts Manufactured Using the Selective Laser Melting Method

    Science.gov (United States)

    Gümrük, Recep; Mines, R. A. W.; Karadeniz, Sami

    2018-03-01

    Micro-lattice structures manufactured using the selective laser melting (SLM) process provides the opportunity to realize optimal cellular materials for impact energy absorption. In this paper, strain rate-dependent material properties are measured for stainless steel 316L SLM micro-lattice struts in the strain rate range of 10-3 to 6000 s-1. At high strain rates, a novel version of the split Hopkinson Bar has been developed. Strain rate-dependent materials data have been used in Cowper-Symonds material model, and the scope and limit of this model in the context of SLM struts have been discussed. Strain rate material data and the Cowper-Symonds model have been applied to the finite element analysis of a micro-lattice block subjected to drop weight impact loading. The model output has been compared to experimental results, and it has been shown that the increase in crush stress due to impact loading is mainly the result of strain rate material behavior. Hence, a systematic methodology has been developed to investigate the impact energy absorption of a micro-lattice structure manufactured using additive layer manufacture (SLM). This methodology can be extended to other micro-lattice materials and configurations, and to other impact conditions.

  4. Monitoring method for an ambient Gamma exposure rate and its measurement analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Mo Sung [Cheongju Univ., Cheongju (Korea, Republic of); Woo, Jong Kwan [University of Seoul, Seoul (Korea, Republic of)

    2006-12-15

    Daily and seasonal variations of the ambient gamma ray exposure rates were measured by using a pressurized ion chamber from January 2003 to December 2005 in the Cheongju Regional Radiation Monitoring Post and the patterns of the distributions were studied. The annual average of the daily variation of the exposure rate was {approx}0.17 {mu}R/h. The exposure rate was found to be maximum during 8:00 am to 9:00 am and minimum during 8:00 pm to 10:00 pm. For the annual data, the exposure rate was the minimum during the month of February. The exposure rate increased from February to mid-October (except during the period from May to July with no change) and decreased from October to February. The seasonal variation was found to be about 1 {mu}R/h. Most of the measured values (96%) of the exposure rates fell under the normal distribution with a deviation of less than 4.8% and the remaining 4% had large fluctuations caused mainly by the rainfalls.

  5. Modeling dose-rate on/over the surface of cylindrical radio-models using Monte Carlo methods

    International Nuclear Information System (INIS)

    Xiao Xuefu; Ma Guoxue; Wen Fuping; Wang Zhongqi; Wang Chaohui; Zhang Jiyun; Huang Qingbo; Zhang Jiaqiu; Wang Xinxing; Wang Jun

    2004-01-01

    Objective: To determine the dose-rates on/over the surface of 10 cylindrical radio-models, which belong to the Metrology Station of Radio-Geological Survey of CNNC. Methods: The dose-rates on/over the surface of 10 cylindrical radio-models were modeled using the famous Monte Carlo code-MCNP. The dose-rates on/over the surface of 10 cylindrical radio-models were measured by a high gas pressurized ionization chamber dose-rate meter, respectively. The values of dose-rate modeled using MCNP code were compared with those obtained by authors in the present experimental measurement, and with those obtained by other workers previously. Some factors causing the discrepancy between the data obtained by authors using MCNP code and the data obtained using other methods are discussed in this paper. Results: The data of dose-rates on/over the surface of 10 cylindrical radio-models, obtained using MCNP code, were in good agreement with those obtained by other workers using the theoretical method. They were within the discrepancy of ±5% in general, and the maximum discrepancy was less than 10%. Conclusions: As if each factor needed for the Monte Carlo code is correct, the dose-rates on/over the surface of cylindrical radio-models modeled using the Monte Carlo code are correct with an uncertainty of 3%

  6. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75069 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germination... rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr06 101.1-107.3 3.68 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  7. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75066 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germination... rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr04 65.1-81.9 2.15 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  8. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75072 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germination... rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr08 72.6-87.8 2.32 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  9. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75075 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germination... rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr12 49.5-63.0 2.54 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  10. Assessment of interchangeability rate between 2 methods of measurements: An example with a cardiac output comparison study.

    Science.gov (United States)

    Lorne, Emmanuel; Diouf, Momar; de Wilde, Robert B P; Fischer, Marc-Olivier

    2018-02-01

    The Bland-Altman (BA) and percentage error (PE) methods have been previously described to assess the agreement between 2 methods of medical or laboratory measurements. This type of approach raises several problems: the BA methodology constitutes a subjective approach to interchangeability, whereas the PE approach does not take into account the distribution of values over a range. We describe a new methodology that defines an interchangeability rate between 2 methods of measurement and cutoff values that determine the range of interchangeable values. We used a simulated data and a previously published data set to demonstrate the concept of the method. The interchangeability rate of 5 different cardiac output (CO) pulse contour techniques (Wesseling method, LiDCO, PiCCO, Hemac method, and Modelflow) was calculated, in comparison with the reference pulmonary artery thermodilution CO using our new method. In our example, Modelflow with a good interchangeability rate of 93% and a cutoff value of 4.8 L min, was found to be interchangeable with the thermodilution method for >95% of measurements. Modelflow had a higher interchangeability rate compared to Hemac (93% vs 86%; P = .022) or other monitors (Wesseling cZ = 76%, LiDCO = 73%, and PiCCO = 62%; P < .0001). Simulated data and reanalysis of a data set comparing 5 CO monitors against thermodilution CO showed that, depending on the repeatability of the reference method, the interchangeability rate combined with a cutoff value could be used to define the range of values over which interchangeability remains acceptable.

  11. Development of a Self-Rated Mixed Methods Skills Assessment: The NIH Mixed Methods Research Training Program for the Health Sciences

    Science.gov (United States)

    Guetterman, Timothy C.; Creswell, John W.; Wittink, Marsha; Barg, Fran K.; Castro, Felipe G.; Dahlberg, Britt; Watkins, Daphne C.; Deutsch, Charles; Gallo, Joseph J.

    2017-01-01

    Introduction Demand for training in mixed methods is high, with little research on faculty development or assessment in mixed methods. We describe the development of a Self-Rated Mixed Methods Skills Assessment and provide validity evidence. The instrument taps six research domains: “Research question,” “Design/approach,” “Sampling,” “Data collection,” “Analysis,” and “Dissemination.” Respondents are asked to rate their ability to define or explain concepts of mixed methods under each domain, their ability to apply the concepts to problems, and the extent to which they need to improve. Methods We administered the questionnaire to 145 faculty and students using an internet survey. We analyzed descriptive statistics and performance characteristics of the questionnaire using Cronbach’s alpha to assess reliability and an ANOVA that compared a mixed methods experience index with assessment scores to assess criterion-relatedness. Results Internal consistency reliability was high for the total set of items (.95) and adequate (>=.71) for all but one subscale. Consistent with establishing criterion validity, respondents who had more professional experiences with mixed methods (e.g., published a mixed methods paper) rated themselves as more skilled, which was statistically significant across the research domains. Discussion This Self-Rated Mixed Methods Assessment instrument may be a useful tool to assess skills in mixed methods for training programs. It can be applied widely at the graduate and faculty level. For the learner, assessment may lead to enhanced motivation to learn and training focused on self-identified needs. For faculty, the assessment may improve curriculum and course content planning. PMID:28562495

  12. Method for the determination of the radon entry rate inside buildings; Methodik zur Bestimmung der Radonquellstaerke in Gebaeuden

    Energy Technology Data Exchange (ETDEWEB)

    Neugebauer, T.; Hingmann, H.; Buermeyer, J.; Grimm, V.; Spruck, K.; Breckow, J. [Technische Hochschule Mittelhessen (THM), Giessen (Germany). Inst. fuer Medizinische Physik und Strahlenschutz (IMPS)

    2016-07-01

    The radon entry rate describes the radon characteristics of a building, which are defined by its constructional condition (tightness of building envelope) and the geological realities (radon soil gas concentration). All possible radon sources of a building are considered. The determination of the radon entry rate is based on the measurement of the radon concentration inside a building and the determination of the air change rate. The air change rate can be calculated via several approaches, VDI 4300-7 provides the most common methods. The main approaches are based on the use of a tracer gas, which concentration is measured over the time. In a first attempt, a one-time and punctual injection of a tracer gas was used. A disadvantage was that the air change rate could be determined only for short periods. In the follow-up, the constant injection of a tracer gas at multiple spots was executed. With this method, it is possible to calculate the air change rate over several weeks on a continuous base; the data can be used to determine the radon entry rate. Based on those series of measurements a first analysis of possible dependencies of the radon entry rate was performed.

  13. PINP: a new method of tagging neuronal populations for identification during in vivo electrophysiological recording.

    Directory of Open Access Journals (Sweden)

    Susana Q Lima

    Full Text Available Neural circuits are exquisitely organized, consisting of many different neuronal subpopulations. However, it is difficult to assess the functional roles of these subpopulations using conventional extracellular recording techniques because these techniques do not easily distinguish spikes from different neuronal populations. To overcome this limitation, we have developed PINP (Photostimulation-assisted Identification of Neuronal Populations, a method of tagging neuronal populations for identification during in vivo electrophysiological recording. The method is based on expressing the light-activated channel channelrhodopsin-2 (ChR2 to restricted neuronal subpopulations. ChR2-tagged neurons can be detected electrophysiologically in vivo since illumination of these neurons with a brief flash of blue light triggers a short latency reliable action potential. We demonstrate the feasibility of this technique by expressing ChR2 in distinct populations of cortical neurons using two different strategies. First, we labeled a subpopulation of cortical neurons-mainly fast-spiking interneurons-by using adeno-associated virus (AAV to deliver ChR2 in a transgenic mouse line in which the expression of Cre recombinase was driven by the parvalbumin promoter. Second, we labeled subpopulations of excitatory neurons in the rat auditory cortex with ChR2 based on projection target by using herpes simplex virus 1 (HSV1, which is efficiently taken up by axons and transported retrogradely; we find that this latter population responds to acoustic stimulation differently from unlabeled neurons. Tagging neurons is a novel application of ChR2, used in this case to monitor activity instead of manipulating it. PINP can be readily extended to other populations of genetically identifiable neurons, and will provide a useful method for probing the functional role of different neuronal populations in vivo.

  14. Growth rates in modern speleothems from Santana Cave, Brazil, by the 210Pb-method

    International Nuclear Information System (INIS)

    Bonotto, D.M.; Karmann, I.; Baskaran, M.M.

    2012-01-01

    The Santana Cave is located at the Upper Ribeira Touristic State Park (PETAR-Parque Estadual Turístico do Alto Ribeira) in southern São Paulo State, Brazil. This paper describes 210 Pb activity concentration data in soda straw stalactites samples collected at Salão das Flores in Santana Cave that is a fossil tributary of the cave river. Non-expensive alpha counting following some analytical steps for extracting and depositing 210 Po were used for providing the 210 Pb data. In the analyzed samples, 210 Pb values of increasingly older samples fitted an exponential curve, thus suggesting that the production of 210 Pb has been constant with time. Also, the near-ideal fit indicated that the growth was uniform and there was no break in the continuous growth. The soda straw growth rates were determined from the best fit to the exponential curve through the 210 Pb activity concentration. The results of the measurements allowed estimate a longitudinal rate corresponding to 1.3 mm/yr and a lateral rate of 0.01 mm/yr, which permitted calculate times of 70 years and 317–498 years for their formation, respectively. The lateral growth rate is compatible with values from studies of chemical weathering rates held under laboratory and natural conditions.

  15. Probing the effect of human normal sperm morphology rate on cycle outcomes and assisted reproductive methods selection.

    Directory of Open Access Journals (Sweden)

    Bo Li

    Full Text Available Sperm morphology is the best predictor of fertilization potential, and the critical predictive information for supporting assisted reproductive methods selection. Given its important predictive value and the declining reality of semen quality in recent years, the threshold of normal sperm morphology rate (NSMR is being constantly corrected and controversial, from the 4th edition (14% to the 5th version (4%. We retrospectively analyzed 4756 cases of infertility patients treated with conventional-IVF(c-IVF or ICSI, which were divided into three groups according to NSMR: ≥14%, 4%-14% and <4%. Here, we demonstrate that, with decrease in NSMR(≥14%, 4%-14%, <4%, in the c-IVF group, the rate of fertilization, normal fertilization, high-quality embryo, multi-pregnancy and birth weight of twins gradually decreased significantly (P<0.05, while the miscarriage rate was significantly increased (p<0.01 and implantation rate, clinical pregnancy rate, ectopic pregnancy rate, preterm birth rate, live birth rate, sex ratio, and birth weight(Singleton showed no significant change. In the ICSI group, with decrease in NSMR (≥14%, 4%-14%, <4%, high-quality embryo rate, multi-pregnancy rate and birth weight of twins were gradually decreased significantly (p<0.05, while other parameters had no significant difference. Considering the clinical assisted methods selection, in the NFMR ≥14% group, normal fertilization rate of c-IVF was significantly higher than the ICSI group (P<0.05, in the 4%-14% group, birth weight (twins of c-IVF were significantly higher than the ICSI group, in the <4% group, miscarriage of IVF was significantly higher than the ICSI group. Therefore, we conclude that NSMR is positively related to embryo reproductive potential, and when NSMR<4% (5th edition, ICSI should be considered first, while the NSMR≥4%, c-IVF assisted reproduction might be preferred.

  16. Accretion rate in mangroves sediment at Sungai Miang, Pahang, Malaysia: 230Thexcess versus artificial horizon marker method

    International Nuclear Information System (INIS)

    Kamaruzzaman Yunus; Jamil Tajam; Hasrizal Shaari; Noor Azhar Mohd Shazili; Misbahul Mohd Amin

    2008-01-01

    Mangroves have enormous ecological value and one of their important role is to act as an efficient sediment trappers which dominantly supplied by rivers and the atmosphere to the oceans. Applying the 230 Th excess method, an average accretion rate of 0.54 cm yr -1 was obtained. this is comparable to that of an artificial horizon marker method giving an average of 0.54 cm yr -1 . The 230 Th excess method provides a rapid and simple method of evaluating 230 Th excess accumulation histories in sediment cores. Sample preparation is also significantly simplified, thus providing a relatively quick and easy method for the determination of the accretion rate in mangrove area. (author)

  17. Effects of test method and participant musical training on preference ratings of stimuli with different reverberation times.

    Science.gov (United States)

    Lawless, Martin S; Vigeant, Michelle C

    2017-10-01

    Selecting an appropriate listening test design for concert hall research depends on several factors, including listening test method and participant critical-listening experience. Although expert listeners afford more reliable data, their perceptions may not be broadly representative. The present paper contains two studies that examined the validity and reliability of the data obtained from two listening test methods, a successive and a comparative method, and two types of participants, musicians and non-musicians. Participants rated their overall preference of auralizations generated from eight concert hall conditions with a range of reverberation times (0.0-7.2 s). Study 1, with 34 participants, assessed the two methods. The comparative method yielded similar results and reliability as the successive method. Additionally, the comparative method was rated as less difficult and more preferable. For study 2, an additional 37 participants rated the stimuli using the comparative method only. An analysis of variance of the responses from both studies revealed that musicians are better than non-musicians at discerning their preferences across stimuli. This result was confirmed with a k-means clustering analysis on the entire dataset that revealed five preference groups. Four groups exhibited clear preferences to the stimuli, while the fifth group, predominantly comprising non-musicians, demonstrated no clear preference.

  18. The long-run dynamic relationship between exchange rate and its attention index: Based on DCCA and TOP method

    Science.gov (United States)

    Wang, Xuan; Guo, Kun; Lu, Xiaolin

    2016-07-01

    The behavior information of financial market plays a more and more important role in modern economic system. The behavior information reflected in INTERNET search data has already been used in short-term prediction for exchange rate, stock market return, house price and so on. However, the long-run relationship between behavior information and financial market fluctuation has not been studied systematically. Further, most traditional statistic methods and econometric models could not catch the dynamic and non-linear relationship. An attention index of CNY/USD exchange rate is constructed based on search data from 360 search engine of China in this paper. Then the DCCA and Thermal Optimal Path methods are used to explore the long-run dynamic relationship between CNY/USD exchange rate and the corresponding attention index. The results show that the significant interdependency exists and the change of exchange rate is 1-2 days lag behind the attention index.

  19. A new method for calculating energy release rate in tunnel excavation subjected to high in situ stress

    Directory of Open Access Journals (Sweden)

    Xiao Qinghua

    2016-03-01

    Full Text Available Based on energy theory, energy release rate (EER and local energy release rate (LEER, a new index called FERR (Fractional Energy Release Rate is proposed, and this method can not only evaluate the risk of rock burst, but also can point out the location of high risk and the scale of rockburst. The FERR index is applied to the TBM assembling tunnel in Jinping Hydro Power Station II to evaluate the scale and intensity of rockburst, as well as the location where rockburst occurs. With FDM method adopted, the energy release rate of 3 excavation plans are calculated and the scale and risk of rockburst is evaluated, and the location of high risk of rockburst is also mapped. With FERR used in the evaluation, the rockburst is nicely controlled which ensured the safety and construction schedule of the project.

  20. Estimating the erosion and deposition rates in a small watershed by the 137Cs tracing method

    International Nuclear Information System (INIS)

    Li Mian; Li Zhanbin; Yao Wenyi; Liu Puling

    2009-01-01

    Understanding the erosion and deposition rates in a small watershed is important for designing soil and water conservation measures. The objective of this study is to estimate the net soil loss and gain at points with various land use types and landform positions in a small watershed in the Sichuan Hilly Basin of China by the 137 Cs tracing technique. Among various land use types, the order of erosion rate was bare rock > sloping cultivated land > forest land. The paddy field and Caotu (a kind of cultivated land located at the foot of hills) were depositional areas. The erosion rate under different landform was in this order: hillside > saddle > hilltop. The footslope and the valley were depositional areas. The 137 Cs technique was shown to provide an effective means of documenting the spatial distribution of soil erosion and deposition within the small watershed

  1. Development of a Self-Rated Mixed Methods Skills Assessment: The National Institutes of Health Mixed Methods Research Training Program for the Health Sciences.

    Science.gov (United States)

    Guetterman, Timothy C; Creswell, John W; Wittink, Marsha; Barg, Fran K; Castro, Felipe G; Dahlberg, Britt; Watkins, Daphne C; Deutsch, Charles; Gallo, Joseph J

    2017-01-01

    Demand for training in mixed methods is high, with little research on faculty development or assessment in mixed methods. We describe the development of a self-rated mixed methods skills assessment and provide validity evidence. The instrument taps six research domains: "Research question," "Design/approach," "Sampling," "Data collection," "Analysis," and "Dissemination." Respondents are asked to rate their ability to define or explain concepts of mixed methods under each domain, their ability to apply the concepts to problems, and the extent to which they need to improve. We administered the questionnaire to 145 faculty and students using an internet survey. We analyzed descriptive statistics and performance characteristics of the questionnaire using the Cronbach alpha to assess reliability and an analysis of variance that compared a mixed methods experience index with assessment scores to assess criterion relatedness. Internal consistency reliability was high for the total set of items (0.95) and adequate (≥0.71) for all but one subscale. Consistent with establishing criterion validity, respondents who had more professional experiences with mixed methods (eg, published a mixed methods article) rated themselves as more skilled, which was statistically significant across the research domains. This self-rated mixed methods assessment instrument may be a useful tool to assess skills in mixed methods for training programs. It can be applied widely at the graduate and faculty level. For the learner, assessment may lead to enhanced motivation to learn and training focused on self-identified needs. For faculty, the assessment may improve curriculum and course content planning.

  2. Collecting Information for Rating Global Assessment of Functioning (GAF): Sources of Information and Methods for Information Collection.

    Science.gov (United States)

    I H, Monrad Aas

    2014-11-01

    Global Assessment of Functioning (GAF) is an assessment instrument that is known worldwide. It is widely used for rating the severity of illness. Results from evaluations in psychiatry should characterize the patients. Rating of GAF is based on collected information. The aim of the study is to identify the factors involved in collecting information that is relevant for rating GAF, and gaps in knowledge where it is likely that further development would play a role for improved scoring. A literature search was conducted with a combination of thorough hand search and search in the bibliographic databases PubMed, PsycINFO, Google Scholar, and Campbell Collaboration Library of Systematic Reviews. Collection of information for rating GAF depends on two fundamental factors: the sources of information and the methods for information collection. Sources of information are patients, informants, health personnel, medical records, letters of referral and police records about violence and substance abuse. Methods for information collection include the many different types of interview - unstructured, semi-structured, structured, interviews for Axis I and II disorders, semistructured interviews for rating GAF, and interviews of informants - as well as instruments for rating symptoms and functioning, and observation. The different sources of information, and methods for collection, frequently result in inconsistencies in the information collected. The variation in collected information, and lack of a generally accepted algorithm for combining collected information, is likely to be important for rated GAF values, but there is a fundamental lack of knowledge about the degree of importance. Research to improve GAF has not reached a high level. Rated GAF values are likely to be influenced by both the sources of information used and the methods employed for information collection, but the lack of research-based information about these influences is fundamental. Further development of

  3. Building the Method to Determine the Rate of Freezing Water in Penaeus monodon of the Freezing Process

    OpenAIRE

    Nguyen Tan Dzung; Trinh Van Dzung; Tran Duc Ba

    2012-01-01

    The method of determination the rate of freezing water in Penaeus monodon of freezing process was established on base the equation of energy balance in warming up process Penaeus monodon after freezing to determine specific heat of Penaeus monodon. The result obtained was built the mathematical model (19) to determine the rate of freezing water according to the freezing temperature of Penaeus monodon. The results indicated that when water was completely frozen (ω = 1 or 100%), the optimal fre...

  4. How Well Can We Detect Lineage-Specific Diversification-Rate Shifts? A Simulation Study of Sequential AIC Methods.

    Science.gov (United States)

    May, Michael R; Moore, Brian R

    2016-11-01

    Evolutionary biologists have long been fascinated by the extreme differences in species numbers across branches of the Tree of Life. This has motivated the development of statistical methods for detecting shifts in the rate of lineage diversification across the branches of phylogenic trees. One of the most frequently used methods, MEDUSA, explores a set of diversification-rate models, where each model assigns branches of the phylogeny to a set of diversification-rate categories. Each model is first fit to the data, and the Akaike information criterion (AIC) is then used to identify the optimal diversification model. Surprisingly, the statistical behavior of this popular method is uncharacterized, which is a concern in light of: (1) the poor performance of the AIC as a means of choosing among models in other phylogenetic contexts; (2) the ad hoc algorithm used to visit diversification models, and; (3) errors that we reveal in the likelihood function used to fit diversification models to the phylogenetic data. Here, we perform an extensive simulation study demonstrating that MEDUSA (1) has a high false-discovery rate (on average, spurious diversification-rate shifts are identified [Formula: see text] of the time), and (2) provides biased estimates of diversification-rate parameters. Understanding the statistical behavior of MEDUSA is critical both to empirical researchers-in order to clarify whether these methods can make reliable inferences from empirical datasets-and to theoretical biologists-in order to clarify the specific problems that need to be solved in order to develop more reliable approaches for detecting shifts in the rate of lineage diversification. [Akaike information criterion; extinction; lineage-specific diversification rates; phylogenetic model selection; speciation.]. © The Author(s) 2016. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.

  5. Method for calculation of upper limit internal alpha dose rates to aquatic organisms with application of plutonium-239 in plankton

    International Nuclear Information System (INIS)

    Paschoa, A.S.; Baptista, G.B.

    1977-01-01

    A method for the calculation of upper limit internal alpha dose rates to aquatic organisms is presented. The mean alpha energies per disintegration of radionuclides of interest are listed to be used in standard methodologies to calculate dose to aquatic biota. As an application, the upper limits for the alpha dose rates from 239 Pu to the total body of plankton are estimated based on data available in open literature [pt

  6. A Study of Japanese Consumption Tax System : Mainly on Multiple Tax Rates and Input Tax Credit Methods

    OpenAIRE

    栗原, 克文

    2007-01-01

    One of the most important discussions on Japanese tax system reform includes how consumption tax (Value-added tax) system ought to be. Facing issues like depopulation, aging society and large budget deficit, consumption tax can be an effective source of revenue to secure social security. This article mainly focuses on multiple tax rates and input tax credit methods of Japanese consumption tax system. Because of regressive nature of consumption tax, tax rate reduction, exemption on foodstuffs ...

  7. A Comparison of Affect Ratings Obtained with Ecological Momentary Assessment and the Day Reconstruction Method

    Science.gov (United States)

    Dockray, Samantha; Grant, Nina; Stone, Arthur A.; Kahneman, Daniel; Wardle, Jane; Steptoe, Andrew

    2010-01-01

    Measurement of affective states in everyday life is of fundamental importance in many types of quality of life, health, and psychological research. Ecological momentary assessment (EMA) is the recognized method of choice, but the respondent burden can be high. The day reconstruction method (DRM) was developed by Kahneman and colleagues ("Science,"…

  8. Methods and Rates of Punishment Implemented by Families to Enuretic Children in Turkey

    Directory of Open Access Journals (Sweden)

    M. Ihsan Karaman

    2013-06-01

    Full Text Available Purpose Nocturnal enuresis is a serious health problem affecting a significant portion of the population. In this study, we investigated the frequency of punishment methods in nocturnal enuresis (NE in Turkey and its relationship with other parameters. Materials and Methods A total of 501 children (301 boys and 200 girls who were admitted to our outpatient clinic due to nocturnal enuresis were included in the study. Mean age was 9.39 years (range 5-18. Prepared questionnaire form inquiring educational status of the family, frequency and implementation and duration of punishment methods was applied to patients and families. Results At least one punishment method was applied to 291 (58.1% of children with NE. Punishment methods of parents were detected as condemnation (257 patients, 51.3%, depriving desires of the child (120 patients, 23.9%, humiliating the child in the presence of other children (113 patients, 22.6%, reprimanding- threatening with punishment (203 patients, 40.5%. This application was found to continue for longer than 1 year in 52% of punished children. Families graduated of high school and above were found to use punishment methods significantly more than others. Conclusion According to the results of our study, a quite high proportion of enuretic children were detected to be exposed to punishment methods. Even, some parents consider that these methods are a part of nocturnal enuresis treatment. We, the doctors, should endeavor more for raising awareness of the community in order to diminish this worrisome behavior.

  9. Changes in hospitalization rate and mortality after acute myocardial infarction in Denmark after diagnostic criteria and methods changed

    DEFF Research Database (Denmark)

    Abildstrøm, Steen Zabell; Rasmussen, Søren; Madsen, Mette

    2004-01-01

    AIMS: To analyse the effect of the change in diagnostic criteria for acute myocardial infarction (AMI) and the use of troponin as a diagnostic marker on the hospitalization rate and mortality of hospitalized AMI patients from 1994 to 2001. METHODS AND RESULTS: Patients (> or =30 years) admitted...... for their first AMI were identified using the National Patient Registry in Denmark. We registered when each hospital introduced troponin as a diagnostic marker. The reported hospitalization rate decreased until 1998 and then increased substantially from 1999 to 2001 from 3472 to 4163 per million inhabitants (19.......9%) for men and from 1648 to 2020 per million inhabitants (22.6%) for women. Troponin use was associated with a significant 14% increase in hospitalization rate in this period [rate ratio 1.14, 95% confidence interval (CI) 1.11-1.18]. The effect of troponin was greatest among patients 70 years and older (rate...

  10. Method for measuring the decay rate of a radionuclide emitting β-rays in a liquid sample

    International Nuclear Information System (INIS)

    Horrocks, D.

    1977-01-01

    With this method the decay rate of a radionuclide emitting β-rays, e.g. 3 H or 14 C, in a liquid sample can be measured by means of liquid scintillation counters, at least two different versions of the sample being used with quench effect (shifting of the Compton spectrum). For this purpose each sample is counted with and without a radioactive standard source, e.g. 137 Cs. Then a pulse height will be determined corresponding to a selected point in the pulse height spectrum if the standard source is present. The determination of a zero-threshold sample count rate is then performed by counting the sample in a counting window. In addition standardized values of the measured pulse heights are derived and put in mathematical relation to corresponding pulse count rates, the pulse count rate for a standardized pulse height value thus becoming zero and the sample decay rate in this way being determined. (DG) 891 HP [de

  11. Study of Continuance Rate and Related Causes of Discontinuance of Pregnancy Prevention Methods among Women in Yazd

    Directory of Open Access Journals (Sweden)

    H Fallahzadeh

    2008-04-01

    Full Text Available Introduction: From maturity to menopause, women are worried about pregnancy. Abstinence from sex or use of pregnancy prevention methods are choices for them. As abstinence is impossible, the only remaining choice is use of pregnancy prevention methods. Effective control of pregnancy is really essential for the health of mother and infant and also control of unplanned increase in population. Regarding the importance of continuance rate of pregnancy prevention methods (OCP, IUD, Condom &DMPA & the reasons for their disruption, this study was carried out with the aim of determining the continuance rate and reasons for discontinuance of pregnancy prevention methods in Yazd women. Methods: This was a cross-sectional study. Six urban health care centers of Yazd were selected as study clusters and information of 15-49 year old women using the pregnancy prevention methods (OCP, IUD, Condom& injection was collected via a questionnaire. The data collected was analyzed by Coplan- Mayer statistic method and variance analysis test. Results: Pregnancy prevention methods were most prevalent in the 25-34 years old age group (57%. Mean duration of pregnancy prevention method usage was 27.98 months using Caplan-mayer method with a median of 24 months. 86.3% for 6 months, 72.8% for 12 months, 62.5% for 18 months, 47.9% for 24 months, 39.9% for 30 months and 37% for 37 months had used four certain methods of pregnancy prevention (OCP, IUD, Condom and Injection. The reasons of discontinuance were disease (15.6% for OCPS, bleeding (27% for IUD, unwanted pregnancy (21% for Condoms and also disease (75% for Injection method. Discussion: According to the results, not only education programs regarding family planning before starting each pregnancy prevention method to women is recommended, but a complete incentive consultation about these methods is essential. This educational & consultation programs should be implemented initially for women using OCP method.

  12. Methods and sensitivity for pass-by measurement of track decay rates

    NARCIS (Netherlands)

    Dittrich, M.G.

    2012-01-01

    Track decay rates are measured to characterize the track dynamics for railway noise type testing, but also for other purposes in relation to railway noise. They are often measured statically using hammer response functions on unloaded track, but can also be derived from rail vibrations on loaded

  13. Comparative evaluation of quantitative glomerular filtration rate measured by isotopic and nonisotopic methods

    International Nuclear Information System (INIS)

    Balachandran, S.; Toguri, A.G.; Petrusick, T.W.; Abbott, L.C.

    1981-01-01

    Good correlation of glomerular filtration rate (GFR) measured isotopically from plasma disappearance of Tc-99m-DTPA (Sn) was shown with inulin clearance, creatinine clearance, and graded radionuclide imaging. The isotopic GFR is a simple, urineless technique not requiring continuous infusion that enables one to perform simultaneous renal imaging with one radiotracer

  14. A new method for measuring bioturbation rates in sandy tidal flat sediments based on luminescence dating

    DEFF Research Database (Denmark)

    Madsen, Anni T.; Murray, Andrew S.; Jain, Mayank

    2011-01-01

    The rates of post-depositional mixing by bioturbation have been investigated using Optically Stimulated Luminescence (OSL) dating in two sediment cores (BAL2 and BAL5), retrieved from a sandy tidal flat in the Danish part of the Wadden Sea. A high-resolution chronology, consisting of thirty-six OSL...

  15. Phonon conductivity and relaxation rate in solids with disturbances by the Green function method

    International Nuclear Information System (INIS)

    Singh, M.

    1980-09-01

    In this present article we have established an expression for the temperature dependence of the lattice thermal conductivity of solids with harmonic disturbances. The relaxation rate for scattering of phonons with point defect is also derived. We will apply the Kubo-correlation function formalism for the thermal conductivity, and the double time temperature dependent Green function technique for the evaluation of correlation functions

  16. Determination of disintegration rates of a 60Co point source and volume sources by the sum-peak method

    International Nuclear Information System (INIS)

    Kawano, Takao; Ebihara, Hiroshi

    1990-01-01

    The disintegration rates of 60 Co as a point source (<2 mm in diameter on a thin plastic disc) and volume sources (10-100 mL solutions in a polyethylene bottle) are determined by the sum-peak method. The sum-peak formula gives the exact disintegration rate for the point source at different positions from the detector. However, increasing the volume of the solution results in enlarged deviations from the true disintegration rate. Extended sources must be treated as an amalgam of many point sources. (author)

  17. Standard practice for measurement of the glass dissolution rate using the single-pass flow-through test method

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2010-01-01

    1.1 This practice describes a single-pass flow-through (SPFT) test method that can be used to measure the dissolution rate of a homogeneous silicate glass, including nuclear waste glasses, in various test solutions at temperatures less than 100°C. Tests may be conducted under conditions in which the effects from dissolved species on the dissolution rate are minimized to measure the forward dissolution rate at specific values of temperature and pH, or to measure the dependence of the dissolution rate on the concentrations of various solute species. 1.2 Tests are conducted by pumping solutions in either a continuous or pulsed flow mode through a reaction cell that contains the test specimen. Tests must be conducted at several solution flow rates to evaluate the effect of the flow rate on the glass dissolution rate. 1.3 This practice excludes static test methods in which flow is simulated by manually removing solution from the reaction cell and replacing it with fresh solution. 1.4 Tests may be conducted wit...

  18. A broken promise: microbiome differential abundance methods do not control the false discovery rate.

    Science.gov (United States)

    Hawinkel, Stijn; Mattiello, Federico; Bijnens, Luc; Thas, Olivier

    2017-08-22

    High-throughput sequencing technologies allow easy characterization of the human microbiome, but the statistical methods to analyze microbiome data are still in their infancy. Differential abundance methods aim at detecting associations between the abundances of bacterial species and subject grouping factors. The results of such methods are important to identify the microbiome as a prognostic or diagnostic biomarker or to demonstrate efficacy of prodrug or antibiotic drugs. Because of a lack of benchmarking studies in the microbiome field, no consensus exists on the performance of the statistical methods. We have compared a large number of popular methods through extensive parametric and nonparametric simulation as well as real data shuffling algorithms. The results are consistent over the different approaches and all point to an alarming excess of false discoveries. This raises great doubts about the reliability of discoveries in past studies and imperils reproducibility of microbiome experiments. To further improve method benchmarking, we introduce a new simulation tool that allows to generate correlated count data following any univariate count distribution; the correlation structure may be inferred from real data. Most simulation studies discard the correlation between species, but our results indicate that this correlation can negatively affect the performance of statistical methods. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. A high count rate position decoding and energy measuring method for nuclear cameras using Anger logic detectors

    International Nuclear Information System (INIS)

    Wong, W.H.; Li, H.; Uribe, J.

    1998-01-01

    A new method for processing signals from Anger position-sensitive detectors used in gamma cameras and PET is proposed for very high count-rate imaging where multiple-event pileups are the norm. This method is designed to sort out and recover every impinging event from multiple-event pileups while maximizing the collection of scintillation signal for every event to achieve optimal accuracy in the measurement of energy and position. For every detected event, this method cancels the remnant signals from previous events, and excludes the pileup of signals from following events. The remnant subtraction is exact even for multiple pileup events. A prototype circuit for energy recovery demonstrated that the maximum count rates can be increased by more than 10 times comparing to the pulse-shaping method, and the energy resolution is as good as pulse shaping (or fixed integration) at low count rates. At 2 x 10 6 events/sec on NaI(Tl), the true counts acquired with this method is 3.3 times more than the delay-line clipping method (256 ns clipping) due to events recovered from pileups. Pulse-height spectra up to 3.5 x 10 6 events/sec have been studied. Monte Carlo simulation studies have been performed for image-quality comparisons between different processing methods

  20. “Et qui or me vaurra entendre, cuer et oreilles me doit rendre”: espacios de lectura y público de los roman courtois de Chrétien de Troyes (siglos XII-XIII

    Directory of Open Access Journals (Sweden)

    Diego Carlo Améndolla Spinola

    2016-06-01

    Full Text Available Basado en los planteamientos de la lógica social del texto, este artículo presenta un estudio del público que escuchaba los romances corteses entre los siglo XII y XIII, específicamente los realizados por Chrétien de Troyes –clérigo lector de la Corte de Leonor de Aquitania y de Enrique II Plantagenet–, además de establecer y analizar las diversas salas de los castillos donde estas obras literarias eran narradas.

  1. Development of growth rate measuring method for intracellular, parasitic acid-fast bacteria using radioisotopes

    International Nuclear Information System (INIS)

    Nakata, Noboru; Fukutomi, Yasuo

    1998-01-01

    To prevent and treat infections diseases caused by pathogenic acid-fast bacteria such as Mycobacterium leprae, Tubercle bacillus, it is important to elucidate the mechanisms of intracellular proliferations of these bacteria. This research project was started to make DNA library using a new constructed shuttle vector. Development of in vitro evaluation method for intracellular proliferation of mycobacterium and its transformed cells was attempted on the basis of Buddemeyer method. This method was able to precisely determine the metabolic activities as low as those in leprae and its modified method using 14 C-palmitic acid was highly sensitive and the results were obtainable in a shorter period. The generated CO 2 was satisfactorily absorbed into scintillator without using a filter paper. A new culture medium from which arginine, a NO-producing compound was eliminated was used to repress the sterilizing effects of NO, but the metabolic activities of leprae was not enhanced. (M.N.)

  2. Development of growth rate measuring method for intracellular, parasitic acid-fast bacteria using radioisotopes

    Energy Technology Data Exchange (ETDEWEB)

    Nakata, Noboru; Fukutomi, Yasuo [National Inst. of Infectious Deseases, Tokyo (Japan)

    1998-02-01

    To prevent and treat infections diseases caused by pathogenic acid-fast bacteria such as Mycobacterium leprae, Tubercle bacillus, it is important to elucidate the mechanisms of intracellular proliferations of these bacteria. This research project was started to make DNA library using a new constructed shuttle vector. Development of in vitro evaluation method for intracellular proliferation of mycobacterium and its transformed cells was attempted on the basis of Buddemeyer method. This method was able to precisely determine the metabolic activities as low as those in leprae and its modified method using {sup 14}C-palmitic acid was highly sensitive and the results were obtainable in a shorter period. The generated CO{sub 2} was satisfactorily absorbed into scintillator without using a filter paper. A new culture medium from which arginine, a NO-producing compound was eliminated was used to repress the sterilizing effects of NO, but the metabolic activities of leprae was not enhanced. (M.N.)

  3. Methods to increase the rate of mass transfer during osmotic dehydration of foods

    OpenAIRE

    Anna Chwastek

    2014-01-01

    Traditional methods of food preservation such as freezing, freeze drying (lyophilization), vacuum drying, convection drying are often supplemented by new technologies that enable obtaining of high quality products. Osmotic dehydration is more and more often used during processing of fruits and vegetables. This method allows maintaining good organoleptic and functional properties in the finished product. Obtaining the desired degree of dehydration or saturation of the material with an osmoacti...

  4. Comparative study on flow rate measurement by nuclear and conventional methods in selected rivers at Ulu Langat district, Selangor

    Energy Technology Data Exchange (ETDEWEB)

    Wan Mohamad Tahir, Wan Zakaria; Mohamad, Daud; Hamzah, Abdul Razak; Yusuf, Johari Mohamad; Aziz Wan Mohamad, Wan Abdul

    1986-06-01

    A radiotracer technique using Tc-99 to measure flows of small rivers was introduced in Malaysia. Three rivers in the Ulu Langat District were selected for a comparative study on flow rate determination by conventional and radioisotope methods. Radioisotopic approach, comprising injection procedures, calibration, mixing length and safety aspects are discussed. The results measured by radioisotope method are compared to the Drainage and Irrigation Department's (DID's) discharge curves data collected from 1980 to 1982 which is calibrated using a current meter. The results are comparable and fall within the range obtained by conventional method. Related to this study, a comprehensive work on stream gauging of moderate and high flow rates using both methods is proposed to be carried out directly.

  5. A Fuzzy Logic-Based Personalized Method to Classify Perceived Exertion in Workplaces Using a Wearable Heart Rate Sensor

    Directory of Open Access Journals (Sweden)

    Pablo Pancardo

    2018-01-01

    Full Text Available Knowing the perceived exertion of workers during their physical activities facilitates the decision-making of supervisors regarding the worker allocation in the appropriate job, actions to prevent accidents, and reassignment of tasks, among others. However, although wearable heart rate sensors represent an effective way to capture perceived exertion, ergonomic methods are generic and they do not consider the diffuse nature of the ranges that classify the efforts. Personalized monitoring is needed to enable a real and efficient classification of perceived individual efforts. In this paper, we propose a heart rate-based personalized method to assess perceived exertion; our method uses fuzzy logic as an option to manage imprecision and uncertainty in involved variables. We applied some experiments to cleaning staff and obtained results that highlight the importance of a custom method to classify perceived exertion of people doing physical work.

  6. Validity and extension of the SCS-CN method for computing infiltration and rainfall-excess rates

    Science.gov (United States)

    Mishra, Surendra Kumar; Singh, Vijay P.

    2004-12-01

    A criterion is developed for determining the validity of the Soil Conservation Service curve number (SCS-CN) method. According to this criterion, the existing SCS-CN method is found to be applicable when the potential maximum retention, S, is less than or equal to twice the total rainfall amount. The criterion is tested using published data of two watersheds. Separating the steady infiltration from capillary infiltration, the method is extended for predicting infiltration and rainfall-excess rates. The extended SCS-CN method is tested using 55 sets of laboratory infiltration data on soils varying from Plainfield sand to Yolo light clay, and the computed and observed infiltration and rainfall-excess rates are found to be in good agreement.

  7. Method for measuring and evaluation dose equivalent rate from fast neutrons in mixed gamma-neutron fields around particles accelerators

    International Nuclear Information System (INIS)

    Cruceru, I.; Sandu, M.; Cruceru, M.

    1994-01-01

    A method for measuring and evaluation of doses and dose equivalent rate in mixed gamma- neutron fields is discussed in this paper. The method is basedon a double detector system consist of an ionization chamber with components made from a plastic scintillator, coupled to on photomultiplier. Generally the radiation fields around accelerators are complex, often consisting of many different ionizing radiations extending over a broad range of energies. This method solve two major difficulties: determination of response functions of radiation detectors; interpretation of measurement and determination of accuracy. The discrimination gamma-fast neutrons is assured directly without a pulse shape discrimination circuit. The method is applied to mixed fields in which particle energies are situated in the energy range under 20 MeV and an izotropic emision (Φ=10 4 -10 11 n.s -1 ). The dose equivalent rates explored is 0.01mSV--0.1SV

  8. A method of detection of respiration rate on Android using UWB Impulse Radar

    Directory of Open Access Journals (Sweden)

    Young-Jin Park

    2016-12-01

    Full Text Available Monitoring respiration rate is important because it can help to detect and prevent abnormal respiratory rates that can lead to cardiac arrest and chronic obstructive pulmonary disease. Nowadays, most medical measurement and monitoring devices are either invasive or wired but people are hesitant to attach physiological sensors to their body. In this study, we investigated whether real-time medical measurement of breathing using Novelda’s Ultra-Wideband Impulse Radio (IR-UWB–which does not need to be attached to the human body and is also non-invasive–is possible on Android. Experimental results obtained were found to be comparable to those of a commercial healthcare device.

  9. Studies on rate equations for defects in irradiated solids using the local analysis method

    International Nuclear Information System (INIS)

    Carvalho e Camargo, M.U. de.

    1983-10-01

    The void formation and swelling phenomenon in material for nuclear reactors structures, mainly for fast reactors, has been studied by several authors. A simple calculation covering the basic instance of radiation damage in irradiated solid solution, using the local analysis in rate theory is presented here. A simple description of pratical and fundamental interest for the complex problem of solid solution under irradiation is given. (Author) [pt

  10. An improved in vivo deuterium labeling method for measuring the biosynthetic rate of cytokinins

    Czech Academy of Sciences Publication Activity Database

    Tarkowski, Petr; Floková, K.; Václavíková, Kateřina; Jaworek, P.; Raus, M.; Nordström, A.; Novák, Ondřej; Doležal, Karel; Šebela, M.; Frébortová, Jitka

    2010-01-01

    Roč. 15, č. 12 (2010), s. 9214-9229 ISSN 1420-3049 R&D Projects: GA ČR(CZ) GA522/08/0920; GA MŠk ED0017/01/01; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : cytokinin * deuterium labelling * biosynthetic rate Subject RIV: CE - Biochemistry Impact factor: 1.988, year: 2010

  11. Pregnancy risk assessment monitoring system in Ireland: methods and response rates

    LENUS (Irish Health Repository)

    O’Keeffe, Linda M.

    2014-06-01

    To describe response rates and characteristics associated with response to the Pregnancy Risk Assessment Monitoring System study in Ireland (PRAMS Ireland). Using hospital discharge records of live births at a large, urban, obstetric hospital, a sampling frame of approximately 2,400 mother-infant pairs were used to alternately sample 1,200 women. Mothers’ information including name, address, parity, age and infant characteristics such as sex and gestational age at delivery were extracted from records. Modes of contact included an invitation letter with option to opt out of the study, three mail surveys, a reminder letter and text message reminder for remaining non-respondents. Sixty-one per cent of women responded to the PRAMS Ireland survey over a 133 day response period. Women aged <30, single women, multiparous women and women with a preterm delivery were less likely to respond. Women participating in PRAMS Ireland were similar to the national birth profile in 2011 which had a mean age of 32, were 40 % primiparous, 33 % single or never married and had a 28 % caesarean section rate. Survey and protocol changes are required to increase response rates above recommended Centers for Disease Control and Prevention (CDC) thresholds of 65 % within the recommended 90 day data collection cycle. Additional efforts such as stratification and over-sampling are required to increase representativeness among hard to reach groups such as younger, single and multiparous women before expanding the project to an ongoing, national surveillance system in Ireland.

  12. Modelling infant mortality rate in Central Java, Indonesia use generalized poisson regression method

    Science.gov (United States)

    Prahutama, Alan; Sudarno

    2018-05-01

    The infant mortality rate is the number of deaths under one year of age occurring among the live births in a given geographical area during a given year, per 1,000 live births occurring among the population of the given geographical area during the same year. This problem needs to be addressed because it is an important element of a country’s economic development. High infant mortality rate will disrupt the stability of a country as it relates to the sustainability of the population in the country. One of regression model that can be used to analyze the relationship between dependent variable Y in the form of discrete data and independent variable X is Poisson regression model. Recently The regression modeling used for data with dependent variable is discrete, among others, poisson regression, negative binomial regression and generalized poisson regression. In this research, generalized poisson regression modeling gives better AIC value than poisson regression. The most significant variable is the Number of health facilities (X1), while the variable that gives the most influence to infant mortality rate is the average breastfeeding (X9).

  13. An Experimental study on a Method of Computing Minimum flow rate

    International Nuclear Information System (INIS)

    Cho, Yeon Sik; Kim, Tae Hyun; Kim, Chang Hyun

    2009-01-01

    Many pump reliability problems in the Nuclear Power Plants (NPPs) are being attributed to the operation of the pump at flow rates well below its best efficiency point(BEP). Generally, the manufacturer and the user try to avert such problems by specifying a minimum flow, below which the pump should not be operated. Pump minimum flow usually involves two considerations. The first consideration is normally termed the 'thermal minimum flow', which is that flow required to prevent the fluid inside the pump from reaching saturation conditions. The other consideration is often referred to as 'mechanical minimum flow', which is that flow required to prevent mechanical damage. However, the criteria for specifying such a minimum flow are not clearly understood by all parties concerned. Also various factor and information for computing minimum flow are not easily available as considering for the pump manufacturer' proprietary. The objective of this study is to obtain experimental data for computing minimum flow rate and to understand the pump performances due to low flow operation. A test loop consisted of the pump to be used in NPPs, water tank, flow rate measurements and piping system with flow control devices was established for this study

  14. Time-trends in method-specific suicide rates compared with the availability of specific compounds. The Danish experience

    DEFF Research Database (Denmark)

    Nordentoft, Merete; Qin, Ping; Helweg-Larsen, Karin

    2006-01-01

    Restriction of means for suicide is an important part of suicide preventive strategies in different countries. All suicides in Denmark between 1970 and 2000 were examined with regard to method used for suicide. Overall suicide mortality and method-specific suicide mortality was compared...... in the number of suicides by self-poisoning with these compounds. Restricted access occurred concomittantly with a 55% decrease in suicide rate...

  15. Review and Extension of CO2-Based Methods to Determine Ventilation Rates with Application to School Classrooms

    Directory of Open Access Journals (Sweden)

    Stuart Batterman

    2017-02-01

    Full Text Available The ventilation rate (VR is a key parameter affecting indoor environmental quality (IEQ and the energy consumption of buildings. This paper reviews the use of CO2 as a “natural” tracer gas for estimating VRs, focusing on applications in school classrooms. It provides details and guidance for the steady-state, build-up, decay and transient mass balance methods. An extension to the build-up method and an analysis of the post-exercise recovery period that can increase CO2 generation rates are presented. Measurements in four mechanically-ventilated school buildings demonstrate the methods and highlight issues affecting their applicability. VRs during the school day fell below recommended minimum levels, and VRs during evening and early morning were on the order of 0.1 h−1, reflecting shutdown of the ventilation systems. The transient mass balance method was the most flexible and advantageous method given the low air change rates and dynamic occupancy patterns observed in the classrooms. While the extension to the build-up method improved stability and consistency, the accuracy of this and the steady-state method may be limited. Decay-based methods did not reflect the VR during the school day due to heating, ventilation and air conditioning (HVAC system shutdown. Since the number of occupants in classrooms changes over the day, the VR expressed on a per person basis (e.g., L·s−1·person−1 depends on the occupancy metric. If occupancy measurements can be obtained, then the transient mass balance method likely will provide the most consistent and accurate results among the CO2-based methods. Improved VR measurements can benefit many applications, including research examining the linkage between ventilation and health.

  16. Measurement of disintegration rates of small [60Co]Co sources in lead containers by the sum-peak method

    International Nuclear Information System (INIS)

    Kawano, Takao; Ebihara, Hiroshi

    1991-01-01

    The sum-peak method has been applied to determine the disintegration rates of two small [ 60 Co]Co sources (30 and 350 kBq) in lead containers with several thickness by using a NaI(Tl) detector. The experimental results showed that the sum-peak method was perfectly effective for the determination of the disintegration rates (unrelated to the thicknesses of the containers) of the 350 kBq source. The sum-peak method was also absolutely effective for the 30 kBq source in the case of containers with thicknesses of 15 mm and less, but in the cases of those with thicknesses of 21, 27 and 33 mm, the disintegration rates were under-estimated and the deviations from the true disintegration rate increased rapidly with increasing thicknesses of the containers. We presume that the under-estimation of the disintegration rates was the result of the over-estimation of the areas under the sum peaks, caused by the interference of the γ-ray (2614 keV) emitted from the naturally occurring radionuclide 208 Tl. (author)

  17. An alternative radiometric method for calculating the sedimentation rates: Application to an intertidal region (SW of Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Ligero, R.A., E-mail: rufino.ligero@uca.e [Departamento de Fisica Aplicada, Universidad de Cadiz, 11510 Puerto Real, Cadiz (Spain); Casas-Ruiz, M. [Departamento de Fisica Aplicada, Universidad de Cadiz, 11510 Puerto Real, Cadiz (Spain); Barrera, M. [Departamento de Medio Ambiente, CIEMAT, Madrid 28040 (Spain); Barbero, L. [Departamento de Ciencias de la Tierra, Universidad de Cadiz, 11510 Puerto Real (Spain); Melendez, M.J. [Departamento de Fisica Aplicada, Universidad de Cadiz, 11510 Puerto Real, Cadiz (Spain)

    2010-09-15

    A new method using the inventory determined for the activity of the radionuclide {sup 137}Cs, coming from global radioactive fallout has been utilised to calculate the sedimentation rates. The method has been applied in a wide intertidal region in the Bay of Cadiz Natural Park (SW Spain). The sedimentation rates estimated by the {sup 137}Cs inventory method ranged from 0.26 cm/year to 1.72 cm/year. The average value of the sedimentation rate obtained is 0.59 cm/year, and this rate has been compared with those resulting from the application of the {sup 210}Pb dating technique. A good agreement between the two procedures has been found. From the study carried out, it has been possible for the first time, to draw a map of sedimentation rates for this zone where numerous physico-chemical, oceanographic and ecological studies converge, since it is situated in a region of great environmental interest. This area, which is representative of common environmental coastal scenarios, is particularly sensitive to perturbations related to climate change, and the results of the study will allow to make short and medium term evaluations of this change.

  18. Method and Apparatus for Predicting Unsteady Pressure and Flow Rate Distribution in a Fluid Network

    Science.gov (United States)

    Majumdar, Alok K. (Inventor)

    2009-01-01

    A method and apparatus for analyzing steady state and transient flow in a complex fluid network, modeling phase changes, compressibility, mixture thermodynamics, external body forces such as gravity and centrifugal force and conjugate heat transfer. In some embodiments, a graphical user interface provides for the interactive development of a fluid network simulation having nodes and branches. In some embodiments, mass, energy, and specific conservation equations are solved at the nodes, and momentum conservation equations are solved in the branches. In some embodiments, contained herein are data objects for computing thermodynamic and thermophysical properties for fluids. In some embodiments, the systems of equations describing the fluid network are solved by a hybrid numerical method that is a combination of the Newton-Raphson and successive substitution methods.

  19. Methods to increase the rate of mass transfer during osmotic dehydration of foods.

    Science.gov (United States)

    Chwastek, Anna

    2014-01-01

    Traditional methods of food preservation such as freezing, freeze drying (lyophilization), vacuum drying, convection drying are often supplemented by new technologies that enable obtaining of high quality products. Osmotic dehydration is more and more often used during processing of fruits and vegetables. This method allows maintaining good organoleptic and functional properties in the finished product. Obtaining the desired degree of dehydration or saturation of the material with an osmoactive substance often requires  elongation of time or use of high temperatures. In recent years much attention was devoted to techniques aimed at increasing the mass transfer between the dehydrated material and the hypertonic solution. The work reviews the literature focused on methods of streamlining the process of osmotic dehydration which include the use of: ultrasound, high hydrostatic pressure, vacuum osmotic dehydration and pulsed electric field.

  20. [A method to estimate the short-term fractal dimension of heart rate variability based on wavelet transform].

    Science.gov (United States)

    Zhonggang, Liang; Hong, Yan

    2006-10-01

    A new method of calculating fractal dimension of short-term heart rate variability signals is presented. The method is based on wavelet transform and filter banks. The implementation of the method is: First of all we pick-up the fractal component from HRV signals using wavelet transform. Next, we estimate the power spectrum distribution of fractal component using auto-regressive model, and we estimate parameter 7 using the least square method. Finally according to formula D = 2- (gamma-1)/2 estimate fractal dimension of HRV signal. To validate the stability and reliability of the proposed method, using fractional brown movement simulate 24 fractal signals that fractal value is 1.6 to validate, the result shows that the method has stability and reliability.

  1. A data driven method to measure electron charge mis-identification rate

    CERN Document Server

    Bakhshiansohi, Hamed

    2009-01-01

    Electron charge mis-measurement is an important challenge in analyses which depend on the charge of electron. To estimate the probability of {\\it electron charge mis-measurement} a data driven method is introduced and a good agreement with MC based methods is achieved.\\\\ The third moment of $\\phi$ distribution of hits in electron SuperCluster is studied. The correlation between this variable and the electron charge is also investigated. Using this `new' variable and some other variables the electron charge measurement is improved by two different approaches.

  2. Treatment rate improvement of the ozone oxidation method for laundry waste water

    International Nuclear Information System (INIS)

    Matsuo, Toshiaki; Nishi, Takashi

    2001-01-01

    Radioactive laundry waste water generated in nuclear power plants includes organic compounds to be removed, for which ozone oxidation treatment is a possibility. To verify the applicability, its total organic carbon concentration (TOC) lowering rate improvement was examined in 0.5x10 -3 m 3 batch and 3x10 -2 m 3 pilot equipment experiments. In the batch experiments, ozone at a concentration of 200 g/Nm 3 was dispersed into 0.5x10 -3 m 3 of Simulated Laundry Waste Water (SLWW) with TOC of 11 mM. Total organic carbon concentration was measured every hour to see the effects of the temperature, and the initial concentrations of both H 2 O 2 and NaOH which were added to urge OH radical generation from ozone. In the pilot equipment experiments, 1x10 -2 to 3x10 -2 m 3 of the SLWW were circulated using an ejector to disperse the ozone. The influences of the flow rate and the SLWW volume on lowering TOC were examined, because they were related to the ejector dispersion performance and the appropriate ozone addition per SLWW volume. Appropriate initial H 2 O 2 and NaOH concentrations in the batch experiments were 14.7 mM and 1 mM, respectively. Lowering of TOC became faster at higher temperatures, because ozone self-decomposition and OH radial diffusion to the organic compound molecules were promoted. Lowering of TOC also became faster at higher flow rates, while the influence of the volume became saturated. (author)

  3. Difference infiltrometer: a method to measure temporally variable infiltration rates during rainstorms

    Science.gov (United States)

    Moody, John A.; Ebel, Brian A.

    2012-01-01

    We developed a difference infiltrometer to measure time series of non-steady infiltration rates during rainstorms at the point scale. The infiltrometer uses two, tipping bucket rain gages. One gage measures rainfall onto, and the other measures runoff from, a small circular plot about 0.5-m in diameter. The small size allows the infiltration rate to be computed as the difference of the cumulative rainfall and cumulative runoff without having to route water through a large plot. Difference infiltrometers were deployed in an area burned by the 2010 Fourmile Canyon Fire near Boulder, Colorado, USA, and data were collected during the summer of 2011. The difference infiltrometer demonstrated the capability to capture different magnitudes of infiltration rates and temporal variability associated with convective (high intensity, short duration) and cyclonic (low intensity, long duration) rainstorms. Data from the difference infiltrometer were used to estimate saturated hydraulic conductivity of soil affected by the heat from a wildfire. The difference infiltrometer is portable and can be deployed in rugged, steep terrain and does not require the transport of water, as many rainfall simulators require, because it uses natural rainfall. It can be used to assess infiltration models, determine runoff coefficients, identify rainfall depth or rainfall intensity thresholds to initiate runoff, estimate parameters for infiltration models, and compare remediation treatments on disturbed landscapes. The difference infiltrometer can be linked with other types of soil monitoring equipment in long-term studies for detecting temporal and spatial variability at multiple time scales and in nested designs where it can be linked to hillslope and basin-scale runoff responses.

  4. Quasi-static method and finite element method for obtaining the modifications of the spontaneous emission rate and energy level shift near a plasmonic nanostructure.

    Science.gov (United States)

    Zhao, Yun-Jin; Tian, Meng; Wang, Xiao-Yun; Yang, Hong; Zhao, Heping; Huang, Yong-Gang

    2018-01-22

    We provide numerical demonstrations of the applicability and accuracy of the quasi-static method and the finite-element method in the investigation of the modifications of the spontaneous emission rate and the energy level shift of an emitter placed near a silver-air interface or a silver nano-sphere. The analytical results are presented as a reference. Our calculations show that the finite element method is an accurate and general method. For frequency away from the radiative mode, the quasi-static method can be applied more effectively for calculating the energy level shift than the spontaneous emission rate. But for frequency around, there is a blue shift for both and this shift increases with the increasing of emitter-silver distance. Applying the theory to the nanosphere dimmer, we see similar phenomenon and find extremely large modifications of the spontaneous emission rate and energy level shift. These findings are instructive in the fields of quantum light-matter interactions.

  5. Improved method for the determination of the cortisol production rate using high-performance liquid chromatography and liquid scintillation counting

    NARCIS (Netherlands)

    van Ingen, H. E.; Endert, E.

    1988-01-01

    Two new methods for the determination of the cortisol production rate using reversed-phase high-performance liquid chromatography are described. One uses ultraviolet detection at 205 nm, the other on-line post-column derivatization with benzamidine, followed by fluorimetric detection. The specific

  6. Effect of Planting Methods and Seeding Rates on Yield of Alfalfa (Medicago sativa L. CV. Hamedani in Bajgah, Fars Province

    Directory of Open Access Journals (Sweden)

    A. Yazdani

    2015-06-01

    ha-1, respectively. Seeding rates also had a significant effect on number of weeds so that maximum and minimum weed numbers were obtained in 20 kg and 5 kg seed ha-1. Our results showed that 20 kg seed ha-1 and furrow planting method was the best treatment to gain maximum forage yield and minimum weed's detrimental impact.

  7. A comparison of methods for calculating NMR cross-relaxation rates (NOESY and ROESY intensities) in small peptides

    NARCIS (Netherlands)

    Feenstra, K Anton; Peter, Christine; Scheek, Ruud M; van Gunsteren, Wilfred F; Mark, Alan E

    Three methods for calculating nuclear magnetic resonance cross-relaxation rates from molecular dynamics simulations of small flexible molecules have been compared in terms of their ability to reproduce relaxation data obtained experimentally and to produce consistent descriptions of the system. The

  8. A rate-jump method for characterization of soft tissues using nanoindentation techniques

    KAUST Repository

    Tang, Bin

    2012-01-01

    The biomechanical properties of soft tissues play an important role in their normal physiological and physical function, and may possibly relate to certain diseases. The advent of nanomechanical testing techniques, such as atomic force microscopy (AFM), nano-indentation and optical tweezers, enables the nano/micro-mechanical properties of soft tissues to be investigated, but in spite of the fact that biological tissues are highly viscoelastic, traditional elastic contact theory has been routinely used to analyze experimental data. In this article, a novel rate-jump protocol for treating viscoelasticity in nanomechanical data analysis is described. © 2012 The Royal Society of Chemistry.

  9. In situ method for measurements of community clearance rate on shallow water bivalve populations

    DEFF Research Database (Denmark)

    Hansen, Benni W.; Dolmer, Per; Vismann, Bent

    2011-01-01

    An open-top chamber was designed for measuring ambient community clearance rate on undisturbed bivalve populations in the field. The chamber was pressed 5-10 cm down in the sediment on the mussel bed. It holds approximately 30-40 cm water column equal to a volume of 43-77 L. It was provided...... with an air lift connected to a SCUBA diver pressure tank generating a continuous and gentle water circulation. This ensures a complete mixture of suspended particles, and thereby, a maximum filtration by the bivalves. An in situ fluorometer was mounted to record plant pigment reduction due to mussel...

  10. Rate-difference method proved satisfactory in estimating the influenza burden in primary care visits

    NARCIS (Netherlands)

    Jansen, Angelique G S C; Sanders, Elisabeth A M; Wallinga, Jacco; Groen, Eelke J; van Loon, Anton M; Hoes, Arno W; Hak, Eelko

    OBJECTIVE: To compare different methods to estimate the disease burden of influenza, using influenza and respiratory syncytial virus-(RSV) associated primary care data as an example. STUDY DESIGN AND SETTING: In a retrospective study in the Netherlands over 1997-2003, primary care attended

  11. Rating of the X-ray method of measurement of stresses in steels

    International Nuclear Information System (INIS)

    Skrzypinski, A.

    1977-01-01

    The possibilities of utilization of some dependencies occuring in the X-ray technique of measurement of natural stresses for determination of distances of a between - plane lattice without natural stresses (d 0 ) are discussed. The proposed methodics of determination of d 0 is illustrated with the investigations which were carried-out on bearing steel LH15. (author)

  12. Logging costs and production rates for the group selection cutting method

    Science.gov (United States)

    Philip M. McDonald

    1965-01-01

    Young-growth, mixed-conifer stands were logged by a group-selection method designed to create openings 30, 60, and 90 feet in diameter. Total costs for felling, limbing, bucking, and skidding on these openings ranged from $7.04 to $7.99 per thousand board feet. Cost differences between openings were not statistically significant. Logging costs for group selection...

  13. Influence of nitrogen rate and drip application method on pomegranate fruit yield and quality

    Science.gov (United States)

    Currently, 98% of domestic commercial pomegranate fruit (Punica granatum L.) are produced in California on over 13,000 ha. Developing more efficient methods of water and fertilizer application are important in reducing production costs. In 2012, a pomegranate orchard established in 2010 with a den...

  14. Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie

    Directory of Open Access Journals (Sweden)

    Anna Poujeau

    2009-03-01

    Full Text Available Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie. En juillet 2004, j’ai assisté aux funérailles d’un jeune homme de la famille au sein de laquelle je vivais à Damas. À l’époque, l’intense émotion suscitée par cet événement empêcha que je m’y intéresse de plus près. Ce n’est que deux ans plus tard, en juillet 2006, que j’ai décidé d’enquêter sur l’un des aspects majeurs de la cérémonie : les lamentations funèbres féminines. Lors de ce dernier terrain, les femmes de la famille que j’interrogeais, que j’accompagnais aux funérailles et dont j’enregistrais les chants m’assignèrent alors une place tout à fait particulière. Puisque, moi aussi, « je m’habillais en noir et je venais aux funérailles », je ne pouvais plus être considérée comme une étrangère. Dès lors, elles firent de moi la fille d’une de leur sœur émigrée à Paris et mariée avec un Français. Ce statut me fut par ailleurs confirmé lorsqu’elles m’attribuèrent une place dans leurs plaisanteries entre sœurs, tantes et neveux matrilatéraux.Dans cet article, je souhaite engager une double réflexion : sur la position et l’implication de l’ethnologue sur un terrain où l’émotion est au premier plan, ainsi que sur la façon dont être assignée à une place dans la parenté de ses informateurs donne enfin toute liberté d’action à l’ethnologue sur son terrain.From monasteries to funerals. The construction of ethnographical relations with the Christians of Damascus (Syria. In July 2004, I attended the funeral of a young man from the family with whom I was staying in Damascus. At the time, the intense emotion provoked by that event prevented me from immediately examining it more closely. It was only two years later, in July 2006, that I decided to study one of the main features of the ceremony: the women’s lamentations. During this

  15. Rate of sedimentation in the Yamuna river around Delhi using the sup(226)Ra-sup(210)Pb method

    International Nuclear Information System (INIS)

    Subramanian, V.; Sitasaward, R.; Joshi, L.U.

    1985-01-01

    For six sediment cores collected from Yamuna river (tributary of Ganges) around Delhi, rate of sedimentation was determined by the sup(226)Ra-sup(210)Pb method. While an average rate of 42 mm/y is obtained, there are variations core to core. A clear-cut downstream increase in the rate from 5 mm/y when the river enters Delhi, to 80 mm/y when it leaves Delhi indicates solid waste contribution from the urban areas. The sediment flux of 4000 mg/cmsup(2)/y is not balanced by the calculated rate of erosion (40 tonnes/kmsup(2)/y) in the river. Thus, much of the sediment flux is of local origin. (author)

  16. Sediment accumulation rates and geochronologies measured in the Saguenay Fjord using the Pb-210 dating method

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J N; Walton, A [Department of Fisheries and Oceans, Dartmouth, N.S. (Canada). Atlantic Oceanographic Lab., Bedford Inst. of Oceanography

    1980-02-01

    Sediment accumulation rates were estimated from the vertical distribution of excess Pb-210 measured in sediment cores collected at seven stations in the Saguenay Fjord, Quebec. These rates decrease with increasing water depth and distance from the mouth of the Saguenay River, ranging from 4.0 g cm/sup -2/yr/sup -1/ (approximately = 7 cm yr/sup -1/) near the head of the fjord to 0.07 g cm/sup -2/yr/sup -1/ (approximately 0.1 cm yr/sup -1/) in the deep inner basin of the fjord. In one core from the head of the fjord, layered sediment structures, having different physical characteristics and composition, appear related to recent pulsed inputs of older raised marine deposits displaced by a landslide in 1971. Synchronous depositional anomalies in several cores provide evidence of other large scale sediment redistribution processes in the fjord. Pb-210 geochronologies are generally in good agreement with time-stratigraphic horizons inferred both from Cs-137 activity profiles and from the analysis of pollen assemblages in one core. (author).

  17. Comparison between continuous and localized methods to evaluate the flow rate through containment concrete structures

    Energy Technology Data Exchange (ETDEWEB)

    Jason, L., E-mail: ludovic.jason@cea.fr [Atomic Energy Commission (CEA), DEN, DANS, DM2S, SEMT, Mechanics and System Simulation Laboratory (LM2S), F-91191 Gif sur Yvette (France); LaMSID, UMR CNRS-EDF-CEA 8193, F-92141 Clamart (France); Masson, B. [Electricité de France (EDF), SEPTEN, F-69628 Villeurbanne (France)

    2014-10-01

    Highlights: • The contribution focuses on the gas transfer through reinforced concrete structures. • A continuous approach with a damage–permeability law is investigated. • It is significant, for this case, only when the damage variable crosses the section. • In this case, two localized approaches are compared. • It helps at evaluating a “reference” crack opening for engineering laws. - Abstract: In this contribution, different techniques are compared to evaluate the gas flow rate through a representative section of a reinforced and prestressed concrete containment structure. A continuous approach is first applied which is based on the evaluation of the gas permeability as a function of the damage variable. The calculations show that the flow rate becomes significant only when the damage variable crosses the section. But in this situation, the continuous approach is no longer fully valid. That is why localized approaches, based on a fine description of the crack openings, are then investigated. A comparison between classical simplified laws (Poiseuille flow) and a more refined model which takes into account the evolution of the crack opening in the depth of the section enables to define the validity domain of the simplified laws and especially the definition of the associated “reference opening”.

  18. Method of simultaneous continuous determination of transfer rates of iron and chromium into solution during Fe-Cr alloys dissolution

    International Nuclear Information System (INIS)

    Shirinov, T.I.; Florianovich, G.M.; Skuratnik, Ya.B.

    1978-01-01

    Radiometry method of simultaneous continuous registration of transfer rates of iron and chromium into solution from Fe-Cr alloys with various composition has been developed. Using gamma-spectrometer components of Fe-Cr alloys can be determined with high sensitivity in separate samples according to Fe 59 and Cr 51 radioactive labels, obtained by neutron activation. The above method is applied to estimate Fe and Cr transfer rates into H 2 SO 4 solution at the temperature of 50 deg from Fe - 28% Cr alloy during its active dissolution. It is established, that beginning with some seconds of alloy and solution contact, its components transfer into the solution in the same composition, as in the alloy. The method enables to determine Fe with the accuracy of up to 5% and Cr with that of up to 10%

  19. Application of specific gravity method for normalization of urinary excretion rates of radionuclides

    International Nuclear Information System (INIS)

    Thakur, Smita S.; Yadav, J.R.; Rao, D.D.

    2015-01-01

    In vitro bioassay monitoring is based on the determination of activity concentration in biological samples excreted from the body and is most suitable for alpha and beta emitters. For occupational workers handling actinides in reprocessing facilities possibility of internal exposure exists and urine assay is preferred method for monitoring such exposure. Urine samples collected for 24 h duration, is the true representative of bioassay sample and hence in the case of insufficient collection time, specific gravity applied method of normalization of urine sample is used. The present study reports the data of specific gravity generated for controlled group of Indian population by the use of densitometer and its application in urinary sample activity normalization. The average specific gravity value obtained for the controlled group was 1.008±0.005 gm/ml. (author)

  20. On the rate of convergence of the alternating projection method in finite dimensional spaces

    Science.gov (United States)

    Galántai, A.

    2005-10-01

    Using the results of Smith, Solmon, and Wagner [K. Smith, D. Solomon, S. Wagner, Practical and mathematical aspects of the problem of reconstructing objects from radiographs, Bull. Amer. Math. Soc. 83 (1977) 1227-1270] and Nelson and Neumann [S. Nelson, M. Neumann, Generalizations of the projection method with application to SOR theory for Hermitian positive semidefinite linear systems, Numer. Math. 51 (1987) 123-141] we derive new estimates for the speed of the alternating projection method and its relaxed version in . These estimates can be computed in at most O(m3) arithmetic operations unlike the estimates in papers mentioned above that require spectral information. The new and old estimates are equivalent in many practical cases. In cases when the new estimates are weaker, the numerical testing indicates that they approximate the original bounds in papers mentioned above quite well.

  1. Evaluation of sources, rates and methods of zinc fertilizer applications in flooded rice

    International Nuclear Information System (INIS)

    Sarkar, A.K.; Deb, D.L.

    1981-01-01

    A pot experiment was conducted using 65 Zn as tracer to evaluate the different sources, levels and methods of zinc fertilization in flooded rice. Results indicated that zinc sulphate was either at par or slightly superior to zincated urea from the point of view of yield and total zinc uptake by rice. The Zndff percent was found to be the highest with zincated urea and the lowest was observed with zinc oxide. 5 and 10 kg/ha levels of zinc were statistically at par in this regard. Among the different methods, surface application and thorough mixing with soil were comparable. Root dipping in 1 percent zinc oxide suspension and application of zinc in irrigation water also indicated high zinc absorption by the rice plant. (author)

  2. Evaluation of Technical and Yield Parameters of Wheat Seeding Methods with Different Seeding Rates in south Khuzestan

    Directory of Open Access Journals (Sweden)

    J Habibi Asl

    2012-05-01

    Full Text Available This study was conducted during two years (2007-2009 in Shawoor Agricultural Research Station on a silty-clay soil. Experiment conducted in split plots in a Randomized Complete Blocks Design in three replications. Main plots were planting methods including centrifugal broadcaster (P1, centrifugal broadcaster + furrower (P2, seed drill (P3, seed drill + furrower (P4, three lines bed drilling (P5 and four lines bed drilling (P6. Subplots were included seed rates of 120, 160, 200 and 240 kg.ha-1. The results showed that P2 method with 14.91 litter.ha-1 and P3 method with 5.02 litter.ha-1 had the highest and lowest fuel consumption respectively. P3 method with 1.462 h.ha-1 and P5 method with 0.620 h.ha-1 required maximum and minimum total operation time respectively. P2 method with 0.684 ha.h-1 had minimum field capacity. Field capacity of P5 and P6 with averagely 1.67 ha.h-1 was maximum. Field capacity of all drilling methods (P3, P4, P5 and P6 was significantly more than that of broadcasting methods (P1 and P2. The highest seed spacing uniformity (87.2% was belonged to P6 method and the lowest value (54.7% was for P1 method. By using drilling methods of P3 and P5 (or P6 instead of P1 method total cost was reduced 41% and 29% respectively. The results of variance analysis of data showed that the difference between planting methods in case of wheat grain yield and yield components was not significant. However, the seed rate had significant effect on some yield components. Suggestion for cropping of wheat Chamran variety in silty-clay soil in Khuzestan province, used P5, P6 and P3 methods are recommended respectively with seed rate of 120 - 160 kg.ha-1.

  3. An Enhanced Method to Estimate Heart Rate from Seismocardiography via Ensemble Averaging of Body Movements at Six Degrees of Freedom

    Directory of Open Access Journals (Sweden)

    Hyunwoo Lee

    2018-01-01

    Full Text Available Continuous cardiac monitoring has been developed to evaluate cardiac activity outside of clinical environments due to the advancement of novel instruments. Seismocardiography (SCG is one of the vital components that could develop such a monitoring system. Although SCG has been presented with a lower accuracy, this novel cardiac indicator has been steadily proposed over traditional methods such as electrocardiography (ECG. Thus, it is necessary to develop an enhanced method by combining the significant cardiac indicators. In this study, the six-axis signals of accelerometer and gyroscope were measured and integrated by the L2 normalization and multi-dimensional kineticardiography (MKCG approaches, respectively. The waveforms of accelerometer and gyroscope were standardized and combined via ensemble averaging, and the heart rate was calculated from the dominant frequency. Thirty participants (15 females were asked to stand or sit in relaxed and aroused conditions. Their SCG was measured during the task. As a result, proposed method showed higher accuracy than traditional SCG methods in all measurement conditions. The three main contributions are as follows: (1 the ensemble averaging enhanced heart rate estimation with the benefits of the six-axis signals; (2 the proposed method was compared with the previous SCG method that employs fewer-axis; and (3 the method was tested in various measurement conditions for a more practical application.

  4. Effects of the rate and methods of placement of K-fertilizer in

    Directory of Open Access Journals (Sweden)

    mehrdad mahloji

    2009-06-01

    Full Text Available In order to study the effects of potassium amounts and methods of potassium application in different systems of tillaging on barley cultivar of Karoon*Kavir grain yield in salinity stress conditions, a farm trail was conducted in a split block arrangement in three replications with a Randomized Complete Block Design at Roodasht salinity and drainage research station (Esfahan province in 2003-5. Experimental treatments were soil tillage systems, potassium fertilizer amounts and its, placement methods. The main plots were soil till systems (conventional, minimum and no tillage.The horizontal treatments were recommended (300 kg/ha potassium sulfate, 33% lower and 33% higher than recommended amounts of potassium fertilizer. The vertical treatments in main plots were fertilizer placement methods (spreading and strip replacement of fertilizer 5 centimeter under the seeds. The water salinity of irrigation after spring growth stage was 12 ds/m. The conventional irrigation before spring growth stage is river water supply. The ANOVA results showed that: In the first year of study, the different soil till systems effected significantly(p = 0.01 plant height, number of spike per square meter, the concentration of minerals in leaf, grain yield, biological yield and harvest index. The fertilizer applications and its, placement effects on above-mentioned traits were not significant. The highest grain yield (3213 Kg/ha obtained in conventional till. In the second year of experiment: soil tillage systems, the potassium fertilizer amounts and fertilizer placements had no significant effect on grain and biological yields of barley cultivar. The two-year study results showed that: The conventional till system is a suitable method for planting barley in soils with clay loam texture. In spite of higher amounts of potassium fertilizer application and higher amount of absorbable K+ in the soil, there were no significant effect on grain yield and its components.

  5. Method for the determination of oxygen consumption rates and diffusion coefficients in multicellular spheroids

    OpenAIRE

    Mueller-Klieser, W.

    1984-01-01

    A method has been developed for the quantitative evaluation of oxygen tension (PO2) distributions in multicellular spheroids measured with O2-sensitive microelectrodes. The experimental data showed that multicellular tumor spheroids in stirred growth media were characterized by a diffusion-depleted zone surrounding the spheroids. This zone was elicited by an unstirred layer of medium next to the spheroid leading to a continuous decrease in the PO2 values from the bulk medium towards the spher...

  6. Improvement of a method for predicting failure rates of coated particles during irradiation

    International Nuclear Information System (INIS)

    Bongartz, K.

    1977-01-01

    A method for calculating the coating stress distribution resulting from the statistical spread of geometrical parameters in irradiated fuel particle batches has been developed by Gulden et al. The existing method utilizing coated particles is extended in two ways: 1. A more realistic treatment of the buffer layer is adopted, taking into account its physical properties. 2. A statistical distribution according to Weibull has been adopted for the silicon carbide layer strength. Calculations with both the new and the old assumptions were performed on one feed particle and one breed particle type. It is shown that the two modifications influence the results of the original method. It was found that the extension of the first assumption has no influence on the stress distribution and the fraction of breaking feed particles, but it changes the stress distribution of the breed particles significantly. The fraction of broken particles at end burnup is increased by a factor of approximately 10. The extension of the second assumption affects the fraction of broken feed as well as that of the breed particles. Depending on the Weibull parameter, m, the number of failed feed particles increases by a factor of 1.3 to 2; the corresponding factor for breed particles is between 3.5 and 60

  7. Evolutionary enhancement of the SLIM-MAUD method of estimating human error rates

    International Nuclear Information System (INIS)

    Zamanali, J.H.; Hubbard, F.R.; Mosleh, A.; Waller, M.A.

    1992-01-01

    The methodology described in this paper assigns plant-specific dynamic human error rates (HERs) for individual plant examinations based on procedural difficulty, on configuration features, and on the time available to perform the action. This methodology is an evolutionary improvement of the success likelihood index methodology (SLIM-MAUD) for use in systemic scenarios. It is based on the assumption that the HER in a particular situation depends of the combined effects of a comprehensive set of performance-shaping factors (PSFs) that influence the operator's ability to perform the action successfully. The PSFs relate the details of the systemic scenario in which the action must be performed according to the operator's psychological and cognitive condition

  8. Predictive power of the DASA-IV: Variations in rating method and timescales.

    Science.gov (United States)

    Nqwaku, Mphindisi; Draycott, Simon; Aldridge-Waddon, Luke; Bush, Emma-Louise; Tsirimokou, Alexandra; Jones, Dominic; Puzzo, Ignazio

    2018-05-10

    This project evaluated the predictive validity of the Dynamic Appraisal of Situational Aggression - Inpatient Version (DASA-IV) in a high-secure psychiatric hospital in the UK over 24 hours and over a single nursing shift. DASA-IV scores from three sequential nursing shifts over a 24-hour period were compared with the mean (average of three scores across the 24-hour period) and peak (highest of the three scores across the 24-hour period) scores across these shifts. In addition, scores from a single nursing shift were used to predict aggressive incidents over each of the following three shifts. The DASA-IV was completed by nursing staff during handover meetings, rating 43 male psychiatric inpatients over a period of 6 months. Data were compared to incident reports recorded over the same period. Receiver operating characteristic (ROC) curves and generalized estimating equations assessed the predictive ability of various DASA-IV scores over 24-hour and single-shift timescales. Scores from the DASA-IV based on a single shift had moderate predictive ability for aggressive incidents occurring the next calendar day, whereas scores based on all three shifts had excellent predictive ability. DASA-IV scores from a single shift showed moderate predictive ability for each of the following three shifts. The DASA-IV has excellent predictive ability for aggressive incidents within a secure setting when data are summarized over a 24-hour period, as opposed to when a single rating is taken. In addition, it has moderate value for predicting incidents over even shorter timescales. © 2018 Australian College of Mental Health Nurses Inc.

  9. Recent amendments of the KTA 2101.2 fire barrier resistance rating method for German NPP and comparison to the Eurocode t-equivalent method

    Energy Technology Data Exchange (ETDEWEB)

    Forell, Burkhard [Gesellschaft fuer Anlagen- und Reaktorsicherheit (GRS) gGmbH, Koeln (Germany)

    2015-12-15

    The German nuclear standard KTA2101 on ''Fire Protection in Nuclear Power Plants'', Part 2: ''Fire Protection of Structural Plant Components'' includes a simplified method for the fire resistance rating of fire barrier elements based on the t-equivalent approach. The method covers the specific features of compartments in nuclear power plant buildings in terms of the boundary conditions which have to be expected in the event of fire. The method has proven to be relatively simple and straightforward to apply. The paper gives an overview of amendments with respect to the rating method made within the regular review of the KTA 2101.2. A comparison to the method of the non-nuclear Eurocode 1 is also provided. The Eurocode method is closely connected to the German standard DIN 18230 on structural fire protection in industrial buildings. Special emphasis of the comparison is given to the ventilation factor, which has a large impact on the required fire resistance.

  10. 41 CFR 302-7.14 - Are there any disadvantages to using the commuted rate method for transporting HHG, PBP&E and...

    Science.gov (United States)

    2010-07-01

    ... disadvantages to using the commuted rate method for transporting HHG, PBP&E and temporary storage? 302-7.14... disadvantages to using the commuted rate method for transporting HHG, PBP&E and temporary storage? Yes. The disadvantages to using the commuted rate method for transporting HHG, PBP&E and temporary storage are that the...

  11. A new analytical method for estimating lumped parameter constants of linear viscoelastic models from strain rate tests

    Science.gov (United States)

    Mattei, G.; Ahluwalia, A.

    2018-04-01

    We introduce a new function, the apparent elastic modulus strain-rate spectrum, E_{app} ( \\dot{ɛ} ), for the derivation of lumped parameter constants for Generalized Maxwell (GM) linear viscoelastic models from stress-strain data obtained at various compressive strain rates ( \\dot{ɛ}). The E_{app} ( \\dot{ɛ} ) function was derived using the tangent modulus function obtained from the GM model stress-strain response to a constant \\dot{ɛ} input. Material viscoelastic parameters can be rapidly derived by fitting experimental E_{app} data obtained at different strain rates to the E_{app} ( \\dot{ɛ} ) function. This single-curve fitting returns similar viscoelastic constants as the original epsilon dot method based on a multi-curve global fitting procedure with shared parameters. Its low computational cost permits quick and robust identification of viscoelastic constants even when a large number of strain rates or replicates per strain rate are considered. This method is particularly suited for the analysis of bulk compression and nano-indentation data of soft (bio)materials.

  12. An effective method of increasing production rate of onion-like fullerenes

    Energy Technology Data Exchange (ETDEWEB)

    Liu Wen; Meng Qingsen [College of Materials Science and Engineering, Taiyuan University of Technology, Taiyuan, 030024 (China)], E-mail: lw915136@sina.com.cn

    2009-09-01

    Onion-like fullerenes (OLFs) were synthesized by arc discharge in benzene using graphite as electrode and ferrocene as catalyst. The effect of ferrocene on the morphologies and structures of the OLFs was investigated by HRTEM and XRD. Results show that ferrocene directly influenced the morphology and yield of OLFs: The degree of graphitization is better. The diameters of the OLFs can be controlled in the range between 10 and 30 nm The method described here suggests a novel and promising route to synthesize OLFs in large scales.

  13. Magma addition rates in continental arcs: New methods of calculation and global implications

    Science.gov (United States)

    Ratschbacher, B. C.; Paterson, S. R.

    2017-12-01

    The transport of mass, heat and geochemical constituents (elements and volatiles) from the mantle to the atmosphere occurs via magma addition to the lithosphere. Calculation of magma addition rates (MARs) in continental arcs based on exposed proportions of igneous arc rocks is complex and rarely consistently determined. Multiple factors influence MAR calculations such as crust versus mantle contributions to magmas, a change in MARs across the arc and with depths throughout the arc crustal column, `arc tempos' with periods of high and low magmatic activity, the loss of previous emplaced arc rocks by subsequent magmatism and return to the mantle, arc migration, variations in the intrusive versus extrusive additions and evolving arc widths and thicknesses during tectonism. All of these factors need to be considered when calculating MARs.This study makes a new attempt to calculate MARs in continental arcs by studying three arc sections: the Famatinian arc, Argentina, the Sierra Nevada batholith, California and the Coast Mountain batholith, Washington and British Columbia. Arcs are divided into fore-arc, main arc and back arc sections and `boxes' with a defined width, length and thickness spanning upper middle and lower crustal levels are assigned to each section. Representative exposed crustal slices for each depth are then used to calculate MARs based on outcrop proportions for each box. Geochemical data is used to infer crustal recycling percentages and total thickness of the arc. Preliminary results show a correlation between MARs, crustal thicknesses and magmatic flare-up durations. For instance, the Famatinian arc shows a strong decrease in MARs between the main arc section (9.4 km3/Ma/arc-km) and the fore-arc (0.61 km3/Ma/arc-km) and back-arc (1.52 km3/Ma/arc-km) regions and an increase in the amount of magmatism with depth.Global MARs over geologic timescales have the potential to investigate mantle melt generation rates and the volatile outgassing contribution

  14. Monitoring the Error Rate of Modern Methods of Construction Based on Wood

    Science.gov (United States)

    Švajlenka, Jozef; Kozlovská, Mária

    2017-06-01

    A range of new and innovative construction systems, currently developed, represent modern methods of construction (MMC), which has the ambition to improve the performance parameters of buildings throughout their life cycle. Regarding the implementation modern methods of construction in Slovakia, assembled buildings based on wood seem to be the most preferred construction system. In the study, presented in the paper, were searched already built and lived-in wood based family houses. The residents' attitudes to such type of buildings in the context with declared designing and qualitative parameters of efficiency and sustainability are overlooked. The methodology of the research study is based on the socio-economic survey carried out during the years 2015 - 2017 within the Slovak Republic. Due to the large extent of data collected through questionnaire, only selected parts of the survey results are evaluated and discussed in the paper. This paper is aimed at evaluating the quality of buildings expressed in a view of users of existing wooden buildings. Research indicates some defects, which can be eliminated in the next production process. Research indicates, that some defects occur, so the production process quality should be improved in the future development.

  15. Impact Localization Method for Composite Plate Based on Low Sampling Rate Embedded Fiber Bragg Grating Sensors

    Directory of Open Access Journals (Sweden)

    Zhuo Pang

    2017-01-01

    Full Text Available Fiber Bragg Grating (FBG sensors have been increasingly used in the field of Structural Health Monitoring (SHM in recent years. In this paper, we proposed an impact localization algorithm based on the Empirical Mode Decomposition (EMD and Particle Swarm Optimization-Support Vector Machine (PSO-SVM to achieve better localization accuracy for the FBG-embedded plate. In our method, EMD is used to extract the features of FBG signals, and PSO-SVM is then applied to automatically train a classification model for the impact localization. Meanwhile, an impact monitoring system for the FBG-embedded composites has been established to actually validate our algorithm. Moreover, the relationship between the localization accuracy and the distance from impact to the nearest sensor has also been studied. Results suggest that the localization accuracy keeps increasing and is satisfactory, ranging from 93.89% to 97.14%, on our experimental conditions with the decrease of the distance. This article reports an effective and easy-implementing method for FBG signal processing on SHM systems of the composites.

  16. Cooling rate and microstructure of surface layers of 5KhNM steel, machined by electroerosion method

    International Nuclear Information System (INIS)

    Foteev, N.K.; Ploshkin, V.V.; Lyakishev, V.A.; Shirokov, S.V.

    1982-01-01

    The cooling rate and microstructure of surface layers of steel 5KhNM machined by electroerosion method have been studied. It is shown that the difference in heating rate of the surface layers with electric discharge over the 5KhNM steel samples depth results in the intensive size reduction of the microstructure. In the surface layer alongside with martensite residual austenite is present, the lattice period of which increases with the increase of pulse duration, carbide phase of complex composition appears, and concentrational heterogeneity in alloying elements (except carbon) is absent

  17. Cooling rate and microstructure of surface layers of 5KhNM steel, machined by electroerosion method

    Energy Technology Data Exchange (ETDEWEB)

    Foteev, N.K.; Ploshkin, V.V.; Lyakishev, V.A.; Shirokov, S.V.

    1982-01-01

    The cooling rate and microstructure of surface layers of steel 5KhNM machined by electroerosion method have been studied. It is shown that the difference in heating rate of the surface layers with electric discharge over the 5KhNM steel samples depth results in the intensive size reduction of the microstructure. In the surface layer alongside with martensite residual austenite is present, the lattice period of which increases with the increase of pulse duration, carbide phase of complex composition appears, and concentrational heterogeneity in alloying elements (except carbon) is absent.

  18. The calibration of rating models estimation of the probability of default based on advanced pattern classification methods

    CERN Document Server

    Konrad, Paul Markus

    2014-01-01

    All across Europe, a drama of historical proportions is unfolding as the debt crisis continues to rock the worldwide financial landscape. Whilst insecurity rises, the general public, policy makers, scientists and academics are searching high and low for independent and objective analyses that may help to assess this unusual situation. For more than a century, rating agencies had developed methods and standards to evaluate and analyze companies, projects or even sovereign countries. However, due to their dated internal processes, the independence of these rating agencies is being questioned, ra

  19. On a method of evaluation of failure rate of equipment and pipings under excess-earthquake loadings

    International Nuclear Information System (INIS)

    Shibata, H.; Okamura, H.

    1979-01-01

    This paper deals with a method of evaluation of the failure rate of equipment and pipings in nuclear power plants under an earthquake which is exceeding the design basis earthquake. If we put the ratio of the maximum ground acceleration of an earthquake to that of the design basis earthquake as n, then the failure rate or the probability of failure is the function of n as p(n). The purpose of this study is establishing the procedure of evaluation of the relation n vs. p(n). (orig.)

  20. A new lattice hydrodynamic model based on control method considering the flux change rate and delay feedback signal

    Science.gov (United States)

    Qin, Shunda; Ge, Hongxia; Cheng, Rongjun

    2018-02-01

    In this paper, a new lattice hydrodynamic model is proposed by taking delay feedback and flux change rate effect into account in a single lane. The linear stability condition of the new model is derived by control theory. By using the nonlinear analysis method, the mKDV equation near the critical point is deduced to describe the traffic congestion. Numerical simulations are carried out to demonstrate the advantage of the new model in suppressing traffic jam with the consideration of flux change rate effect in delay feedback model.

  1. The indoor air and children's health study: methods and incidence rates.

    Science.gov (United States)

    Marbury, M C; Maldonado, G; Waller, L

    1996-03-01

    The Indoor Air and Children's Health Study is a prospective cohort study of the relation between indoor air pollution and lower respiratory illness (LRI) during the first 2 years of life. Information on family and household characteristics was obtained from a health maintenance organization for 1,424 infants enrolled at birth. Data on LRI were abstracted from medical records. The incidence of all LRI was 48.4 per 100 child-years. Wheezing-associated respiratory illness (WARI)/asthma was the most common specific LRI, with an incidence of 11.5 per 100 child-years. Total LRI incidence was lowest during the first 6 months of life. Girls had lower incidence than boys [rate ratio (RR) = 0.8; 95% confidence interval (CI) = 0.7-0.8)]. With the exception of croup, all LRI were most common during February and March. These results are comparable with those of other prospective studies. Consistent with other studies, self-reported maternal smoking demonstrated an RR of 1.5 (95% CI = 1.2-1.8) for total LRI, but the association varied for specific LRIs from 2.3 (95% CI = 1.5-3.0) for WARI/asthma to 1.0 (95% CI = 0.7-1.6) for bronchitis.

  2. Evaluation of Burning Test Rate Method for Flammable Solids to Increase air-Cargo Safety.

    Science.gov (United States)

    Lukežič, Marjan; Marinšek, Marjan; Faganeli, Jadran

    2010-03-01

    This paper deals with a standard classification procedure for readily combustible solids and their assignment to the relevant packing groups according to international air-cargo legislation and regulations. The current International Air Transport Association and United Nations Orange Book regulations were used on chemically similar substances: hexamethylenetetramine and Dancook ignition briquettes, which are both assigned into the same Packing Group III. To critically evaluate the degree of hazard both chemicals present, a standard burning test rate as well as thermogravimetry, differential scanning calorimetry and evolved gas analysis measurements were performed. It was shown that relatively small changes in the chemical composition of the material may have essential influence on the package group determination. Taking into account all the facts collected in the experimental work, it was concluded that ignition briquettes will undergo spontaneous combustion if exposed to elevated temperatures and, from this point of view, represent higher risk than hexamethylenetetramine during air transportation. Therefore, ignition briquettes should be classified into Packing Group II.

  3. The Normalized-Rate Iterative Algorithm: A Practical Dynamic Spectrum Management Method for DSL

    Directory of Open Access Journals (Sweden)

    Statovci Driton

    2006-01-01

    Full Text Available We present a practical solution for dynamic spectrum management (DSM in digital subscriber line systems: the normalized-rate iterative algorithm (NRIA. Supported by a novel optimization problem formulation, the NRIA is the only DSM algorithm that jointly addresses spectrum balancing for frequency division duplexing systems and power allocation for the users sharing a common cable bundle. With a focus on being implementable rather than obtaining the highest possible theoretical performance, the NRIA is designed to efficiently solve the DSM optimization problem with the operators' business models in mind. This is achieved with the help of two types of parameters: the desired network asymmetry and the desired user priorities. The NRIA is a centralized DSM algorithm based on the iterative water-filling algorithm (IWFA for finding efficient power allocations, but extends the IWFA by finding the achievable bitrates and by optimizing the bandplan. It is compared with three other DSM proposals: the IWFA, the optimal spectrum balancing algorithm (OSBA, and the bidirectional IWFA (bi-IWFA. We show that the NRIA achieves better bitrate performance than the IWFA and the bi-IWFA. It can even achieve performance almost as good as the OSBA, but with dramatically lower requirements on complexity. Additionally, the NRIA can achieve bitrate combinations that cannot be supported by any other DSM algorithm.

  4. The Normalized-Rate Iterative Algorithm: A Practical Dynamic Spectrum Management Method for DSL

    Science.gov (United States)

    Statovci, Driton; Nordström, Tomas; Nilsson, Rickard

    2006-12-01

    We present a practical solution for dynamic spectrum management (DSM) in digital subscriber line systems: the normalized-rate iterative algorithm (NRIA). Supported by a novel optimization problem formulation, the NRIA is the only DSM algorithm that jointly addresses spectrum balancing for frequency division duplexing systems and power allocation for the users sharing a common cable bundle. With a focus on being implementable rather than obtaining the highest possible theoretical performance, the NRIA is designed to efficiently solve the DSM optimization problem with the operators' business models in mind. This is achieved with the help of two types of parameters: the desired network asymmetry and the desired user priorities. The NRIA is a centralized DSM algorithm based on the iterative water-filling algorithm (IWFA) for finding efficient power allocations, but extends the IWFA by finding the achievable bitrates and by optimizing the bandplan. It is compared with three other DSM proposals: the IWFA, the optimal spectrum balancing algorithm (OSBA), and the bidirectional IWFA (bi-IWFA). We show that the NRIA achieves better bitrate performance than the IWFA and the bi-IWFA. It can even achieve performance almost as good as the OSBA, but with dramatically lower requirements on complexity. Additionally, the NRIA can achieve bitrate combinations that cannot be supported by any other DSM algorithm.

  5. A Comprehensive Software and Database Management System for Glomerular Filtration Rate Estimation by Radionuclide Plasma Sampling and Serum Creatinine Methods.

    Science.gov (United States)

    Jha, Ashish Kumar

    2015-01-01

    Glomerular filtration rate (GFR) estimation by plasma sampling method is considered as the gold standard. However, this method is not widely used because the complex technique and cumbersome calculations coupled with the lack of availability of user-friendly software. The routinely used Serum Creatinine method (SrCrM) of GFR estimation also requires the use of online calculators which cannot be used without internet access. We have developed user-friendly software "GFR estimation software" which gives the options to estimate GFR by plasma sampling method as well as SrCrM. We have used Microsoft Windows(®) as operating system and Visual Basic 6.0 as the front end and Microsoft Access(®) as database tool to develop this software. We have used Russell's formula for GFR calculation by plasma sampling method. GFR calculations using serum creatinine have been done using MIRD, Cockcroft-Gault method, Schwartz method, and Counahan-Barratt methods. The developed software is performing mathematical calculations correctly and is user-friendly. This software also enables storage and easy retrieval of the raw data, patient's information and calculated GFR for further processing and comparison. This is user-friendly software to calculate the GFR by various plasma sampling method and blood parameter. This software is also a good system for storing the raw and processed data for future analysis.

  6. The Development of the circadian heart rate rhytm (CDR) in Asian infants

    OpenAIRE

    Stanislaus Sandarupa, Drs., M.A., Ph.D.

    2011-01-01

    Although the human fetus can follow the maternal circadian thythm, the enterained expression of the circadian clock, based in the suprachiasmatic nucleus (SCN) of the hypothalamus awaits postnatal maturation of the retinal hypothalamic tract, and melatonin neurotransmission. Objective: To test the hypothesis that term-born Asian Infants, at reduced risk to die of Sudden Infant Death Syndrome (SIDS) exhibit a circadian heat rate thythm (CHR) at a later age than non-Asian term infants.

  7. Degreasing method for the seborrheic areas with respect to regaining sebum excretion rate to casual level.

    Science.gov (United States)

    Rode, Birgitte; Ivens, Ulla; Serup, Jørgen

    2000-05-01

    BACKGROUND/AIMS: Sebum excreted from the seborrheic glands keeps the skin surface subtle and moist. Before determining the activity of seborrheic glands, the skin surface must be degreased to remove contamination but without provoking sebum excretion. The purpose of this study was to set up a standardised degreasing procedure for various seborrheic areas in different skin types. The method will take day-to-day variations into account with respect to the kinetics of refatting. METHODS: The Sebumeter(R) from Courage+Khazaka is used to quantify the sebum excretion. Day-to-day variations were measured on the forehead in groups of 12 volunteers on 2 consecutive days. The degreasing procedure was investigated by individual cleaning with alcohol compared to washing with a mild detergent followed by wipes with alcohol on the forehead. The degree of refatting was monitored until 3 h after defatting on seborrheic areas: the forehead, cheek, nose, chin and upper back. RESULTS: There was no statistical significant difference in the variation from day to day (Pskin types was observed. An individual difference in the number of alcoholic wipes needed to degrease the forehead was seen. Washing followed by several repetitions of alcoholic wipes was not sufficient for the forehead, chin and nose (P>0.05). For the cheek and upper back, it was sufficient to wash with soap (Pskin until the sebum output reached the casual level was 2 h (P>0.05). The area under the curve (AUC) indicates that individual skin types return to casual level after defatting. CONCLUSION: There was no statistically significant day-to-day variation using the Sebumeter(R). We ended up with different degreasing procedures in different seborrheic areas. Washing gently with a detergent solution and then performing three wipes with alcohol was optimal for degreasing the forehead, nose and chin. For the cheek and upper back, it was sufficient to use a mild soap. Casual level was reached after 2 h in all seborrheic

  8. A method for the direct numerical simulation of hypersonic boundary-layer instability with finite-rate chemistry

    International Nuclear Information System (INIS)

    Marxen, Olaf; Magin, Thierry E.; Shaqfeh, Eric S.G.; Iaccarino, Gianluca

    2013-01-01

    A new numerical method is presented here that allows to consider chemically reacting gases during the direct numerical simulation of a hypersonic fluid flow. The method comprises the direct coupling of a solver for the fluid mechanical model and a library providing the physio-chemical model. The numerical method for the fluid mechanical model integrates the compressible Navier–Stokes equations using an explicit time advancement scheme and high-order finite differences. This Navier–Stokes code can be applied to the investigation of laminar-turbulent transition and boundary-layer instability. The numerical method for the physio-chemical model provides thermodynamic and transport properties for different gases as well as chemical production rates, while here we exclusively consider a five species air mixture. The new method is verified for a number of test cases at Mach 10, including the one-dimensional high-temperature flow downstream of a normal shock, a hypersonic chemical reacting boundary layer in local thermodynamic equilibrium and a hypersonic reacting boundary layer with finite-rate chemistry. We are able to confirm that the diffusion flux plays an important role for a high-temperature boundary layer in local thermodynamic equilibrium. Moreover, we demonstrate that the flow for a case previously considered as a benchmark for the investigation of non-equilibrium chemistry can be regarded as frozen. Finally, the new method is applied to investigate the effect of finite-rate chemistry on boundary layer instability by considering the downstream evolution of a small-amplitude wave and comparing results with those obtained for a frozen gas as well as a gas in local thermodynamic equilibrium

  9. Recruitment Methods and Show Rates to a Prostate Cancer Early Detection Program for High-Risk Men: A Comprehensive Analysis

    Science.gov (United States)

    Giri, Veda N.; Coups, Elliot J.; Ruth, Karen; Goplerud, Julia; Raysor, Susan; Kim, Taylor Y.; Bagden, Loretta; Mastalski, Kathleen; Zakrzewski, Debra; Leimkuhler, Suzanne; Watkins-Bruner, Deborah

    2009-01-01

    Purpose Men with a family history (FH) of prostate cancer (PCA) and African American (AA) men are at higher risk for PCA. Recruitment and retention of these high-risk men into early detection programs has been challenging. We report a comprehensive analysis on recruitment methods, show rates, and participant factors from the Prostate Cancer Risk Assessment Program (PRAP), which is a prospective, longitudinal PCA screening study. Materials and Methods Men 35–69 years are eligible if they have a FH of PCA, are AA, or have a BRCA1/2 mutation. Recruitment methods were analyzed with respect to participant demographics and show to the first PRAP appointment using standard statistical methods Results Out of 707 men recruited, 64.9% showed to the initial PRAP appointment. More individuals were recruited via radio than from referral or other methods (χ2 = 298.13, p < .0001). Men recruited via radio were more likely to be AA (p<0.001), less educated (p=0.003), not married or partnered (p=0.007), and have no FH of PCA (p<0.001). Men recruited via referrals had higher incomes (p=0.007). Men recruited via referral were more likely to attend their initial PRAP visit than those recruited by radio or other methods (χ2 = 27.08, p < .0001). Conclusions This comprehensive analysis finds that radio leads to higher recruitment of AA men with lower socioeconomic status. However, these are the high-risk men that have lower show rates for PCA screening. Targeted motivational measures need to be studied to improve show rates for PCA risk assessment for these high-risk men. PMID:19758657

  10. Discussion on the method to increase the successful rate of L5/S1 intervertebral disc puncture

    International Nuclear Information System (INIS)

    Zhong Xianyi; Li Liangjun; Yu Chengxin

    2007-01-01

    Objective: To study the effective methods of L 5 /S 1 intervertebral disc puncture without drilling to solve the barriers from iliaca. Methods: (1) puncturing with belly-buttock sticking out: to enlarge waist sacro-iliaca angle to move the puncture point up; (2) puncturing through intervertebral edge: puncturing through L 5 to 1/3 intervertebral disc to make the puncture point move Up; (3) puncturing through L 5 /S 1 intervertebral disc with the self-made puncture location instrument. Results with the methods, 280 cases with L 5 /S 1 intervertebral disc protrusion have been successfully punctured, with successful rate 100%. Conclusion: These methods are ideal and easy to use to treat L 5 /S 1 intervertebral disc protrusion puncture, and worth popularizing. (authors)

  11. The Forecasting of Labour Force Participation and the Unemployment Rate in Poland and Turkey Using Fuzzy Time Series Methods

    Directory of Open Access Journals (Sweden)

    Yolcu Ufuk

    2016-06-01

    Full Text Available Fuzzy time series methods based on the fuzzy set theory proposed by Zadeh (1965 was first introduced by Song and Chissom (1993. Since fuzzy time series methods do not have the assumptions that traditional time series do and have effective forecasting performance, the interest on fuzzy time series approaches is increasing rapidly. Fuzzy time series methods have been used in almost all areas, such as environmental science, economy and finance. The concepts of labour force participation and unemployment have great importance in terms of both the economy and sociology of countries. For this reason there are many studies on their forecasting. In this study, we aim to forecast the labour force participation and unemployment rate in Poland and Turkey using different fuzzy time series methods.

  12. Wind energy development: Methods to assess bird and bat fatality rates post-construction

    Science.gov (United States)

    Huso, Manuela; Dalthorp, Daniel; Miller, T J; Bruns, Dawn

    2016-01-01

    Monitoring fatalities at wind energy facilities after they have been constructed can provide valuable information regarding impacts of wind power development on wildlife. The objective of this monitoring is to estimate abundance of a super-population of carcasses that entered the area within a designated period of time. By definition, the population is not closed and carcasses can enter as they are killed through collision with turbines, and leave as they are removed by scavengers or decompose to a point where they are not recognizable. In addition, the population is not inherently mobile, but can only change location through some external force. A focus on number of animal carcasses comprising the super-population, combined with peculiar traits that resist classic assumptions, distinguish fatality estimation at wind-power facilities from more classic abundance estimates that can be addressed through mark-recapture techniques or other well-known abundance estimators. We review the available methods to estimate the super-population of carcasses at wind power facilities. We discuss the role of these estimates in determining appropriate levels of minimization and mitigation of impacts to individual species of concern. We discuss the potential to extrapolate these measurements to reflect the cumulative effect of the industry on individual species. Finally, we suggest avenues of research needed to strengthen our understanding of the effect wind power development has, and might have in the future, on wildlife on this continent and worldwide.

  13. Normalized impact factor (NIF): an adjusted method for calculating the citation rate of biomedical journals.

    Science.gov (United States)

    Owlia, P; Vasei, M; Goliaei, B; Nassiri, I

    2011-04-01

    The interests in journal impact factor (JIF) in scientific communities have grown over the last decades. The JIFs are used to evaluate journals quality and the papers published therein. JIF is a discipline specific measure and the comparison between the JIF dedicated to different disciplines is inadequate, unless a normalization process is performed. In this study, normalized impact factor (NIF) was introduced as a relatively simple method enabling the JIFs to be used when evaluating the quality of journals and research works in different disciplines. The NIF index was established based on the multiplication of JIF by a constant factor. The constants were calculated for all 54 disciplines of biomedical field during 2005, 2006, 2007, 2008 and 2009 years. Also, ranking of 393 journals in different biomedical disciplines according to the NIF and JIF were compared to illustrate how the NIF index can be used for the evaluation of publications in different disciplines. The findings prove that the use of the NIF enhances the equality in assessing the quality of research works produced by researchers who work in different disciplines. Copyright © 2010 Elsevier Inc. All rights reserved.

  14. [Comparison of methods for the identification of the most common yeasts in the clinical microbiology laboratory].

    Science.gov (United States)

    Guelfand, L; Grisolía, P; Bozzano, C; Kaufman, S

    2003-01-01

    We evaluated different methods for the routine identification of medically important yeasts. A total of 150 clinical isolates: 25 C. albicans, 25 C. tropicalis, 25 C. glabrata, 25 C. parapsilosis, 8 C. guilliermondii, 11 C. krusei and 31 Cryptococcus neoformans were tested by Yeast Biochemical Card bioMerieux Vitek (YBC), CHROMagar Candida (CHR). The addition of yeast morphology in Corn Meal agar-Tween 80 (AM) to YBC and CHR was also evaluated. The reference methods used were: API 20C, germ tube formation, AM, Christensen urea and Birdseed agar. YBC identified 135 yeasts with an overall accuracy of 90%. Sensitivity (S) and specificity (E) were: 92-98% for C. albicans and C. tropicalis; 84-99% for C. papapsilosis; 100-99% for C. glabrata; 91-100% for C. krusei; 63-98% for C. guilliermondii and 90-99% for Cryptococcus neoformans, respectively. CHR identified correctly 100% for C. albicans, 92% for C. tropicalis and 91% for C. krusei. Both methods combined with AM provided 100% S and E. We found that YBC system was appropriate for identification of yeasts isolated from human sources. CHR was effective and easy to use for identification of C. albicans, C. tropicalis and C. krusei. The routine use of AM with both methods is recommended.

  15. Monte Carlo calculation of correction factors for radionuclide neutron source emission rate measurement by manganese bath method

    International Nuclear Information System (INIS)

    Li Chunjuan; Liu Yi'na; Zhang Weihua; Wang Zhiqiang

    2014-01-01

    The manganese bath method for measuring the neutron emission rate of radionuclide sources requires corrections to be made for emitted neutrons which are not captured by manganese nuclei. The Monte Carlo particle transport code MCNP was used to simulate the manganese bath system of the standards for the measurement of neutron source intensity. The correction factors were calculated and the reliability of the model was demonstrated through the key comparison for the radionuclide neutron source emission rate measurements organized by BIPM. The uncertainties in the calculated values were evaluated by considering the sensitivities to the solution density, the density of the radioactive material, the positioning of the source, the radius of the bath, and the interaction cross-sections. A new method for the evaluation of the uncertainties in Monte Carlo calculation was given. (authors)

  16. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75157 Solanum lycopersicum Solanaceae ... Seed quality_salt stress Salt I_mean germination... rate (reciprocal of the mean germination time; MGT-1) 2,3 ... Chr09 106.5-112.7 2.41 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  17. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75239 Solanum lycopersicum Solanaceae ... Seed quality_osmotic stress Osmotic I_mean germination... rate (reciprocal of the mean germination time; MGT-1) 2,3 ... Chr12 39.4-64.0 2.02 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  18. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75274 Solanum lycopersicum Solanaceae ... Seed quality_osmotic stress Osmotic II_mean germination... rate (reciprocal of the mean germination time; MGT-1) 2,3 ... Chr02 15.4-31.3 2.94 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  19. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75205 Solanum lycopersicum Solanaceae ... Seed quality_salt stress Salt II_mean germination... rate (reciprocal of the mean germination time; MGT-1) 2,3 ... Chr02 15.4-26.6 3.43 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  20. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75233 Solanum lycopersicum Solanaceae ... Seed quality_osmotic stress Osmotic I_mean germination... rate (reciprocal of the mean germination time; MGT-1) 2,3 ... Chr02 7.6-23.7 3.5 ... 10.1111/j.1365-3040.2011.02463.x 22074055