WorldWideScience

Sample records for rapid ana ii

  1. Serpentine Locomotion Articulated Chain: ANA II

    Directory of Open Access Journals (Sweden)

    A. M. Cardona

    2005-01-01

    Full Text Available When humanity faces challenges in solving problems beyond their technical resources, and has no foundation to solve a problem, engineering must search for an answer developing new concepts and innovative frameworks to excel these limitations and travel beyond our capabilities. This project “Serpentine locomotion articulated chain: ANA II” is a self-contained robot built to evaluate the behavior of the platform being capable of serpentine movements, in a modular chain mechanical design, based on a master/slave architecture.

  2. Zn(II, Pb(II and Cd(II levels in livers and muscles of wild duck (Anas platyrhynchos hunting in El Melah Lagoon (NE Tunisia

    Directory of Open Access Journals (Sweden)

    Cherif Ensibi

    2014-08-01

    Full Text Available We investigated the levels of Zn(II], Pb(II] and Cd(II] in livers and muscles of the wild duck (Anas platyrhynchos hunting in El Melah lagoon in northeastern Tunisia from December 2010. Analysis of variance shows that no significant differences in metals levels were found between samples, but it should be pointed out that the number of samples was small. HSD Tukey test show that the amount of Cd(II], Zn(II] and Pb(II] in the levers was higher than in the muscles. The results obtained suggest the importance of wild ducks as bioindicators of heavy metal pollution.

  3. Ana Mendieta

    Directory of Open Access Journals (Sweden)

    María Íñigo Clavo

    2002-01-01

    Full Text Available El siguiente texto hace un recorrido sobre algunos asuntos tratados en la producción artística de Ana Mendieta a través de una única obra: La performance Body Prints. En contraposición con la limpieza minimalista y en contraposición también con la opaca y compleja retícula gestual de Pollock, Mendieta presenta su cuerpo desnudo impregnado de sangre. Tendida en el suelo es cubierta primero con una sábana blanca y luego con una negra hasta dejar su huella en ambas. Las dos sábanas manchadas de sangre nos remiten a la figura del sudario, elemento que Mendieta usó en varios trabajos durante los primeros setenta.The following text looks at some of Ana Mendietas' subject matters through her piece: The Body Prints. Mendieta presents her naked body ipregnated of blood in contrast to the minimal cleannes, and also in contrast to Pollocks opaque and complex gestures network. On the floor she is first covered with a white sheet and then with a black one until a trace of her figure is imprinted on the sheets. The two sheets remaind us the shrough figure, an element that Mendieta used in several pieces during the seventies. Analyzing this performance we recognize themes such as violence, birth and female identity claimed by the feminist theory of diference.

  4. ANA (Antinuclear Antibody Test)

    Science.gov (United States)

    ... Testing Leptin Levetiracetam Lipase Lipid Profile Lipoprotein (a) Lithium Liver Panel Lp-PLA2 Lupus Anticoagulant Testing Luteinizing ... Scleroderma Elsewhere On The Web Lupus Foundation of America American College of Rheumatology: Antinuclear Antibodies (ANA) American ...

  5. TOPAZ II Anti-Criticality Device Rapid Prototype

    Science.gov (United States)

    Campbell, Donald R.; Otting, William D.

    1994-07-01

    The Ballistic Missile Defense Organization (BMDO) has been working on a Nuclear Electric Propulsion Space Test Project (NEPSTP) using an existing Russian Topaz II reactor system to power the NEPSTP satellite. Safety investigations have shown that it will be possible to safely launch the Topaz II system in the United States with some modification to preclude water flooded criticality. A ``fuel-out'' water subcriticality concept was selected by the Los Alamos National Laboratory (LANL) as the baseline concept. A fuel-out anti-criticality device (ACD) conceptual design was developed by Rockwell. The concept functions to hold the fuel from the four centermost thermionic fuel elements (TFEs) outside the reactor during launch and reliably inserts the fuel into the reactor once the operational orbit is achieved. A four-tenths scale ACD rapid prototype model, fabricated from the CATIA solids design model, clearly shows in three dimensions the relative size and spatial relationship of the ACD components.

  6. Experiência da adoção do I e II Consensos Brasileiros de Fator Antinuclear por Imunofluorescência Indireta em Células HEp-2 em um hospital universitário Experience of an university hospital on the implementation of I and II Brazilian Consensuses for Standardization of ANA in HEp-2 Cells

    Directory of Open Access Journals (Sweden)

    Claudia Cilene Fernandes Correia Laurino

    2009-04-01

    Full Text Available OBJETIVO:Analisar a prevalência, padrões e títulos do Fator Antinuclear (FAN por imunofluorescência indireta (IFI em células HEp-2 em um hospital universitário após a adoção do I e II Consensos Nacional para Padronização dos Laudos de FAN em Células HEp-2. MÉTODO: Foi realizado um estudo transversal, em que foram revisados os laudos de FAN por IFI originários de solicitações encaminhadas ao Serviço de Patologia Clínica do Hospital de Clínicas de Porto Alegre (SPC/HCPA entre 2002 e 2005. RESULTADOS:Foram analisados 12.095 testes de FAN no período entre 2002 e 2005. As solicitações com resultado reagente foram de 2.577 (21,30%, com média anual de 644±233. Houve um aumento significativo na proporção de resultados reagentes posterior à adoção dos Consensos (p OBJECTIVE: To evaluate the prevalence of patterns and titers of antinuclear antibodies (ANA detected by indirect immunofluorescence (IIF technique on HEp-2 cells in a university hospital following the introduction of I and II Brazilian Consensuses for Standardization of ANA in HEp-2 Cells. METHODS:A transversal study was performed between 2002 and 2005 during which all ANA orders to Serviço de Hospital de Clínicas de Porto Alegre (SPC/HCPA and cognate results were reviewed. RESULTS:12.095 tests of ANA were revised. The number of positive results during this period was 2.577 (21.30%, annual mean 644 (SD: 233. A marked increase in the number of positive results was observed following the introduction of the Consensuses (p < 0.001. Rheumatology was the medical specialty which requested the highest number of ANA testing per patient although a significant decrease of these numbers was observed after the introduction of the Consensus in 2004 (p < 0,001. Nuclear fine speckled immunofluorescence labeling was the most frequently ANA pattern observed, 52.3% (453/866, and low ANA titers (1/80 and 1/160 more commonly detected (27.8% and 29.4%, respectively. CONCLUSION

  7. Rapid metabolism of exogenous angiotensin II by catecholaminergic neuronal cells in culture media.

    Science.gov (United States)

    Basu, Urmi; Seravalli, Javier; Madayiputhiya, Nandakumar; Adamec, Jiri; Case, Adam J; Zimmerman, Matthew C

    2015-02-01

    Angiotensin II (AngII) acts on central neurons to increase neuronal firing and induce sympathoexcitation, which contribute to the pathogenesis of cardiovascular diseases including hypertension and heart failure. Numerous studies have examined the precise AngII-induced intraneuronal signaling mechanism in an attempt to identify new therapeutic targets for these diseases. Considering the technical challenges in studying specific intraneuronal signaling pathways in vivo, especially in the cardiovascular control brain regions, most studies have relied on neuronal cell culture models. However, there are numerous limitations in using cell culture models to study AngII intraneuronal signaling, including the lack of evidence indicating the stability of AngII in culture media. Herein, we tested the hypothesis that exogenous AngII is rapidly metabolized in neuronal cell culture media. Using liquid chromatography-tandem mass spectrometry, we measured levels of AngII and its metabolites, Ang III, Ang IV, and Ang-1-7, in neuronal cell culture media after administration of exogenous AngII (100 nmol/L) to a neuronal cell culture model (CATH.a neurons). AngII levels rapidly declined in the media, returning to near baseline levels within 3 h of administration. Additionally, levels of Ang III and Ang-1-7 acutely increased, while levels of Ang IV remained unchanged. Replenishing the media with exogenous AngII every 3 h for 24 h resulted in a consistent and significant increase in AngII levels for the duration of the treatment period. These data indicate that AngII is rapidly metabolized in neuronal cell culture media, and replenishing the media at least every 3 h is needed to sustain chronically elevated levels. © 2015 The Authors. Physiological Reports published by Wiley Periodicals, Inc. on behalf of the American Physiological Society and The Physiological Society.

  8. Purification and Characterization of Anacardium occidentale (Cashew) Allergens Ana o 1, Ana o 2, and Ana o 3

    NARCIS (Netherlands)

    Reitsma, Marit; Bastiaan-Net, Shanna; Sforza, Stefano; Valk, Van Der J.P.M.; Gerth Van Wijk, Van Roy; Savelkoul, H.F.J.; Jong, De N.W.; Wichers, H.J.

    2016-01-01

    In this study a fast and simple purification procedure for the three known allergens from cashew (7S globulin Ana o 1, 11S globulin Ana o 2, and 2S albumin Ana o 3) is described. The purified allergens are characterized by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE),

  9. Comparison of treatment outcome using two definitions of rapid cycling in subjects with bipolar II disorder.

    Science.gov (United States)

    Amsterdam, Jay D; Lorenzo-Luaces, Lorenzo; DeRubeis, Robert J

    2017-02-01

    We examined differences in treatment outcome between Diagnostic and Statistical Manual Fourth Edition (DSM-IV)-defined rapid cycling and average lifetime-defined rapid cycling in subjects with bipolar II disorder. We hypothesized that, compared with the DSM-IV definition, the average lifetime definition of rapid cycling may better identify subjects with a history of more mood lability and a greater likelihood of hypomanic symptom induction during long-term treatment. Subjects ≥18 years old with a bipolar II major depressive episode (n=129) were categorized into DSM-IV- and average lifetime-defined rapid cycling and prospectively treated with either venlafaxine or lithium monotherapy for 12 weeks. Responders (n=59) received continuation monotherapy for six additional months. These exploratory analyses found moderate agreement between the two rapid-cycling definitions (κ=0.56). The lifetime definition captured subjects with more chronic courses of bipolar II depression, whereas the DSM-IV definition captured subjects with more acute symptoms of hypomania. There was no difference between rapid-cycling definitions with respect to the response to acute venlafaxine or lithium monotherapy. However, the lifetime definition was slightly superior to the DSM-IV definition in identifying subjects who went on to experience hypomanic symptoms during continuation therapy. Although sample sizes were limited, the findings suggest that the lifetime definition of rapid cycling may identify individuals with a chronic rapid-cycling course and may also be slightly superior to the DSM-IV definition in identifying individuals with hypomania during relapse-prevention therapy. These findings are preliminary in nature and need replication in larger, prospective, bipolar II studies. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  10. Casein kinase II is elevated in solid human tumours and rapidly proliferating non-neoplastic tissue

    DEFF Research Database (Denmark)

    Münstermann, U; Fritz, G; Seitz, G

    1990-01-01

    Protein kinase CKII (i.e. casein kinase II, CKII, NII) is expressed at a higher level in rapidly proliferating tissues and in solid human tumours (e.g. colorectal carcinomas) when compared to the corresponding non-neoplastic colorectal mucosa. This could be shown by (a) Western blotting of cellular...

  11. Homogeneous, heterogeneous and biological oxidation of iron(II) in rapid sand filtration

    NARCIS (Netherlands)

    Beek, van C.G.E.M.; Hiemstra, T.; Hofs, B.; Nederlof, M.M.; Paassen, van J.A.M.; Reijnen, G.K.

    2012-01-01

    Homogeneous, heterogeneous and biological oxidation may precipitate iron(II) as iron(III) hydroxides. In this paper we evaluate the conditions under which each of these processes is dominant in rapid sand filtration (RSF). It is demonstrated that in the presence of iron(III) hydroxide precipitates

  12. The "Clarice" by Ana Miranda

    Directory of Open Access Journals (Sweden)

    Juliane Cardozo de Mello

    2012-11-01

    Full Text Available This article intends to analyze the novel Clarice of Ana Miranda, through the concepts of historiographic metafiction and imaginary biography, because the narrative parodies the biography genre, emphasizing the banal moments of the character's life and focuses inside of narrated person and, furthermore, shows a fragmented structure composed by a series of intertexts with the work of novelist Clarice Lispector, protagonist of the book, which are used for constructing a mosaic of character at some stages of her life as, for example, the childhood and youth related to the first book of the author Perto do coração selvagem. Another important aspect refers to the reinvention of a great name of Brazilian literature through his work, and especially from the imagination of a reader - Ana Miranda - who creates "her Clarice" and from this discussion, debates of the creation of the production literary art, the condition of writer and women in society.

  13. Rapid Photodegradation of Methyl Orange (MO Assisted with Cu(II and Tartaric Acid.

    Directory of Open Access Journals (Sweden)

    Jing Guo

    Full Text Available Cu(II and organic carboxylic acids, existing extensively in soil and aquatic environments, can form complexes that may play an important role in the photodegradation of organic contaminants. In this paper, the catalytic role of Cu(II in the removal of methyl orange (MO in the presence of tartaric acid with light was investigated through batch experiments. The results demonstrate that the introduction of Cu(II could markedly enhance the photodegradation of MO. In addition, high initial concentrations of Cu(II and tartaric acid benefited the decomposition of MO. The most rapid removal of MO assisted by Cu(II was achieved at pH 3. The formation of Cu(II-tartaric acid complexes was assumed to be the key factor, generating hydroxyl radicals (•OH and other oxidizing free radicals under irradiation through a ligand-to-metal charge-transfer pathway that was responsible for the efficient degradation of MO. Some intermediates in the reaction system were also detected to support this reaction mechanism.

  14. Prediction of Class II improvement after rapid maxillary expansion in early mixed dentition

    Directory of Open Access Journals (Sweden)

    Alberto Caprioglio

    2017-04-01

    Full Text Available Abstract Background The aim of this study is to identify cephalometric pretreatment parameters for prediction of Class II improvement induced by rapid maxillary expansion. Methods Lateral cephalograms of 30 patients (mean age 8.3 ± 1.6 years old showing Class II molar relationship and undergone to rapid maxillary expansion on the upper deciduous molars were traced before treatment, and molar relation changes were evaluated on dental casts before and after treatment. Overall treatment time lasted 10.2 ± 2 months. Good responders (18 subjects, 10 females and 8 males showed improvement of at least 2.50 mm, and bad responders (12 subjects, 7 females and 5 males showed no improvement, improvement less than 2.50 mm, or worsening of molar relationship after treatment. Student’s t test was used to assess significance of differences between groups, and discriminant analysis allowed identification of predictive pretreatment variables. Results Articular angle, superior gonial angle, and mandibular dimensions (Co-Gn, S-Ar, Ar-Go, Go-Me showed significant differences in the comparison between groups. Mandibular length Co-Gn and superior gonial angle were selected as significant predictive variable for discrimination. Conclusions Patients with smaller mandibular length and more acute superior gonial angle are expected to have more chances to improve molar Class II after rapid maxillary expansion.

  15. The universe of ANA testing: a case for point-of-care ANA testing.

    Science.gov (United States)

    Konstantinov, Konstantin N; Rubin, Robert L

    2017-12-01

    Testing for total antinuclear antibodies (ANA) is a critical tool for diagnosis and management of autoimmune diseases at both the primary care and subspecialty settings. Repurposing of ANA from a test for lupus to a test for any autoimmune condition has driven the increase in ANA requests. Changes in ANA referral patterns include early or subclinical autoimmune disease detection in patients with low pre-test probability and use of negative ANA results to rule out underlying autoimmune disease. A positive result can lead to further diagnostic considerations. Currently, ANA tests are performed in centralized laboratories; an alternative would be ANA testing at the clinical point-of-care (POC). By virtue of its near real-time data collection capability, low cost, and ease of use, we believe the POC ANA has the potential to enable a new paradigm shift in autoimmune serology testing.

  16. Plastid Phylogenomics Resolve Deep Relationships among Eupolypod II Ferns with Rapid Radiation and Rate Heterogeneity.

    Science.gov (United States)

    Wei, Ran; Yan, Yue-Hong; Harris, A J; Kang, Jong-Soo; Shen, Hui; Xiang, Qiao-Ping; Zhang, Xian-Chun

    2017-06-01

    The eupolypods II ferns represent a classic case of evolutionary radiation and, simultaneously, exhibit high substitution rate heterogeneity. These factors have been proposed to contribute to the contentious resolutions among clades within this fern group in multilocus phylogenetic studies. We investigated the deep phylogenetic relationships of eupolypod II ferns by sampling all major families and using 40 plastid genomes, or plastomes, of which 33 were newly sequenced with next-generation sequencing technology. We performed model-based analyses to evaluate the diversity of molecular evolutionary rates for these ferns. Our plastome data, with more than 26,000 informative characters, yielded good resolution for deep relationships within eupolypods II and unambiguously clarified the position of Rhachidosoraceae and the monophyly of Athyriaceae. Results of rate heterogeneity analysis revealed approximately 33 significant rate shifts in eupolypod II ferns, with the most heterogeneous rates (both accelerations and decelerations) occurring in two phylogenetically difficult lineages, that is, the Rhachidosoraceae-Aspleniaceae and Athyriaceae clades. These observations support the hypothesis that rate heterogeneity has previously constrained the deep phylogenetic resolution in eupolypods II. According to the plastome data, we propose that 14 chloroplast markers are particularly phylogenetically informative for eupolypods II both at the familial and generic levels. Our study demonstrates the power of a character-rich plastome data set and high-throughput sequencing for resolving the recalcitrant lineages, which have undergone rapid evolutionary radiation and dramatic changes in substitution rates. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  17. Mandibular response after rapid maxillary expansion in class II growing patients: a pilot randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Roberta Lione

    2017-11-01

    Full Text Available Abstract Background The aim of this pilot randomized controlled trial (RCT was to evaluate the sagittal mandibular response induced by rapid maxillary expansion (RME therapy in mixed dentition patients with class II malocclusion, comparing the effects of bonded RME and banded RME with a matched untreated class II control group. Methods This RCT was designed in parallel with an allocation ratio of 1:1:1. The sample consisted of 30 children with a mean age of 8.1 ± 0.6 years who were randomly assigned to three groups: group 1 treated with bonded RME, group 2 treated with banded RME, and group 3 the untreated control group. All patients met the following inclusion criteria: early mixed dentition, class II molar relationship, transverse discrepancy ≥ 4 mm, overjet ≥ 5 mm, and prepubertal skeletal maturity stage (CS1–CS2. The expansion screw was activated one quarter of a turn per day (0.25 mm until overcorrection was reached. For each subject, lateral cephalograms and plaster casts were obtained before treatment (T1 and after 1 year (T2. A randomization list was created for the group assignment, with an allocation ratio of 1:1:1. The observer who performed all the measurements was blinded to group assignment. The study was single-blinded in regard to statistical analysis. Results RME was effective in the correction of maxillary deficiency. Class II patients treated with both types of RME showed no significant improvement of the anteroposterior relationship of the maxilla and the mandible at both skeletal and occlusal levels. The acrylic splint RME had significant effects on reducing the skeletal vertical dimension and the gonial angle. Conclusions The orthopedic expansion did not affect the sagittal relationship of class II patients treated in the early mixed dentition when compared with the untreated control group. Additional studies with a larger sample are warranted to elucidate individual variations in dento-skeletal mandibular

  18. Mandibular response after rapid maxillary expansion in class II growing patients: a pilot randomized controlled trial.

    Science.gov (United States)

    Lione, Roberta; Brunelli, Valerio; Franchi, Lorenzo; Pavoni, Chiara; Quiroga Souki, Bernardo; Cozza, Paola

    2017-11-06

    The aim of this pilot randomized controlled trial (RCT) was to evaluate the sagittal mandibular response induced by rapid maxillary expansion (RME) therapy in mixed dentition patients with class II malocclusion, comparing the effects of bonded RME and banded RME with a matched untreated class II control group. This RCT was designed in parallel with an allocation ratio of 1:1:1. The sample consisted of 30 children with a mean age of 8.1 ± 0.6 years who were randomly assigned to three groups: group 1 treated with bonded RME, group 2 treated with banded RME, and group 3 the untreated control group. All patients met the following inclusion criteria: early mixed dentition, class II molar relationship, transverse discrepancy ≥ 4 mm, overjet ≥ 5 mm, and prepubertal skeletal maturity stage (CS1-CS2). The expansion screw was activated one quarter of a turn per day (0.25 mm) until overcorrection was reached. For each subject, lateral cephalograms and plaster casts were obtained before treatment (T1) and after 1 year (T2). A randomization list was created for the group assignment, with an allocation ratio of 1:1:1. The observer who performed all the measurements was blinded to group assignment. The study was single-blinded in regard to statistical analysis. RME was effective in the correction of maxillary deficiency. Class II patients treated with both types of RME showed no significant improvement of the anteroposterior relationship of the maxilla and the mandible at both skeletal and occlusal levels. The acrylic splint RME had significant effects on reducing the skeletal vertical dimension and the gonial angle. The orthopedic expansion did not affect the sagittal relationship of class II patients treated in the early mixed dentition when compared with the untreated control group. Additional studies with a larger sample are warranted to elucidate individual variations in dento-skeletal mandibular response to the maxillary expansion protocol in class-II

  19. Sulfur rich microporous polymer enables rapid and efficient removal of mercury(II) from water.

    Science.gov (United States)

    Xu, Dan; Wu, Winston Duo; Qi, Hao-Jun; Yang, Rui-Xia; Deng, Wei-Qiao

    2017-12-29

    Design and synthesis of adsorbents for efficient decontamination of hazardous contaminants Hg2+ from wastewater, based on a facile and economical strategy, is an attractive target. Here, a novel sulfur rich microporous polymer (sulfur content of 31.4 wt %) with high surface area as well as densely populated sulfur atom with fast accessibility was reported to remove mercury (II) from water. The as prepared polymer (SMP) exhibited high binding affinity, high adsorption capacities, rapid adsorption kinetics, and good recyclability for Hg2+. The adsorption capacity of SMP was 595.2 mg g-1. Furthermore, SMP could reduce trace concentrations of Hg2+ from 200 p. p. b. to a level below drinking water standards (2 p. p. b.) within 3 min. This work allows large-scale production of sulfur rich porous materials for the practical application in water treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Windows 7 ieviešana

    OpenAIRE

    Laurens, Matīss

    2011-01-01

    Kvalifikācijas darbā „Windows 7 ieviešana” tiek izveidota Windows 7 operētājsistēmas ieviešanas sistēma virtuālajā vidē, kas sevī ietver visu ieviešanas produktu un rīku apvienojumu, lai būtu pieejami visi „Lite Touch Installation” ieviešanas veidi noteiktu ieviešanas situāciju risināšanai. Ieviešanas sistēma tiek veidota ar mērķi izveidot pilnība strādājošu infrastruktūru virtuālajā vidē, pēc kuras piemēra pēc tam būtu iespējams realizēt strādājošu ievi...

  1. The 9-methyl group of retinal is essential for rapid Meta II decay and phototransduction quenching in red cones.

    Science.gov (United States)

    Estevez, Maureen E; Kolesnikov, Alexander V; Ala-Laurila, Petri; Crouch, Rosalie K; Govardovskii, Victor I; Cornwall, M Carter

    2009-08-01

    Cone photoreceptors of the vertebrate retina terminate their response to light much faster than rod photoreceptors. However, the molecular mechanisms underlying this rapid response termination in cones are poorly understood. The experiments presented here tested two related hypotheses: first, that the rapid decay rate of metarhodopsin (Meta) II in red-sensitive cones depends on interactions between the 9-methyl group of retinal and the opsin part of the pigment molecule, and second, that rapid Meta II decay is critical for rapid recovery from saturation of red-sensitive cones after exposure to bright light. Microspectrophotometric measurements of pigment photolysis, microfluorometric measurements of retinol production, and single-cell electrophysiological recordings of flash responses of salamander cones were performed to test these hypotheses. In all cases, cones were bleached and their visual pigment was regenerated with either 11-cis retinal or with 11-cis 9-demethyl retinal, an analogue of retinal lacking the 9-methyl group. Meta II decay was four to five times slower and subsequent retinol production was three to four times slower in red-sensitive cones lacking the 9-methyl group of retinal. This was accompanied by a significant slowing of the recovery from saturation in cones lacking the 9-methyl group after exposure to bright (>0.1% visual pigment photoactivated) but not dim light. A mathematical model of the turn-off process of phototransduction revealed that the slower recovery of photoresponse can be explained by slower Meta decay of 9-demethyl visual pigment. These results demonstrate that the 9-methyl group of retinal is required for steric chromophore-opsin interactions that favor both the rapid decay of Meta II and the rapid response recovery after exposure to bright light in red-sensitive cones.

  2. VaxCelerate II: rapid development of a self-assembling vaccine for Lassa fever.

    Science.gov (United States)

    Leblanc, Pierre; Moise, Leonard; Luza, Cybelle; Chantaralawan, Kanawat; Lezeau, Lynchy; Yuan, Jianping; Field, Mary; Richer, Daniel; Boyle, Christine; Martin, William D; Fishman, Jordan B; Berg, Eric A; Baker, David; Zeigler, Brandon; Mais, Dale E; Taylor, William; Coleman, Russell; Warren, H Shaw; Gelfand, Jeffrey A; De Groot, Anne S; Brauns, Timothy; Poznansky, Mark C

    2014-01-01

    Development of effective vaccines against emerging infectious diseases (EID) can take as much or more than a decade to progress from pathogen isolation/identification to clinical approval. As a result, conventional approaches fail to produce field-ready vaccines before the EID has spread extensively. Lassa is a prototypical emerging infectious disease endemic to West Africa for which no successful vaccine is available. We established the VaxCelerate Consortium to address the need for more rapid vaccine development by creating a platform capable of generating and pre-clinically testing a new vaccine against specific pathogen targets in less than 120 d A self-assembling vaccine is at the core of the approach. It consists of a fusion protein composed of the immunostimulatory Mycobacterium tuberculosis heat shock protein 70 (MtbHSP70) and the biotin binding protein, avidin. Mixing the resulting protein (MAV) with biotinylated pathogen-specific immunogenic peptides yields a self-assembled vaccine (SAV). To meet the time constraint imposed on this project, we used a distributed R&D model involving experts in the fields of protein engineering and production, bioinformatics, peptide synthesis/design and GMP/GLP manufacturing and testing standards. SAV immunogenicity was first tested using H1N1 influenza specific peptides and the entire VaxCelerate process was then tested in a mock live-fire exercise targeting Lassa fever virus. We demonstrated that the Lassa fever vaccine induced significantly increased class II peptide specific interferon-γ CD4(+) T cell responses in HLA-DR3 transgenic mice compared to peptide or MAV alone controls. We thereby demonstrated that our SAV in combination with a distributed development model may facilitate accelerated regulatory review by using an identical design for each vaccine and by applying safety and efficacy assessment tools that are more relevant to human vaccine responses than current animal models.

  3. Santa Ana River Design Memorandum Number 1. Phase 2. GDM on the Santa Ana River Mainstem Including Santiago Creek. Volume 1. Seven Oaks Dam. Appendix A

    Science.gov (United States)

    1988-08-01

    o-c 10 0- a 50 MINA 1.0r$FSIGMA W. 2.0% P~T MC. W- .2.0% OPT I 0010. .0030 10 20.0 300 AXIAL STRAIIN (PERCENT) AXIAL STRAIN (PERCENT) SETY PAYS...2.69II project Upper Sanita Ana River rarnrks Remolded to 95% Anea Impervious Borrow Div. No. 96586 - 96587 Darins No. TH-85-4 jale No. Comp A Depth

  4. Rapid Genome-wide Recruitment of RNA Polymerase II Drives Transcription, Splicing, and Translation Events during T Cell Responses

    Directory of Open Access Journals (Sweden)

    Kathrin Davari

    2017-04-01

    Full Text Available Activation of immune cells results in rapid functional changes, but how such fast changes are accomplished remains enigmatic. By combining time courses of 4sU-seq, RNA-seq, ribosome profiling (RP, and RNA polymerase II (RNA Pol II ChIP-seq during T cell activation, we illustrate genome-wide temporal dynamics for ∼10,000 genes. This approach reveals not only immediate-early and posttranscriptionally regulated genes but also coupled changes in transcription and translation for >90% of genes. Recruitment, rather than release of paused RNA Pol II, primarily mediates transcriptional changes. This coincides with a genome-wide temporary slowdown in cotranscriptional splicing, even for polyadenylated mRNAs that are localized at the chromatin. Subsequent splicing optimization correlates with increasing Ser-2 phosphorylation of the RNA Pol II carboxy-terminal domain (CTD and activation of the positive transcription elongation factor (pTEFb. Thus, rapid de novo recruitment of RNA Pol II dictates the course of events during T cell activation, particularly transcription, splicing, and consequently translation.

  5. Smēķēšanas ierobežošanas politika Latvijā

    OpenAIRE

    Kaula, Linda

    2008-01-01

    Viens no darba mērķiem ir smēķēšanas ierobežošanas politikas ieviešanas analīze, kas nozīmē PVO izstrādāto smēķēšanas ierobežošanas programmu analīzi un VM īstenoto darbību analīzi smēķēšanas ierobežošanai Latvijā. Par vēl vienu darba mērķi ir noteikta NVO aktivitāšu ietekmes uz VM smēķēšanas ierobežošanas politikas īstenošanas izvērtēšana, lai uzzinātu to, vai biznesa interešu pārstāvētām NVO ir reāla ietekme uz smēķēšanas ierobežošanas politikas īstenošanu. Darba mērķis ir arī realizēto pr...

  6. Título do blogue: ana vidigal

    Directory of Open Access Journals (Sweden)

    Cristina Néry

    2012-10-01

    Full Text Available Existe desde 2007 e constitui‑se como um arquivo pessoal e actualizado do trabalho de 30 décadas da artista plástica Ana Vidigal. Afirma: a «pintura é tudo o que se cola». O processo é estabelecido assim pela artista como um regime de reciclagem de elementos que passa pelo uso de objectos da sua infância ou elementos característicos da cultura dos anos sessenta. O blogue é gerido pela própria, para que não fique nada por ver, como um depósito de narrativas do seu trabalho. Ana Vidigal convoca...

  7. Improving Class II malocclusion as a side-effect of rapid maxillary expansion: a prospective clinical study.

    Science.gov (United States)

    Guest, Susan S; McNamara, James A; Baccetti, Tiziano; Franchi, Lorenzo

    2010-11-01

    The objective of this prospective clinical study was to evaluate the dentoalveolar and skeletal effects induced by rapid maxillary expansion (RME) therapy in mixed dentition patients with Class II Division 1 malocclusion compared with a matched untreated Class II Division 1 control group. The treatment sample consisted of cephalometric records of 50 patients with Class II malocclusion (19 boys, 31 girls) treated with an RME protocol including an acrylic splint expander. Some patients also had a removable mandibular Schwarz appliance or maxillary incisor bracketing as part of their treatment protocol. Postexpansion, the patients were stabilized with a removable maintenance plate or a transpalatal arch. The mean age at the start of treatment of the RME group was 8.8 years (T1), with a prephase 2 treatment cephalogram (T2) taken 4.0 years later. The control sample, derived from the records of 3 longitudinal growth studies, consisted of the cephalometric records of 50 Class II subjects (28 boys, 22 girls). The mean age of initial observation for the control group was 8.9 years, and the mean interval of observation was 4.1 years. All subjects in both groups were prepubertal at T1 and showed comparable prevalence rates for prepubertal or postpubertal stages at T2. Independent-sample Student t tests were used to examine between-group differences. Class II patients treated with the described bonded RME protocol showed statistically significant increases in mandibular length and advancement of pogonion relative to nasion perpendicular. The acrylic splint RME had significant effects on the anteroposterior relationship of the maxilla and the mandible, as shown by the improvements toward Class I in the maxillomandibular differential value, the Wits appraisal value, and the ANB angle. Patients treated with the bonded RME showed the greatest effects of therapy at the occlusal level, specifically highly significant improvement of Class II molar relationship and decrease in

  8. Long-term outcome of skeletal Class II Division 1 malocclusion treated with rapid palatal expansion and Kloehn cervical headgear.

    Science.gov (United States)

    Filho, Roberto M A Lima; Lima, Anna Letícia

    2003-08-01

    The treatment of a patient with a skeletal Class II Division 1 malocclusion, with excessive overjet, complete overbite, airway obstruction, and severe arch length deficiency in the mandibular dental arch, is presented. The maxilla was narrow compared with the mandible, and the posterior teeth were compensated, with the maxillary teeth inclined buccally and the mandibular teeth inclined lingually. The palatal vault was extremely high. Treatment included rapid palatal expansion to correct the transverse maxillary deficiency and Kloehn cervical headgear to correct the anteroposterior skeletal discrepancy. Long-term stability (12-year follow-up) is reported.

  9. The RAPID-II Neuropsychological Test battery for subjects aged 20 to 49 years: Norms and cognitive profile.

    Science.gov (United States)

    Binetruy, M; Mauny, F; Lavaux, M; Meyer, A; Sylvestre, G; Puyraveau, M; Berger, E; Magnin, E; Vandel, P; Galmiche, J; Chopard, G

    2017-06-30

    Cognitive evaluation of young subjects is now widely carried out for non-traumatic diseases such as multiple sclerosis, HIV, or sleep disorders. This evaluation requires normative data based on healthy adult samples. However, most clinicians use a set of tests that were normed in an isolated manner from different samples using different cutoff criteria. Thus, the score of an individual may be considered either normal or impaired according to the norms used. It is well established that healthy adults obtained low-test scores when a battery of tests is administered. Thus, the knowledge of low base rates is required so as to minimize false diagnosis of cognitive impairment. The aim of this study was twofold (1) to provide normative data for RAPID-II battery in healthy adults, and (2) estimate the proportion of healthy adults having low scores across this battery. Norms for the 44 test scores of the RAPID-II test battery were developed using the overall sample of 335 individuals based on three categories of age (20 to 29, 30 to 39, and 40 to 49 years) and two educational levels: Baccalaureate or higher educational degree (high educational level), lower than baccalaureate (low educational level). The 5th, 25th, 50th, and 75th percentiles were calculated from the six age and education subsamples and used to define norms. The frequency of low scores on the RAPID-II battery was calculated by simultaneously examining the performance of 33 primary scores. A low score was defined as less than or equal to the 5th percentile drawn from the six age and education normative subsamples. In addition, the percentages of low scores were also determined when all possible combinations of two-test scores across the RAPID-II were considered in the overall normative sample. Our data showed that 59.4% subjects of the normative sample obtained at least one or more low score. With more than 9 test scores, this percentage was equal to 0% in the normative sample. Among all combinations of two

  10. U Portugalii dusha poeta / Ana Paula Zacarias ; interv. Aleksandr Shegedin

    Index Scriptorium Estoniae

    Zacarias, Ana Paula

    2006-01-01

    Äsja avatud Portugali saatkonda juhtiv suursaadik Ana Paula Baptista Grade Zacarias jagab Portugali kogemusi seoses liitumisega Euroopa Liiduga. Eesti-Portugali suhted, suursaadiku esmamuljed Eestist

  11. Lietas nosūtīšana tiesai, kā viens no procesa pabeigšanas veidiem

    OpenAIRE

    Osovska, Viktorija

    2017-01-01

    Maģistra darba tēma ir „Krimināllietas nodošana tiesai, ka viens no pirmstiesas procesa pabeigšanas veidiem”. Maģistra darbam ir savstarpēji saistīti mērķi. Pirmkārt, noskaidrot pirmstiesas procesa pabeigšanas unkrimināllietas nodošanas tiesai procesuālā kārtība Latvijas tiesību sistēmā. Otrkārt, identificēt pirmstiesas kriminālprocesa pabeigšanas nododot krimināllietu tiesai saistītās juridiskās problēmas un izstrādāt to risinājumus. Maģistra darbā pētīta pirmstiesas procesa pabeigšanas kārt...

  12. Ana Maria Lorandi and the Ethnohistory's train

    Directory of Open Access Journals (Sweden)

    Alejandra Ramos

    2017-03-01

    Full Text Available In 2016 it was celebrated eighty years of the Dra. Ana María Lorandi, who dedicated over fifty years to academic research. This finds as active as ever, working on new projects and following the new generations of anthropologists interested in Ethnohistory. In writing this article, we think of honoring it by examining its contribution through three forms of action that she developed prominently: management, research and insertion into transnational networks. Throughout the text we proposed to recover his voice, trying to incorporate his vision of the history of scientific development in which played a key role.

  13. Correction of a skeletal Class II malocclusion with severe crowding by a specially designed rapid maxillary expander.

    Science.gov (United States)

    Wang, Honghong; Feng, Jing; Lu, Peijun; Shen, Gang

    2015-02-01

    To correct an Angle Class II malocclusion or to create spaces in the maxillary arch by nonextraction treatment, distal movement of the maxillary molars is required. Various modalities for distalizing the buccal segment have been reported. Conventional extraoral appliances can be used to obtain maximum anchorage. However, many patients reject headgear wear because of social and esthetic concerns, and the success of this treatment depends on patient compliance. Intraoral appliances, such as repelling magnets, nickel-titanium coils, pendulum appliance, Jones jig appliance, distal jet appliance, and modified Nance appliance, have been introduced to distalize the molars with little or no patient cooperation. However, intraoral appliances can result in anchorage loss of the anterior teeth and distal tipping of the maxillary molars. In this case report, we introduce a diversified rapid maxillary expansion appliance that was custom designed and fabricated for the treatment of a growing girl with a skeletal Class II malocclusion and severe crowding from a totally lingually positioned lateral incisor. The appliance concomitantly expanded the maxilla transversely and retracted the buccal segment sagittally, distalizing the maxillary molars to reach a Class I relationship and creating the spaces to displace the malpositioned lateral incisor. The uniqueness of this special diversified rapid maxillary expansion appliance was highlighted by a series of reconstructions and modifications at different stages of the treatment to reinforce the anchorage. Copyright © 2015 American Association of Orthodontists. Published by Elsevier Inc. All rights reserved.

  14. Arsenic analysis II: rapid separation and quantification of inorganic arsenic plus metabolites and arsenobetaine from urine.

    Science.gov (United States)

    Nixon, D E; Moyer, T P

    1992-12-01

    We describe the rapid separation of inorganic arsenic plus metabolites from arsenobetaine or seafood arsenic in urine. Traditional, high-pressure liquid chromatography is replaced by disposable silica-based cation-exchange cartridges for this separation. Both fractions are quickly separated and collected for analysis by atomic absorption spectrophotometry. Analytical recovery of both fractions is > or = 95%, with an overall precision (CV) ranging from 1.6% to 6.4%. Using this method, we correctly identified the sources of arsenic exposure, whether of inorganic or seafood origin, in 11 urine specimens supplied by the Centre de Toxicologie du Quebec.

  15. Changes in skeletal and dental relationship in Class II Division I malocclusion after rapid maxillary expansion: a prospective study.

    Science.gov (United States)

    Baratieri, Carolina; Alves, Matheus; Bolognese, Ana Maria; Nojima, Matilde C G; Nojima, Lincoln I

    2014-01-01

    To assess skeletal and dental changes immediately after rapid maxillary expansion (RME) in Class II Division 1 malocclusion patients and after a retention period, using cone beam computed tomography (CBCT) imaging. Seventeen children with Class II, Division 1 malocclusion and maxillary skeletal transverse deficiency underwent RME following the Haas protocol. CBCT were taken before treatment (T1), at the end of the active expansion phase (T2) and after a retention period of 6 months (T3). The scanned images were measured anteroposteriorly (SNA, SNB, ANB, overjet and MR) and vertically (N-ANS, ANS-Me, N-Me and overbite). Significant differences were identified immediately after RME as the maxilla moved forward, the mandible moved downward, overjet increased and overbite decreased. During the retention period, the maxilla relapsed backwards and the mandible was displaced forward, leaving patients with an overall increase in anterior facial height. RME treatment allowed more anterior than inferior positioning of the mandible during the retention period, thus significantly improving Class II dental relationship in 75% of the patients evaluated.

  16. Changes in skeletal and dental relationship in Class II Division I malocclusion after rapid maxillary expansion: a prospective study

    Directory of Open Access Journals (Sweden)

    Carolina Baratieri

    2014-06-01

    Full Text Available OBJECTIVE: To assess skeletal and dental changes immediately after rapid maxillary expansion (RME in Class II Division 1 malocclusion patients and after a retention period, using cone beam computed tomography (CBCT imaging. METHODS: Seventeen children with Class II, Division 1 malocclusion and maxillary skeletal transverse deficiency underwent RME following the Haas protocol. CBCT were taken before treatment (T1, at the end of the active expansion phase (T2 and after a retention period of 6 months (T3. The scanned images were measured anteroposteriorly (SNA, SNB, ANB, overjet and MR and vertically (N-ANS, ANS-Me, N-Me and overbite. RESULTS: Significant differences were identified immediately after RME as the maxilla moved forward, the mandible moved downward, overjet increased and overbite decreased. During the retention period, the maxilla relapsed backwards and the mandible was displaced forward, leaving patients with an overall increase in anterior facial height. CONCLUSION: RME treatment allowed more anterior than inferior positioning of the mandible during the retention period, thus significantly improving Class II dental relationship in 75% of the patients evaluated.

  17. STARPTAUTISKĀ BIZNESA PROCESU AUTSORSINGA IZMANTOŠANA

    OpenAIRE

    Artjomovs, Andrejs

    2007-01-01

    Maģistra darba tēze ir „Ārpakalpojumu izmantošanas biznesa procesos starptautiskā prakse." Darbs sastāv no 4 daļām, ievada, secinājumiem un autora priekšlikumiem. Pirmā daļa ir teorētiska un veltīta ārpakalpojumu būtības un funkciju izpētei, riska analīzei, ārpakalpojumu priekšrocībām, vēsturiskajai attīstībai. Otrajā daļā autors analizē ārpakalpojumu stratēģijas izstrādāšanu un ārpakalpojumu izmantošanas procesu. Trešā daļa veltīta globālam apskatam un pasaules tirgus ārpakalpojumu izman...

  18. Communicating stigma: the pro-ana paradox.

    Science.gov (United States)

    Yeshua-Katz, Daphna; Martins, Nicole

    2013-01-01

    This study explores the personal experience of pro-ana bloggers, members of an online community for people with eating disorders. Using Erving Goffman's work on stigma, this study explores the motivations, benefits, and drawbacks of blogging about a stigmatized mental illness, as taken from the bloggers' own perceptive. We conducted 33 interviews with bloggers from seven different countries via phone, Skype, and e-mail. Participants were motivated to blog because they found social support, a way to cope with a stigmatized illness, and means of self-expression. Participants described blogging as a cathartic experience and perceived the social support they received from other members of the pro-ana community as a benefit. The fear that the eating disorder will be revealed if the blog is exposed and the concern that the blog encourages disordered eating were the perceived negative consequences of maintaining such a blog. Thus, blogging about anorexia serves to both alleviate and trigger anxiety about living with this stigmatized illness. Recommendations for future research are made.

  19. Free inside: The Music Class at Santa Ana Jail

    Science.gov (United States)

    Fierro, Joe

    2010-01-01

    This article examines the workings of the music class at the Santa Ana Jail in Santa Ana, California. It gives us insight into a jail system and a music class focused on helping inmates position themselves to become productive members of society. In this article I examine how the facility encourages inmates' good behaviour and why the music class…

  20. Finite element analysis of gradually and rapidly varied unsteady flow in open channel : II. Applications

    Energy Technology Data Exchange (ETDEWEB)

    Han, Kun Yeun; Park, Jae Hong; Lee, Eul Rae [Kyungpook National University, Taegu (Korea, Republic of)

    1997-02-28

    Petrov-Galerkin finite element model for analyzing dynamic wave equation is applied to gradually and rapidly varied unsteady flow. The model is verified by applying to hydraulic jump, nonlinear disturbance propagation in frictionless horizontal channel and dam-break analysis. It shows stable and accurate results compared with analytical solutions for various cases. The model is applied to a surge propagation in a frictionless horizontal channel. Three-dimensional water surface profiles show that the computed result converges to the analytical one with sharp discontinuity. The model is also applied to the Taehwa River to analyze unsteady flood wave propagation. The computed results have good agreements with those of DWOPER model in terms of discharge and stage hydrographs. (author). 19 refs., 22 figs.

  1. Rapid and selective lead (II) colorimetric sensor based on azacrown ether-functionalized gold nanoparticles

    Science.gov (United States)

    Alizadeh, A.; Khodaei, M. M.; Karami, Ch; Workentin, M. S.; Shamsipur, M.; Sadeghi, M.

    2010-08-01

    A gold nanoparticle (AuNPs)-based simple and fast colorimetric sensor for selective detecting of Pb(II) in aqueous solution has been developed. Monodisperse AuNPs (approx. 2.0 nm diameter) has been prepared facilely and further modified with an alkanethiol-bearing monoazacrown ether terminus. These AuNPs are shown to selectively sense Pb2 + through color change, which is visually discernible by an appearance of the surface plasmon band (SPB) at 520 nm. The recognition mechanism is attributed to the unique structure of the monoazacrown ether attached to AuNPs and metal sandwich coordination between two azacrown ether moieties that are attached to separate nanoparticles. This inter-particle cross-linking results in an aggregation and apparent color change from brown to purple. Additionally, TEM experiments support the optical absorption data proving the aggregation between azacrown ether-capped gold nanoparticles. This AuNP-based colorimetric assay is a facile and robust method and allows fast detection of Pb2 + at ambient temperatures. More importantly, the developed technique does not utilize enzymatic reactions, light-sensitive dye molecules, lengthy protocols or sophisticated instrumentation.

  2. Comparative toxicity of lead shot in black ducks (Anas rubripes) and mallards (Anas platyrhynchos)

    Science.gov (United States)

    Rattner, B.A.; Fleming, W.J.; Bunck, C.M.

    1989-01-01

    In winter, pen-reared and wild black ducks (Anas rubripes), and game farm and wild mallards (Anas platyrhynchos), maintained on pelleted feed, were sham-dosed or given one number 4 lead shot. After 14 days, dosed birds were redosed with two or four additional lead shot. This dosing regimen also was repeated in summer using pen-reared black ducks and game farm mallards. Based upon mortality, overt intoxication, weight change, delta-aminolevulinic acid dehydratase activity and protoporphyrin concentration, black ducks and mallards were found to be equally tolerant to lead shot. However, captive wild ducks were more sensitive than their domesticated counterparts, as evidenced by greater mortality and weight loss following lead shot administration. This difference may be related to stress associated with captivity and unnatural diet.

  3. Sex differences in the risk of rapid cycling and other indicators of adverse illness course in patients with bipolar I and II disorder.

    Science.gov (United States)

    Erol, Almila; Winham, Stacey J; McElroy, Susan L; Frye, Mark A; Prieto, Miguel L; Cuellar-Barboza, Alfredo B; Fuentes, Manuel; Geske, Jennifer; Mori, Nicole; Biernacka, Joanna M; Bobo, William V

    2015-09-01

    To examine the independent effects of sex on the risk of rapid cycling and other indicators of adverse illness course in patients with bipolar I disorder (BP-I) or bipolar II disorder (BP-II). We analyzed data from the first 1,225 patients enrolled in the Mayo Clinic Individualized Medicine Biobank for Bipolar Disorder. Demographic and clinical variables were ascertained using standardized questionnaires; height and weight were assessed to determine body mass index (BMI). Rates of rapid cycling, cycle acceleration, and increased severity of mood episodes over time were compared between women and men overall and within subgroups defined by bipolar disorder subtype (BP-I or BP-II). Multiple logistic regression analysis was used to assess the independent effect of sex on the risk of these indicators of adverse illness course. Women had significantly higher rates of rapid cycling than men. Overall rates of rapid cycling were higher in patients with BP-II than BP-I; and sex differences in the rate of rapid cycling were more pronounced in patients with BP-II than BP-I, although the power to detect statistically significant differences was reduced due to the lower sample size of subjects with BP-II. Female sex was a significant predictor of rapid cycling, cycle acceleration, and increased severity of mood episodes over time after adjusting for age, bipolar disorder subtype, BMI, having any comorbid psychiatric disorder, and current antidepressant use. Female sex was associated with significantly higher risk of rapid cycling, cycle acceleration, and increased severity of mood episodes over time in a sample of 1,225 patients with bipolar disorders. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  4. Applications of RIGAKU Dmax Rapid II micro-X-ray diffractometer in the analysis of archaeological metal objects

    Science.gov (United States)

    Mozgai, Viktória; Szabó, Máté; Bajnóczi, Bernadett; Weiszburg, Tamás G.; Fórizs, István; Mráv, Zsolt; Tóth, Mária

    2017-04-01

    During material analysis of archaeological metal objects, especially their inlays or corrosion products, not only microstructure and chemical composition, but mineralogical composition is necessary to be determined. X-ray powder diffraction (XRD) is a widely-used method to specify the mineralogical composition. However, when sampling is not or limitedly allowed due to e.g. the high value of the object, the conventional XRD analysis can hardly be used. Laboratory micro-XRD instruments provide good alternatives, like the RIGAKU Dmax Rapid II micro-X-ray diffractometer, which is a unique combination of a MicroMax-003 third generation microfocus, sealed tube X-ray generator and a curved 'image plate' detector. With this instrument it is possible to measure as small as 10 µm area in diameter on the object. Here we present case studies for the application of the micro-XRD technique in the study of archaeological metal objects. In the first case niello inlay of a Late Roman silver augur staff was analysed. Due to the high value of the object, since it is the only piece known from the Roman Empire, only non-destructive analyses were allowed. To reconstruct the preparation of the niello, SEM-EDX analysis was performed on the niello inlays to characterise their chemical composition and microstructure. Two types of niello are present: a homogeneous, silver sulphide niello (acanthite) and an inhomogeneous silver-copper sulphide niello (exsolution of acanthite and jalpaite or jalpaite and stromeyerite). The micro-X-ray diffractometer was used to verify the mineralogical composition of the niello, supposed on the base of SEM results. In the second case corrosion products of a Late Roman copper cauldron with uncertain provenance were examined, since they may hold clues about the burial conditions (pH, Eh, etc.) of the object. A layer by layer analysis was performed in cross sections of small metal samples by using electron microprobe and micro-X-ray diffractometer. The results

  5. Mechanical Testing of PMCs under Simulated Rapid Heat-Up Propulsion Environments. II; In-Plane Compressive Behavior

    Science.gov (United States)

    Stokes, Eric H.; Shin, E. Eugene; Sutter, James K.

    2003-01-01

    Carbon fiber thermoset polymer matrix composites (PMC) with high temperature polyimide based in-situ polymerized monomer reactant (PMR) resin has been used for some time in applications which can see temperatures up to 550 F. Currently, graphite fiber PMR based composites are used in several aircraft engine components including the outer bypass duct for the GE F-404, exit flaps for the P&W F-100-229, and the core cowl for the GE/Snecma CF6-80A3. Newer formulations, including PMR-II-50 are being investigated as potential weight reduction replacements of various metallic components in next generation high performance propulsion rocket engines that can see temperatures which exceed 550 F. Extensive FEM thermal modeling indicates that these components are exposed to rapid heat-up rates (up to -200 F/sec) and to a maximum temperature of around 600 F. Even though the predicted maximum part temperatures were within the capability of PW-II-50, the rapid heat-up causes significant through-thickness thermal gradients in the composite part and even more unstable states when combined with moisture. Designing composite parts for such extreme service environments will require accurate measurement of intrinsic and transient mechanical properties and the hygrothermal performance of these materials under more realistic use conditions. The mechanical properties of polymers degrade when exposed to elevated temperatures even in the absence of gaseous oxygen. Accurate mechanical characterization of the material is necessary in order to reduce system weight while providing sufficient factors of safety. Historically, the testing of PMCs at elevated temperatures has been plagued by the antagonism between two factors. First, moisture has been shown to profoundly affect the mechanical response of these materials at temperatures above their glass transition temperature while concurrently lowering the material's Tg. Moisture phenomena is due to one or a combination of three effects, i

  6. Meet EPA Scientist Ana Rappold, Ph.D.

    Science.gov (United States)

    EPA Scientist Ana Rappold is a statistician in EPA's Environmental Public Health Division of the National Health and Environmental Effects Research Lab. Her research is focused on the health effects of air pollution.

  7. Use of Strep-tag II for rapid detection and purification of Mycobacterium tuberculosis recombinant antigens secreted by Streptomyces lividans.

    Science.gov (United States)

    Ayala, Julio C; Pimienta, Elsa; Rodríguez, Caridad; Anné, Jozef; Vallín, Carlos; Milanés, María T; King-Batsios, Emmanuel; Huygen, Kris; Van Mellaert, Lieve

    2013-09-01

    Recent results with respect to the secretory production of bio-active Mycobacterium tuberculosis proteins in Streptomyces have stimulated the further exploitation of this host as a bacterial cell factory. However, the rapid isolation of a recombinant protein by conventional procedures can be a restrictive step. A previous attempt to isolate recombinant antigens fused to the widely used 6His-tag was found to be relatively incompatible with secretory production in the Streptomyces host. As an alternative, the eight-residue Strep-tag® II (WSHPQFEK), displaying intrinsic binding affinity towards streptavidin, was evaluated for the secretory production of two M. tuberculosis immunodominant antigens in Streptomyces lividans and their subsequent downstream processing. Therefore, the genes ag85A (Rv3804c, encoding the mycolyl-transferase Ag85A) and Rv2626c (encoding hypoxic response protein 1), were equipped with a 3'-Strep-tag® II-encoding sequence and placed under control of the Streptomyces venezuelae CBS762.70 subtilisin inhibitor (vsi) transcriptional, translational and signal sequences. Strep-tagged Ag85A and Rv2626c proteins were detected in the spent medium of recombinant S. lividans cultures at 48h of growth, and purified using a Strep-Tactin Superflow® matrix. Recombinant Ag85A appeared as a 30-kDa protein of which the N-terminal amino acid sequence was identical to the expected one. Rv2626c was produced in two forms of 17 and 37kDa respectively, both with the same predicted N-terminal sequence, suggesting that the 37-kDa product is an Rv2626c dimer. The obtained results indicate that the Strep-tagII is proteolytically stable in Streptomyces and does not interfere with the membrane translocation of Ag85A and Rv2626c. A comparison of reactivity of serum from tuberculosis patients versus healthy persons by ELISA showed that both S. lividans-derived antigens were recognized by sera of individuals infected with M. tuberculosis, indicating that they remained

  8. A Multifunctional Mn(II) Phosphonate for Rapid Separation of Methyl Orange and Electron-Transfer Photochromism.

    Science.gov (United States)

    Gao, Chao-Ying; Yang, Yang; Ai, Jing; Tian, Hong-Rui; Li, Lei-Jiao; Yang, Weiting; Dang, Song; Sun, Zhong-Ming

    2016-08-08

    A Mn(II) phosphonate of the general formula [Mn(H2 L)2 (H2 O)2 (H2 bibp)] adopts a layered motif with protonated H2 bibp(2+) cations embedded in the channels (H4 L=thiophene-2-phosphonic acid; bibp=4,4'-bis(1-imidazolyl)biphenyl). The title compound exhibits excellent adsorptive removal of methyl orange (MO) dye from aqueous solution. Its advantageous features include fast adsorption, high uptake capacity, selective removal, and reusability, which are of great significance for practical application in wastewater treatment. Meanwhile, the compound displays rapid photochromism upon irradiation with visible light at room temperature. Extensive research has demonstrated that such behavior is based on a ligand-to-ligand charge-transfer (LLCT) mechanism. The irradiated sample possesses an ultra-long-lived charge-separated state. Moreover, not only is the compound the first Mn-based photochromic MOF, but it is also one of the very few examples showing LLCT with non-photochromic components. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Klientu apkalpošanas uzlabošana starptautiskā uzņēmumā AS ,,Drogas"

    OpenAIRE

    Liepiņa, Līva

    2012-01-01

    Sabiedrībā vērojama negatīva attieksme pret uzņēmuma AS „Drogas” klientu apkalpošanas politiku, līdz ar to bakalaura darba mērķis ir, pamatojoties uz teoriju, interviju un semināru analīzi, slepenā pircēja metodes un klientu apmierinātības aptaujas datiem, analizēt klientu apmierinātību ar AS „Drogas” sniegto klientu apkalpošanu un izstrādāt secinājumus un priekšlikumus klientu apkalpošanas uzlabošanas iespējām. Darba uzdevumi ir veikt klientu apkalpošanas teorētisko analīzi, apskatīt gal...

  10. Lasīšanas veicināšanas iespējas 3.klasē

    OpenAIRE

    Rimša, Evita

    2011-01-01

    Pētījuma mērķis: Izpētīt lasīšanas veicināšanas iespējas 3.klasē, izmantojot dažādas lasīšanas veicināšanas metodes, dažādus lasīšanas veidus, veicināt skolēnu interesi par lasīšanu. Pētījuma uzdevumi: 1.Analizēt pedagoģiski psiholoģisko literatūru par skolēna lasītprasmi. 2.Analizēt lasītprasmes veicināšanas metodes pedagoģiskajā literatūrā. 3.Veikt mācību izmēģinājumdarbību, novērojot skolēnus stundās. 4.Veikt skolēnu un viņu vecāku anketēšanu. Hipotēze: Pārzinot skolēn...

  11. Polyacrylamide-phytic acid-polydopamine conducting porous hydrogel for rapid detection and removal of copper (II) ions.

    Science.gov (United States)

    Zhao, Zhen; Chen, Hongda; Zhang, Hua; Ma, Lina; Wang, Zhenxin

    2017-05-15

    In this work, a conducting porous polymer hydrogel-based electrochemical sensor has been developed for rapid detection of copper (II) ions (Cu2+). The polymer (termed as PAAM/PA/PDA) hydrogel is prepared through multi-interactions of the monomers dopamine (DA), acrylamide (AAM) and phytic acid (PA) under mild ambient conditions: the AAM polymerizes through free-radical polymerization, DA occurs poly coupling reaction, and PA crosslinks polydopamine (PDA) and polyacrylamide (PAAM) by hydrogen bonds. The three dimensional (3D) network nanostructured PAAM/PA/PDA hydrogel not only provides a large surface area for increasing the amount of immobilized molecules/ions, but also exhibits a good conductivity. The PAAM/PA/PDA hydrogel-based electrochemical sensor exhibits a low detection limit (1nmolL-1, S/N=3) and wide linear range (from 1nmolL-1 to 1µmolL-1) for Cu2+ detection in aqueous samples. Furthermore, the Cu2+ can be sensitively detected by the electrochemical sensor in different sample matrices, indicating that the electrochemical sensor could be used to monitor Cu2+ with reasonable assay performance in practical samples. The PAAM/PA/PDA hydrogel also exhibits a good capacity to remove Cu2+(231.36±4.70mgg-1), which is superior to those of other adsorption materials reported in the literature. The facile synthesized PAAM/PA/PDA hydrogel provides a novel and regenerable platform for monitoring and removing Cu2+ in real samples. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Pratināšanas kriminālistiskie aspekti

    OpenAIRE

    Urga, Iveta

    2012-01-01

    Ivetas Urgas diplomdarbs „Pratināšanas kriminālistiskie aspekti” veltīts šīs visizplatītākās izmeklēšanas darbības aktuālajām problēmām. Autore veikusi pētījumu gan izmantojot savu praktisko pieredzi, gan intervējot kolēģus- policijas izmeklētājus, gan pētot apjomīgu teorētisko materiālu bāzi, lai risinātu galveno problēmu, paaugstinātu šīs izmeklēšanas darbības efektivitāti. Darbs sastāv no trīs nodaļām, kurās pakāpeniski analizēti šādi jautājumi: 1)Pratināšanas pierādīšanas nozīme un tās...

  13. Rapid adsorption of copper(II and lead(II by rice straw/Fe₃O₄ nanocomposite: optimization, equilibrium isotherms, and adsorption kinetics study.

    Directory of Open Access Journals (Sweden)

    Roshanak Khandanlou

    Full Text Available Rice straw/magnetic nanocomposites (RS/Fe3O4-NCs were prepared via co-precipitation method for removal of Pb(II and Cu(II from aqueous solutions. Response surface methodology (RSM was utilized to find the optimum conditions for removal of ions. The effects of three independent variables including initial ion concentration, removal time, and adsorbent dosage were investigated on the maximum adsorption of Pb (II and Cu (II. The optimum conditions for the adsorption of Pb(II and Cu(II were obtained (100 and 60 mg/L of initial ion concentration, (41.96 and 59.35 s of removal time and 0.13 g of adsorbent for both ions, respectively. The maximum removal efficiencies of Pb(II and Cu(II were obtained 96.25% and 75.54%, respectively. In the equilibrium isotherm study, the adsorption data fitted well with the Langmuir isotherm model. The adsorption kinetics was best depicted by the pseudo-second order model. Desorption experiments showed adsorbent can be reused successfully for three adsorption-desorption cycles.

  14. Cell scientist to watch - Ana Garcia-Saez.

    Science.gov (United States)

    2017-09-01

    Ana Garcia-Saez graduated with a master's degree in biochemistry from the University of Valencia, Spain, before completing a PhD in the laboratory of Jesus Salgado in 2005. Afterwards Ana joined the research group of Petra Schwille at the Dresden University of Technology, Germany. In 2010, she started her own group at BioQuant, the Center for Quantitative Analysis of Molecular and Cellular Biosystems, at Heidelberg University with funding from the Max Planck Institute for Intelligent Systems and the German Cancer Research Centre (DKFZ). Since 2013, Ana has been a full Professor at the University of Tübingen. Her work focuses on membrane dynamics of mitochondria and the interaction of proteins with membrane lipids in the context of cell death programs, where she uses biophysical models and single-molecule high-resolution microscopy. © 2017. Published by The Company of Biologists Ltd.

  15. Cephalometric evaluation of the hyoid triangle before and after maxillary rapid expansion in patients with skeletal class II, mixed dentition, and infantile swallowing.

    Science.gov (United States)

    Parisella, Valeria; Vozza, Iole; Capasso, Francesca; Luzzi, Valeria; Ierardo, Gaetano; Nofroni, Italo; Polimeni, Antonella

    2012-07-01

    Rocabado's hyoid triangle is the only cephalometric parameter that can assess the effects of orthodontic treatment on tongue posture. To evaluate the restoration of tongue posture and function by conducting a cephalometric assessment of the hyoid triangle before and after rapid maxillary expansion. Sixty-four healthy patients aged 6-11 years with skeletal class II malocclusion, mixed dentition, and infantile swallowing took part in this study. They submitted to lateral cephalometric radiography before and after orthodontic maxillary rapid expansion, in order to assess the resulting changes in the proportions of the hyoid triangle (following Rocabado's parameters). The cephalometric findings were compared according to sex, age, and divergence using the chi-square McNemar test at the 5% significance level (ptriangle was modified by the orthodontic maxillary expansion, reconditioning of tongue posture and function particularly among male, aged 6-7 years old with skeletal class II malocclusion, mixed dentition, and infantile swallowing.

  16. Zeolite-like metal-organic frameworks with ana topology

    KAUST Repository

    Eddaoudi, Mohamed

    2017-04-20

    Embodiments of the present disclosure describe a zeolite-like metal-organic framework composition comprising a metal-organic framework composition with ana topology characterized by the formula [MIII(4, 5-imidazole dicarboxylic acid)2X(solvent)a]n wherein MIII comprises a trivalent cation of a rare earth element, X comprises an alkali metal element or alkaline earth metal element, and solvent comprises a guest molecule occupying pores. Embodiments of the present disclosure describe a method of separating paraffins comprising contacting a zeolite-like metal-organic framework with ana topology with a flow of paraffins, and separating the paraffins by size.

  17. Entrevista com a Professora Ana Jacó Vilela

    OpenAIRE

    Editorial, Corpo

    2017-01-01

    A professora Ana Jacó Vilela é graduada em Psicologia pela Universidade Federal de Minas Gerais (1972), mestre em Psicologia pela Fundação Getúlio Vargas - RJ (1980) e doutora em Psicologia Escolar e do Desenvolvimento Humano pela Universidade de São Paulo (1996), com pós-doutorado em História e Historiografia da Psicologia na Universidade Autônoma de Barcelona (2004). Ana Jacó Vilela é professora associada da UERJ, atuando no Programa de Pós-graduação em Psicologia Social e no Curso de gradu...

  18. A case study of the Santa Ana winds in the San Gabriel mountains

    Science.gov (United States)

    Michael A. Fosberg

    1965-01-01

    Santa Ana wind structure varies between the high main ridges, the foothills, and the canyon bottoms. In each of these regions, a typical pattern characterizes the Santa Ana. Strong steady wind, at the high levels are determined almost completely by the large scale weather patterns. lntermediate canyons and ridges are affected by Santa Ana winds only when the foehn is...

  19. Characterization of duck (Anas platyrhynchos) MHC class Igene in ...

    Indian Academy of Sciences (India)

    LIN ZHANG

    2017-06-17

    Jun 17, 2017 ... could contribute to design effective diagnostics and vaccines for the species against various infections. [Zhang L., Liu W.-J., Wu J.-Q., Xu M.-L., Kong Z.-J., Huang Y.-Y. and Yang S.-H. 2017 Characterization of duck (Anas platyrhynchos). MHC class I gene in two duck lines. J. Genet. 96, 371–375].

  20. C-H oxidation and chelation of a dipyrromethane mediated rapid colorimetric naked-eye Cu(ii) chemosensor.

    Science.gov (United States)

    Rajmohan, Rajamani; Ayaz Ahmed, Khan Behlol; Sangeetha, Sampathkumar; Anbazhagan, Veerappan; Vairaprakash, Pothiappan

    2017-09-08

    Copper(ii) ion mediated C-H oxidation of dipyrromethanes (DPMs) to the corresponding dipyrrins followed by complexation invoked the selective sensing of copper(ii) ions in aqueous solutions. On the addition of copper, the colour of the DPM solution instantaneously changes from yellow to pink with the detection limit of 0.104 μM measured by absorption spectroscopy, whereas visible colour changes could be observed by the naked eye for concentrations as low as 3 μM.

  1. Native fish population and habitat study, Santa Ana River, California

    Science.gov (United States)

    Wulff, Marissa L.; Brown, Larry R.; May, Jason

    2017-01-01

    Collection of additional data on the Santa Ana Sucker (Catostomus santaanae) and the Arroyo Chub (Gila orcutti) has been identified as a needed task to support development of the upper Santa Ana River Habitat Conservation Plan (HCP; http://www.uppersarhcp.com/). The ability to monitor population abundance and understanding the habitats used by species are important when developing such plans. The Santa Ana Sucker (Catostomus santaanae) is listed as a threatened species under federal legislation and is considered a species of special concern in California by the California Department of Fish and Wildlife (Moyle 2002). The Arroyo Chub (Gila orcutti) is considered a species of special concern in California by the California Department of Fish and Wildlife (Moyle 2002). Both species are present in the Santa Ana River watershed in the area being evaluated for establishment of the upper Santa Ana River Habitat Conservation Plan (HCP; http://www.uppersarhcp.com/). The HCP is a collaborative effort involving the water resource agencies of the Santa Ana River Watershed, the US Fish and Wildlife Service, California Department of Fish and Wildlife, and other government agencies and stakeholder organizations. The goals of the HCP are to: 1) enable the water resource agencies to provide a reliable water supply for human uses; 2) conserve and maintain natural rivers and streams that provide habitat for a diversity of unique and rare species; and 3) maintain recreational opportunities for activities such as hiking, fishing, and wildlife viewing, provided by the protection of these habitats and the river systems they depend on. The HCP will specify how species and their habitats will be protected and managed in the future and will provide the incidental take permits needed by the water resource agencies under the federal and State endangered species acts to maintain, operate, and improve their water resource infrastructure. Although the Santa Ana Sucker has been the subject of

  2. Rapid, synergistic extractive spectrophotometric determination of copper(II) by using sensitive chromogenic reagent N″,N″'-bis[(E)-(4-fluorophenyl) methylidene]thiocarbonohydrazide.

    Science.gov (United States)

    Nalawade, Rekha A; Nalawade, Avinash M; Kamble, Ganesh S; Anuse, Mansing A

    2015-07-05

    A rapid and simple spectrophotometric method was developed for the determination of copper(II) by using newly synthesized chromogenic reagent, N″,N″'-bis[(E)-(4-fluorophenyl)methylidene]thiocarbonohydrazide [bis(4-fluoroPM)TCH]. The reagent is highly sensitive and it forms yellow colored ternary complex with copper(II) in presence pyridine having composition 1:1:2 (M:L:Py) in the acidic pH range. Absorption of colored complex in amyl acetate is measured with reagent as a blank at λmax 375 nm. The synergistic effect is observed due to pyridine forming adduct with reagent in the organic phase. Beer's law was obeyed in the concentration range from 2.0 to 14 μg mL(-1) for copper(II)-[bis(4-fluoroPM)TCH]-Py complex. Molar absorptivity and Sandell's sensitivity values for Cu(II)-bis(4-fluoroPM)TCH]-Py complex are 0.42545×10(5) and 0.0014 μg/cm(2), respectively. The selectivity of the developed method was checked in the presence of various foreign ions. The developed method showed relative standard deviation (R.S.D.) of 0.13% for n=10. The composition of Cu(II)-[bis(4-fluoroPM)TCH]-Py complex was determined by known methods such as Job's method of continuous variation, mole ratio method and slope ratio method. It is found that the ternary complex is stable for more than 24h. Various factors influencing on the degree of complexation, such as, effect of pH, reagent concentration, synergent concentration, solvent etc. were studied. The accuracy and reliability of method was verified by AAS. This method is found to be simple, rapid and reproducible. Copyright © 2015. Published by Elsevier B.V.

  3. Runāšanas prasmju mācīšana dažāda vecuma studentiem

    OpenAIRE

    Mamikoņjana, Veronika

    2012-01-01

    Runašana ir viens no nozīmīgākajiem katras valodas aspektiem tā kā tā ir galvenais valodas saziņas veids. Turklāt, runāšana ir ļoti sarežģīts process kas prasa daudzu orgānu darbu. Tieši tāpēc ir svarīgi attīstīt runāšanas prasmes. Pastāv vairākās modeles, metodes, teorijas un klases aktivitātes kuri var tikt izmantoti šīm nolūkam. Skolotājam ir jāizlemj, kurus no tiem izvēlēties lai padarīt nodarbību efektīvu un lietderīgu. Lai izdarīt to veiksmīgi skolotājam ir jāņem vērā mācīšanas/mācīšanā...

  4. Cilvēku resursu vadīšana un pilnveidošana uzņēmumā "X"

    OpenAIRE

    Ņikiforova, Svetlana

    2012-01-01

    Bakalaura darba nosaukums ir „Cilvēku resursu vadīšana un pilnveidošana uzņēmumā „X””. Darba mērķis ir izstrādāt uzņēmuma „X” cilvēkresursu vadīšanas pilnveidošanas priekšlikumus. Darba mērķa sasniegšanai veiktie uzdevumi: literatūras izpēte par cilvēkresursu vadīšanu, uzņēmuma „X” cilvēkresursu vadīšanas sistēmas analīze, uzņēmuma „X” darbinieku anketēšana, intervijas veikšana ar personāla speciālisti, novērojumu veikšana uzņēmumā „X”, secinājumu un priekšlikumu izstrādāšana uzņēmuma „...

  5. A rapid and sensitive extractive spectrophotometric determination of copper(II) in pharmaceutical and environmental samples using benzildithiosemicarbazone.

    Science.gov (United States)

    Reddy, B K; Kumar, J R; Reddy, K J; Sarma, L S; Reddy, A V

    2003-03-01

    Benzildithiosemicarbazone (BDTSC) is proposed as a sensitive and selective analytical reagent for the extractive spectrophotometric determination of copper(II). BDTSC reacts with copper(II) in the pH range 1.0-7.0 to form a yellowish complex. Beer's law is obeyed in the concentration range 0.5-0.4 microg cm(-3). The yellowish Cu(II)-BDTSC complex in chloroform shows a maximum absorbance at 380 nm, with molar absorptivity and Sandell's sensitivity values of 1.63 x 10(4) dm3 mol(-1) cm(-1) and 0.00389 microg cm(-2), respectively. A repetition of the method is checked by finding the relative standard deviation (RSD) (n = 10), which is 0.6%. The composition of the Cu(II)-BDTSC complex is established as 1:1 by slope analysis, molar ratio and Asmus' methods. An excellent linearity with a correlation coefficient value of 0.98 is obtained for the Cu(II)-BDTSC complex. The instability constant of the complex calculated from Edmond and Birnbaum's method is 7.70 x 10(-4) and that of Asmus' method is 7.66 x 10(-4), at room temperature. The method is successfully employed for the determination copper(II) in pharmaceutical and environmental samples. The reliability of the method is assured by analyzing the standard alloys (BCS 5g, 10g, 19e, 78, 32a, 207 and 179) and by inter-comparison of experimental values, using an atomic absorption spectrometer.

  6. Rapid and specific luminescence sensing of Cu(ii) ions with a porphyrinic metal-organic framework.

    Science.gov (United States)

    Li, Linnan; Shen, Sensen; Lin, Ruoyun; Bai, Yu; Liu, Huwei

    2017-09-05

    We herein present a porphyrinic metal-organic framework (MOF) as a highly sensitive fluorescent probe targeting Cu(ii) ions with a fast response. The well-isolated nature of porphyrin moieties within the framework greatly enable accessible recognition sites, which leads to an outstanding detection limit performance of 67 nM among MOF-based materials.

  7. A Novel Nanocomposite as an Efficient Adsorbent for the Rapid Adsorption of Ni(II) from Aqueous Solution.

    Science.gov (United States)

    Zhang, Xiaotao; Wang, Ximing; Chen, Zhangjing

    2017-09-22

    A sulfhydryl-lignocellulose/montmorillonite (SLT) nanocomposite was prepared using a chemical intercalation reaction. The SLT nanocomposite was characterized by Fourier Transform Infrared Spectroscopy (FTIR), X-Ray Diffraction (XRD), Scanning Electron Microscope (SEM), and Transmission Electron Microscopy (TEM), the results demonstrated that an intercalated-exfoliated nanostructure was formed in the SLT nanocomposite. Batch experiments were conducted to optimize parameters such as SLT nanocomposite dosage, the initial concentration of Ni(II), solution pH, temperature, and time. The results indicated that the attractive adsorption capacity reached 1134.08 mg/g with 0.05 g of SLT at an initial concentration of Ni(II) of 700 mg/L, solution pH of 5.5, adsorption temperature of 50 °C, and adsorption time of 40 min, meanwhile, the Ni(II) adsorption capacity significantly decreased with the increase in ionic strength. The pseudo-second order kinetic model could describe the whole adsorption process well, and the isotherm adsorption equilibrium conformed to the Freundlich model. The adsorption mechanism of SLT was also discussed by means of FTIR and Energy-Dispersive X-Ray (EDX). Dramatically, the introduction of sulfhydryl achieves the increased activated functional groups content of SLT nanocomposite, leading to remarkably higher adsorption amount on Ni(II). The desorption capacity of SLT was dependent on parameters such as HNO3 concentration, desorption temperature, and ultrasonic desorption time. The satisfactory desorption capacity and desorption efficiency of 458.21 mg/g and 40.40% were obtained at an HNO3 concentration, desorption temperature, and ultrasonic desorption time of 0.4 mol/L, 40 °C, and 30 min, respectively. The regeneration studies showed that the adsorption capacity of SLT was consistent for four cycles without any appreciable loss and confirmed that the SLT was reusable. Owing to such outstanding features, the novel SLT nanocomposite proved the

  8. Online Stigma Resistance in the Pro-Ana Community.

    Science.gov (United States)

    Yeshua-Katz, Daphna

    2015-10-01

    Media scholars often use concepts from Goffman's dramaturgical approach to study online communities of stigmatized individuals as "backstages," spaces where members take refuge from social disapproval. In this study, I extend this view through an examination of in-depth interviews with bloggers from the "pro-ana" community, an online community for people with eating disorders. To explore how this community uses an online environment that is both anonymous and public, I fuse Goffman's ideas about identity performance and stigma with more recent theories about boundary maintenance. In-depth interviews with "pro-ana" bloggers reveal that to protect this virtual group and resist stigmas associated both with their illness and with their online presence, they construct their own norms and rules in the online realm, and discipline and eject members deemed to be out-group. © The Author(s) 2015.

  9. Rapid Removal of Zinc(II) from Aqueous Solutions Using a Mesoporous Activated Carbon Prepared from Agricultural Waste.

    Science.gov (United States)

    Zhang, Xiaotao; Hao, Yinan; Wang, Ximing; Chen, Zhangjing

    2017-08-28

    A low-cost activated carbon (XSBLAC) prepared from XanthocerasSorbifoliaBungehull via chemical activation was investigated to determine its adsorption and desorption properties for zinc(II) ions from aqueous solutions. XSBLAC was characterized based on its N₂-adsorption/desorption isotherm, EDX, XRD, SEM and FTIR results. An adsorption study was conducted in a series of experiments to optimize the process variables for zinc(II) removal using XSBLAC. Modeling the adsorption kinetics indicated good agreement between the experimental data and the pseudo-second-order kinetic model. The Langmuir equilibrium isotherm fit the experimental data reasonably well. The calculated enthalpy (ΔH⁰), entropy (ΔS⁰) and Gibbs free energy (ΔG⁰) values revealed the endothermic and spontaneous nature of the adsorption process. HNO₃ displayed the best desorption performance. The adsorption mechanism was investigated in detail through FTIR and SEM/EDX spectroscopic analyses. The results suggested that XSBLAC is a potential biosorbent for removing zinc(II) from aqueous solutions.

  10. Vrijednosne preferencije hrvatskih građana kao odrednice materijalizma

    OpenAIRE

    Dević, Ivan; Majetić, Filip; KRNIĆ, Rašeljka

    2016-01-01

    Temeljni ciljevi ovog rada jesu: ispitati faktorsku strukturu skale materijalizma, razinu usmjerenosti građana Hrvatske prema materijalizmu, utvrditi hijerarhiju vrijednosti i objasniti povezanost vrijednosti i materijalizma uz kontrolu sociodemografskih obilježja. Istraživanje je provedeno na reprezentativnom uzorku punoljetnoga stanovništva (N =1004). Za mjerenje materijalizma upotrijebljena je kratka verzija skale materijalizma (The Material Values Scale, Richins, 2004...

  11. Congreso www.derechotics.com 2010 Ana Aba, Mesa 3

    OpenAIRE

    Cotino Hueso, Lorenzo

    2010-01-01

    Garantías de la privacidad en las redes sociales, por Ana Aba Catoira, Profesora titular de Derecho constitucional, U. de A Coruña.Mesa 3: Privacidad y la propiedad intelectual frente a la libertad de expresión e información en la redCongreso www.derechotics.com Valencia, 14-15 octubre 2010 Libertades informativas en internet: ejercicio, amenazas y garantías, Lorenzo Cotino (org.)

  12. Ingestion of lead and nontoxic shot by Green-winged Teal (Anas crecca) and Northern Shovelers (Anas clypeata) from the mid-Gulf Coast of Texas, USA.

    Science.gov (United States)

    Garrison, Drew A; Fedynich, Alan M; Smith, Autumn J; Ferro, Pamela J; Butler, David A; Peterson, Markus J; Lupiani, Blanca

    2011-07-01

    Ninety-eight Green-winged Teal (Anas crecca) and 84 Northern Shoveler (Anas clypeata) gizzards were examined for ingested shot. One Northern Shoveler had lead and three had steel shot; 24 teal and 17 shovelers had composite nontoxic shot or nonlead metal fragments. Prevalence of ingested lead appears minimal and consistent with other studies conducted after lead-shot bans.

  13. O outro de Ana Cristina Cesar: WW ou um qualquer

    Directory of Open Access Journals (Sweden)

    Ana Carolina Cernicchiaro

    2010-01-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2010nesp3p176 Quem é Ana Cristina Cesar? A quem perguntar senão ao outro (como fazia Jacques Derrida ao gato1, a um outro, ao outro qualquer que somos nós seus leitores, estes que ela abraça e se joga aos pés; ao outro qualquer que são seus amigos: WW, KM, LM, Jack, Charles, Caio, Ângela, enfim, um índice onomástico inteiro. Aos outros seus conterrâneos, não só os do Rio de Janeiro, mas os da cidade dos poetas, Londres, Lisboa, Paris, Nova York, Belo Horizonte, São Paulo, etc, etc, etc. Ao outro suas personagens, suas máscaras, Ana C, ACC, Ana Cristina Cesar, o gato, a toalha, aquela que ouve Roberto Carlos, que assiste Casablanca, que briga com Freud, que conversa com uma amiga, que bate à porta de um amigo, que pega um táxi, que fuma debaixo da janela, “meio-bruxa, meia-fera”, a que tem sobressaltos, que escreve no automóvel, entre tantas outras que não são

  14. O outro de Ana Cristina Cesar: WW ou um qualquer

    Directory of Open Access Journals (Sweden)

    Ana Carolina Cernicchiaro

    2010-06-01

    Full Text Available Quem é Ana Cristina Cesar? A quem perguntar senão ao outro (como fazia Jacques Derrida ao gato1, a um outro, ao outro qualquer que somos nós seus leitores, estes que ela abraça e se joga aos pés; ao outro qualquer que são seus amigos: WW, KM, LM, Jack, Charles, Caio, Ângela, enfim, um índice onomástico inteiro. Aos outros seus conterrâneos, não só os do Rio de Janeiro, mas os da cidade dos poetas, Londres, Lisboa, Paris, Nova York, Belo Horizonte, São Paulo, etc, etc, etc. Ao outro suas personagens, suas máscaras, Ana C, ACC, Ana Cristina Cesar, o gato, a toalha, aquela que ouve Roberto Carlos, que assiste Casablanca, que briga com Freud, que conversa com uma amiga, que bate à porta de um amigo, que pega um táxi, que fuma debaixo da janela, “meio-bruxa, meia-fera”, a que tem sobressaltos, que escreve no automóvel, entre tantas outras que não são.

  15. Field-Deployable Reverse Transcription-Insulated Isothermal PCR (RT-iiPCR) Assay for Rapid and Sensitive Detection of Foot-and-Mouth Disease Virus.

    Science.gov (United States)

    Ambagala, A; Fisher, M; Goolia, M; Nfon, C; Furukawa-Stoffer, T; Ortega Polo, R; Lung, O

    2017-10-01

    Foot-and-mouth disease (FMD) is a highly contagious viral disease of cloven-hoofed animals, which can decimate the livestock industry and economy of countries previously free of this disease. Rapid detection of foot-and-mouth disease virus (FMDV) is critical to containing an FMD outbreak. Availability of a rapid, highly sensitive and specific, yet simple and field-deployable assay would support local decision-making during an FMDV outbreak. Here we report validation of a novel reverse transcription-insulated isothermal PCR (RT-iiPCR) assay that can be performed on a commercially available, compact and portable POCKIT™ analyser that automatically analyses data and displays '+' or '-' results. The FMDV RT-iiPCR assay targets the 3D region of the FMDV genome and was capable of detecting 9 copies of in vitro-transcribed RNA standard with 95% confidence. It accurately identified 63 FMDV strains belonging to all seven serotypes and showed no cross-reactivity with viruses causing similar clinical diseases in cloven-hoofed animals. The assay was able to identify FMDV RNA in multiple sample types including oral, nasal and lesion swabs, epithelial tissue suspensions, vesicular and oral fluid samples, even before the appearance of clinical signs. Clinical sensitivity of the assay was comparable or slightly higher than the laboratory-based real-time RT-PCR assay in use. The assay was able to detect FMDV RNA in vesicular fluid samples without nucleic acid extraction. For RNA extraction from more complex sample types, a commercially available taco™ mini transportable magnetic bead-based, automated extraction system was used. This assay provides a potentially useful field-deployable diagnostic tool for rapid detection of FMDV in an outbreak in FMD-free countries or for routine diagnostics in endemic countries with less structured laboratory systems. © 2016 Her Majesty the Queen in Right of Canada.

  16. [Treatment of Class II malocclusion using Herbst appliance with headgear and rapid palatal expansion and straight wire appliance with implant anchorage].

    Science.gov (United States)

    Zhang, Xiao-jie; Zheng, Cang-shang; Zhang, Min

    2015-06-01

    To investigate the effects of early treatment of Class II malocclusion with Herbst appliance with headgear and rapid palatal expansion and straight wire appliance with implant anchorage. Twenty-five Chinese children (14 males, 11 females, aged from 10-12 years with an average age of 10.5 years) were treated with Herbst appliance with headgear and rapid palatal expansion for 6 months. Then they were further treated with straight wire appliance with implant anchorage. Cephalometric data pre- and post-treatment were measured and analysed. Multiple correlation analysis was performed with SPSS13.0 software package. Compared with pretreatment, as angle SNB (4.2800±1.4000)° and as angle NP-FH (3.5600±1.0440)° increased posttreatment. as angle SNA (0.5600±0.8206)°, as angle ANB (4.7600±1.2000)°, as angle U1-NA (11.9200±1.4411)° and as angle U1-SN (13.1600±1.7720)° decreased posttreatment (Pheadgear and rapid palatal expansion. The maxillary dentition is significantly retracted by fixed appliance with implant anchorage and the skeletal pattern of patients is significantly improved.

  17. Combining a Ru(II) "Building Block" and Rapid Screening Approach to Identify DNA Structure-Selective "Light Switch" Compounds.

    Science.gov (United States)

    Wachter, Erin; Moyá, Diego; Glazer, Edith C

    2017-02-13

    A chemically reactive Ru(II) "building block", able to undergo condensation reactions with substituted diamines, was utilized to create a small library of luminescent "light switch" dipyrido-[3,2-a:2',3'-c] phenazine (dppz) complexes. The impact of substituent identity, position, and the number of substituents on the light switch effect was investigated. An unbiased, parallel screening approach was used to evaluate the selectivity of the compounds for a variety of different biomolecules, including protein, nucleosides, single stranded DNA, duplex DNA, triplex DNA, and G-quadruplex DNA. Combining these two approaches allowed for the identification of hit molecules that showed different selectivities for biologically relevant DNA structures, particularly triplex and quadruplex DNA.

  18. BRS Ana: cultivar de batata de duplo propósito BRS ANA: A dual purpose potato cultivar

    Directory of Open Access Journals (Sweden)

    Arione da S Pereira

    2010-12-01

    Full Text Available O genótipo BRS Ana é uma nova cultivar de batata adequada para fritura à francesa, com potencial de processamento na forma de palitos pré-fritos congelados e de flocos, liberada em 2007. Foi desenvolvida pelo Programa de Melhoramento de Batata da Embrapa (Clima Temperado, Pelotas-RS, Transferência de Tecnologia - Escritório de Canoinhas-SC e Hortaliças, Brasília-DF, com base na aparência e rendimento de tubérculos, peso específico e qualidade de fritura. Os tubérculos têm película vermelha, levemente áspera, polpa branca, formato oval e olhos rasos. O potencial produtivo é alto. No ecossistema subtropical, apresentou maior produtividade (31,2 t ha-1 que as cultivares mais plantadas no país, quando cultivada no outono, e não diferiu na primavera. Em ecossistema tropical, plantio da seca, a cultivar BRS Ana foi tão produtiva (33,8 t ha-1 quanto as demais cultivares avaliadas. Produziu maior percentagem de tubérculos graúdos (55,6% e peso médio dos tubérculos (108,4 g que as testemunhas no outono do ecossistema subtropical. Em ambos os ecossistemas, a cultivar BRS Ana apresentou elevados valores de peso específico (1,086 e conteúdo de matéria seca (19,7%. Nos testes sensoriais mostrou-se adequada à fritura na forma de palitos, tanto no preparo doméstico, quanto na industrialização. É moderadamente suscetível à requeima (Phytophthora infestans e tem boa resistência à pinta-preta (Alternaria solani. A reação à podridão-mole (Pectobacterium sp. é similar à das cultivares mais plantadas. Apresenta baixa degenerescência de sementes por viroses, conferida pela resistência moderadamente alta ao PVY e baixa incidência do PLRV. Suscetibilidade a distúrbios de origem fisiológica nos tubérculos não tem sido observada. No ecossistema subtropical a tuberização é mais tardia na primavera, devendo portanto ser plantada mais cedo.The genotype BRS Ana is a new potato cultivar adequate for French fries, with

  19. Rapid Prototyping

    Science.gov (United States)

    1999-01-01

    Javelin, a Lone Peak Engineering Inc. Company has introduced the SteamRoller(TM) System as a commercial product. The system was designed by Javelin during a Phase II NASA funded small commercial product. The purpose of the invention was to allow automated-feed of flexible ceramic tapes to the Laminated Object Manufacturing rapid prototyping equipment. The ceramic material that Javelin was working with during the Phase II project is silicon nitride. This engineered ceramic material is of interest for space-based component.

  20. Rapid detection of equine influenza virus H3N8 subtype by insulated isothermal RT-PCR (iiRT-PCR) assay using the POCKIT™ Nucleic Acid Analyzer.

    Science.gov (United States)

    Balasuriya, Udeni B R; Lee, Pei-Yu Alison; Tiwari, Ashish; Skillman, Ashley; Nam, Bora; Chambers, Thomas M; Tsai, Yun-Long; Ma, Li-Juan; Yang, Pai-Chun; Chang, Hsiao-Fen Grace; Wang, Hwa-Tang Thomas

    2014-10-01

    Equine influenza (EI) is an acute, highly contagious viral respiratory disease of equids. Currently, equine influenza virus (EIV) subtype H3N8 continues to be the most important respiratory pathogen of horses in many countries around the world. The need to achieve a rapid diagnosis and to implement effective quarantine and movement restrictions is critical in controlling the spread of EIV. In this study, a novel, inexpensive and user-friendly assay based on an insulated isothermal RT-PCR (iiRT-PCR) method on the POCKIT™, a field-deployable device, was described and validated for point-of-need detection of EIV-H3N8 in clinical samples. The newly established iiRT-PCR assay targeting the EIV HA3 gene was evaluated for its sensitivity using in vitro transcribed (IVT) RNA, as well as ten-fold serial dilutions of RNA extracted from the prototype H3N8 strain A/equine/Miami/1/63. Inclusivity and exclusivity panels were tested for specificity evaluation. Published real-time RT-PCR (rRT-PCR) assays targeting the NP and HA3 genes were used as the reference standards for comparison of RNA extracted from field strains and from nasal swab samples collected from experimentally infected horses, respectively. Limit of detection with a 95% probability (LoD95%) was estimated to be 11copies of IVT RNA. Clinical sensitivity analysis using RNA prepared from serial dilutions of a prototype EIV (Miami 1/63/H3N8) showed that the iiRT-PCR assay was about 100-fold more sensitive than the rRT-PCR assay targeting the NP gene of EIV subtype H3N8. The iiRT-PCR assay identified accurately fifteen EIV H3N8 strains and two canine influenza virus (CIV) H3N8 strains, and did not cross-react with H6N2, H7N7, H1N1 subtypes or any other equine respiratory viral pathogens. Finally, 100% agreement was found between the iiRT-PCR assay and the universal influenza virus type A rRT-PCR assay in detecting the EIV A/equine/Kentucky/7/07 strain in 56 nasal swab samples collected from experimentally inoculated

  1. Ligand-induced type II interleukin-4 receptor dimers are sustained by rapid re-association within plasma membrane microcompartments

    Science.gov (United States)

    Richter, David; Moraga, Ignacio; Winkelmann, Hauke; Birkholz, Oliver; Wilmes, Stephan; Schulte, Markos; Kraich, Michael; Kenneweg, Hella; Beutel, Oliver; Selenschik, Philipp; Paterok, Dirk; Gavutis, Martynas; Schmidt, Thomas; Garcia, K. Christopher; Müller, Thomas D.; Piehler, Jacob

    2017-07-01

    The spatiotemporal organization of cytokine receptors in the plasma membrane is still debated with models ranging from ligand-independent receptor pre-dimerization to ligand-induced receptor dimerization occurring only after receptor uptake into endosomes. Here, we explore the molecular and cellular determinants governing the assembly of the type II interleukin-4 receptor, taking advantage of various agonists binding the receptor subunits with different affinities and rate constants. Quantitative kinetic studies using artificial membranes confirm that receptor dimerization is governed by the two-dimensional ligand-receptor interactions and identify a critical role of the transmembrane domain in receptor dimerization. Single molecule localization microscopy at physiological cell surface expression levels, however, reveals efficient ligand-induced receptor dimerization by all ligands, largely independent of receptor binding affinities, in line with the similar STAT6 activation potencies observed for all IL-4 variants. Detailed spatiotemporal analyses suggest that kinetic trapping of receptor dimers in actin-dependent microcompartments sustains robust receptor dimerization and signalling.

  2. Diverse mechanisms for photoprotection in photosynthesis. Dynamic regulation of photosystem II excitation in response to rapid environmental change.

    Science.gov (United States)

    Derks, Allen; Schaven, Kristin; Bruce, Doug

    2015-01-01

    Photosystem II (PSII) of photosynthesis catalyzes one of the most challenging reactions in nature, the light driven oxidation of water and release of molecular oxygen. PSII couples the sequential four step oxidation of water and two step reduction of plastoquinone to single photon photochemistry with charge accumulation centers on both its electron donor and acceptor sides. Photon capture, excitation energy transfer, and trapping occur on a much faster time scale than the subsequent electron transfer and charge accumulation steps. A balance between excitation of PSII and the use of the absorbed energy to drive electron transport is essential. If the absorption of light energy increases and/or the sink capacity for photosynthetically derived electrons decreases, potentially deleterious side reactions may occur, including the production of reactive oxygen species. In response, a myriad of fast (second to minutes timescale) and reversible photoprotective mechanisms are observed to regulate PSII excitation when the environment changes more quickly than can be acclimated to by gene expression. This review compares the diverse photoprotective mechanisms that are used to dissipate (quench) PSII excitation within the antenna systems of higher land plants, green algae, diatoms, and cyanobacteria. The molecular bases of how PSII excitation pressure is sensed by the antenna system and how the antenna then reconfigures itself from a light harvesting to an energy dissipative mode are discussed. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Servera puses programmēšanas valodu atbalsts un izstrādes vižu instalēšana un konfigurēšana tīmekļa serverī

    OpenAIRE

    Polis, Jānis

    2011-01-01

    Kvalifikācijas darba tēma ir „Servera puses programmēšanas valodu atbalsts un izstrādes vižu instalēšana un konfigurēšana tīmekļa serverī”. Darba mērķis ir izveidot pilnvērtīgu tīmekļa servera prototipu, ko paredzēts izmantot vienas kompānijas ietvaros, kas atbalsta vairākas tīmekļa servera puses programmēšanas valodas un izstrādes vides, lai varētu veidot dažāda veida tīmekļa vietnes. Kā arī izstrādāt mājas lapu, kas reklamētu uzņēmuma produkciju. Šis serveris tiks veidots ...

  4. Aptamer-based fluorescence-quenching lateral flow strip for rapid detection of mercury (II) ion in water samples.

    Science.gov (United States)

    Wu, Ze; Shen, Haicong; Hu, Junhui; Fu, Qiangqiang; Yao, Cuize; Yu, Shiting; Xiao, Wei; Tang, Yong

    2017-09-01

    Divalent mercury ion (Hg 2+ ) is one of the most common and stable forms of mercury pollution. In this study, a skillfully designed lateral flow strip (LFS) was developed for sensitive detection of Hg 2+ in river water samples. Aptamer, a specific oligonucleotide probe, was used to selectively identify and target Hg 2+ instead of antibody in traditional immunechromatographic strips; and the fluorescence-quenching system was used to generate positive and low background florescence signals in the competitive-likely LFS. The linear detection range of the LFS for Hg 2+ was 0.13 ng mL -1 to 4 ng mL -1 and the limit of detection (LOD) was 0.13 ng mL -1 . This test provided results in 15 min and demonstrated high specificity. For detection of Hg 2+ in river water, the results were consistent with inductively coupled plasma-mass spectrometry measurements. The aptamer-based fluorescence-quenching LFS was shown to provide a reliable, accurate method for rapid detection of mercury contamination. Graphical Abstract The principle of the aptamer-based fluorescence-quenching LFS.

  5. Olhos pardos e Olhos Vermelhos: Ana C. & Chacal

    Directory of Open Access Journals (Sweden)

    Renata Gonçalves Gomes

    2010-09-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2010nesp3p105 É preciso uma geração para definir um poeta ou um poeta para definir uma geração? Para Ana Cristina Cesar e para Chacal as respostas seriam diferentes. Mesmo que tenham sido poetas de uma mesma época, não podem ser considerados donos de uma poética similar com uma mesma ideologia ou postura poética. Chacal, um dos “bichos-grilos” da “marginalidade poética” carioca manteve uma postura anti-literária, ou anti-formalista, avessa à intelectualidade e à fala acadêmica, se posicionando frente a uma opção marginal, mais tarde descaracterizando esta opção para que sua poética fosse lançada, e “consagrada”, no mercado editorial. Já Ana Cristina Cesar, manteve uma postura distanciada da dita marginalidade literária da década de setenta, mesmo que sempre presente nas discussões sobre o tema da época. Por isso mesmo, fazia parte dos poetas e críticos “acadêmicos” que discutiam o assunto de forma literária e crítica, além do seu fazer poético. A fim de discutir essa dicotomia na geração de poetas da década de setenta no Rio de Janeiro, nesta monografia, os poetas Ana Cristina Cesar e Chacal são expostos para uma análise de suas posturas diante das opções, ou ausência delas, marginal e babélica.

  6. Olhos pardos e Olhos Vermelhos: Ana C. & Chacal

    Directory of Open Access Journals (Sweden)

    Renata Gonçalves Gomes

    2010-06-01

    Full Text Available É preciso uma geração para definir um poeta ou um poeta para definir uma geração? Para Ana Cristina Cesar e para Chacal as respostas seriam diferentes. Mesmo que tenham sido poetas de uma mesma época, não podem ser considerados donos de uma poética similar com uma mesma ideologia ou postura poética. Chacal, um dos “bichos-grilos” da “marginalidade poética” carioca manteve uma postura anti-literária, ou anti-formalista, avessa à intelectualidade e à fala acadêmica, se posicionando frente a uma opção marginal, mais tarde descaracterizando esta opção para que sua poética fosse lançada, e “consagrada”, no mercado editorial. Já Ana Cristina Cesar, manteve uma postura distanciada da dita marginalidade literária da década de setenta, mesmo que sempre presente nas discussões sobre o tema da época. Por isso mesmo, fazia parte dos poetas e críticos “acadêmicos” que discutiam o assunto de forma literária e crítica, além do seu fazer poético. A fim de discutir essa dicotomia na geração de poetas da década de setenta no Rio de Janeiro, nesta monografia, os poetas Ana Cristina Cesar e Chacal são expostos para uma análise de suas posturas diante das opções, ou ausência delas, marginal e babélica.

  7. Contribution of Doñana wetlands to carbon sequestration.

    Science.gov (United States)

    Morris, Edward P; Flecha, Susana; Figuerola, Jordi; Costas, Eduardo; Navarro, Gabriel; Ruiz, Javier; Rodriguez, Pablo; Huertas, Emma

    2013-01-01

    Inland and transitional aquatic systems play an important role in global carbon (C) cycling. Yet, the C dynamics of wetlands and floodplains are poorly defined and field data is scarce. Air-water CO2 fluxes in the wetlands of Doñana Natural Area (SW Spain) were examined by measuring alkalinity, pH and other physiochemical parameters in a range of water bodies during 2010-2011. Areal fluxes were calculated and, using remote sensing, an estimate of the contribution of aquatic habitats to gaseous CO2 transport was derived. Semi-permanent ponds adjacent to the large Guadalquivir estuary acted as mild sinks, whilst temporal wetlands were strong sources of CO2 (-0.8 and 36.3 mmol(CO2) m(-2) d(-1)). Fluxes in semi-permanent streams and ponds changed seasonally; acting as sources in spring-winter and mild sinks in autumn (16.7 and -1.2 mmol(CO2) m(-2) d(-1)). Overall, Doñana's water bodies were a net annual source of CO2 (5.2 mol(C) m(-2) y(-1). Up-scaling clarified the overwhelming contribution of seasonal flooding and allochthonous organic matter inputs in determining regional air-water gaseous CO2 transport (13.1 Gg(C) y(-1)). Nevertheless, this estimate is about 6 times < local marsh net primary production, suggesting the system acts as an annual net CO2 sink. Initial indications suggest longer hydroperiods may favour autochthonous C capture by phytoplankton. Direct anthropogenic impacts have reduced the hydroperiod in Doñana and this maybe exacerbated by climate change (less rainfall and more evaporation), suggesting potential for the modification of C sequestration.

  8. Morfologia e histologia do oviduto de marrecas Ana boschas

    OpenAIRE

    C.; Moraes; Baraldi-Artoni,S.M.; M.R. Pacheco; Nishizawa, M.; Nakaghi, L.S.O. [UNESP

    2010-01-01

    Avaliaram-se o comprimento do infundíbulo, do magno, do istmo, do útero e da vagina e o número de pregas do magno e do istmo do oviduto de 20 marrecas Ana boschas na fase reprodutiva. O infundíbulo apresenta mucosa com pregas longitudinais e baixas, revestidas por epitélio pseudoestratificado cilíndrico ciliado, com células caliciformes. O magno, compartimento mais longo do oviduto, 25,38cm±3,20, encontra-se constituído por uma camada mucosa com pregas altas e espessas revestidas por células ...

  9. Entrevista realizada com Ana Magnólia Bezerra Mendes

    OpenAIRE

    Ferreira, Camila Lopes; Pilatti, Luiz Alberto

    2012-01-01

    A entrevistada é Ana Magnólia Bezerra Mendes, Professora do Departamento de Psicologia Social e do Trabalho e do Programa de Pós-graduação em Psicologia Social e do Trabalho e das Organizações (PSTO) do Instituto de Psicologia da Universidade de Brasília (UnB). Tem pós-doutorado no Conservatoire National des Arts et Métiers (CNAM), Paris, doutorado em Psicologia pela UnB e sanduíche na Universidade de Bath, Inglaterra, mestrado e graduação em Psicologia. É coordenadora do Laboratório de Psico...

  10. A new rapidly absorbed paracetamol tablet containing sodium bicarbonate. II. Dissolution studies and in vitro/in vivo correlation.

    Science.gov (United States)

    Rostami-Hodjegan, A; Shiran, M R; Tucker, G T; Conway, B R; Irwin, W J; Shaw, L R; Grattan, T J

    2002-05-01

    The objective of this study was to compare the in vitro dissolution profile of a new rapidly absorbed paracetamol tablet containing sodium bicarbonate (PS) with that of a conventional paracetamol tablet (P), and to relate these by deconvolution and mapping to in vivo release. The dissolution methods used include the standard procedure described in the USP monograph for paracetamol tablets, employing buffer at pH 5.8 or 0.05 M HCl at stirrer speeds between 10 and 50 rpm. The mapping process was developed and implemented in Microsoft Excel worksheets that iteratively calculated the optimal values of scale and shape factors which linked in vivo time to in vitro time. The in vitro-in vivo correlation (IVIVC) was carried out simultaneously for both formulations to produce common mapping factors. The USP method, using buffer at pH 5.8, demonstrated no difference between the two products. However, using an acidic medium the rate of dissolution of P but not of PS decreased with decreasing stirrer speed. A significant correlation (r = 0.773; p dissolution using the profiles obtained with 0.05 M HCl and a stirrer speed of 30 rpm. The scale factor for optimal simultaneous IVIVC in the fasting state was 2.54 and the shape factor was 0.16; corresponding values for mapping in the fed state were 3.37 and 0.13 (implying a larger in vitro-in vivo time difference but reduced shape difference in the fed state). The current IVIVC explains, in part, the observed in vivo variability of the two products. The approach to mapping may also be extended to different batches of these products, to predict the impact of any changes of in vitro dissolution on in vivo release and plasma drug concentration-time profiles.

  11. Remiksēšanas kultūra virtuālajā vidē: mēmu lietošanas un veidošanas vietņu analīze

    OpenAIRE

    Vilsone, Paula

    2013-01-01

    Bakalaura darba “Remiksēšanas kultūra virtuālajā vidē: mēmu lietošanas un veidošanas vietņu analīze” mērķis ir izpētīt interneta mēmu lietotāju un veidotāju mēmu patērēšanas paradumus. Darbam izvirzīts pētnieciskais jautājums, vai latviešu mēmu lietotājiem un veidotājiem ir interneta vietne, kura lokālā līmenī spējīga konkurēt ar populārām pasaules mēroga mēmu lietošanas un veidošanas vietnēm? Kā arī apakšjautājumi – ja ir, tad kas to padara konkurētspējīgu; ja nav, tad kāpēc un vai tāda viet...

  12. Rational design of a novel azoimine appended maleonitrile-based Salen chemosensor for rapid naked-eye detection of copper(II) ion in aqueous media.

    Science.gov (United States)

    Rezaeian, Khatereh; Khanmohammadi, Hamid; Arab, Vajihe

    2015-12-05

    Achieving specific selectivity and high sensitivity for the colorimetric recognition of copper(II) ions in aqueous media over a complex background of potentially competing metal ions is inherently challenging in sensor development. Thus, a novel azo-azomethine receptor (L) based on the combination of 2-amino-3-(5-bromo-2-hydroxybenzylamino)maleonitrile and azo-coupled salicylaldehyde scaffold has been designed and synthesized for the naked-eye and rapid detection of Cu(2+) ion at trace level in a wide pH range. Accordingly, the devised chemosensor distinguished Cu(2+) from other metal ions by distinct color change from light yellow to light brown without any expensive equipment. The binding stoichiometry between Cu(2+) and L has been investigated using Job's plot and MALDI-TOF mass analysis. Remarkably, the current sensor can detect Cu(2+) ions even at 1.07 μM level, which is lower than the World Health Organization (WHO) permissible level (30 μM) in drinking water. Furthermore, sensor L was successfully utilized in the preparation of test strips for the detection of copper(II) ions from aqueous environment. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Comparison of chaparral regrowth patterns between Santa Ana wind-driven and non-Santa Ana fire areas

    Science.gov (United States)

    Rachels, Diane Helen

    Wildfires are a common occurrence in California shrublands and island forests. Fire has a fundamental role in maintaining the ecosystem functions in chaparral where fire intensity and severity play important roles in the regeneration of species. In San Diego, the Cedar Fire that occurred in the fall of 2003 was unique in that one side was burned with wildfire fueled by dry, strong easterly Santa Ana winds that later died down, burning the remainder of the area under a mild westerly wind, allowing fuel-fed conditions. The objective of this study was to understand the connection between vegetation type and structure and environmental response to extreme fire events by analyzing life form regrowth in chaparral communities from the Santa Ana wind driven, Santa Ana backing, and non-Santa Ana fire types. Environmental factors of slope angle, aspect, elevation and soils were investigated in an effort to isolate shrub regrowth patterns. Fire burn characteristics, anthropogenic disturbance, fire history, and moisture availability were also analyzed to identify additional factors that may have influenced shrub regrowth. Shrub extents before the fire and six year after the fire were examined per slope aspect, slope angle, elevation, and fire characteristic categories. The closed canopy and natural features of the chaparral environment make ground based mapping very difficult. Remote sensing data and methods can be very helpful to evaluate the health of the vegetation and condition of the watershed for flood, erosion, and fire control. This study used high spatial resolution aerial imagery and a machine learning algorithm with a spatial contextual classifier to map three different areas from within the Cedar Fire perimeter. Geographic information science (GIS), field mapping, and image interpretation methods were used to identify vegetation samples for the classification and accuracy assessment of the vegetation maps. Object-based image samples were selected for the classifier

  14. An immuno-wall microdevice exhibits rapid and sensitive detection of IDH1-R132H mutation specific to grade II and III gliomas.

    Science.gov (United States)

    Yamamichi, Akane; Kasama, Toshihiro; Ohka, Fumiharu; Suzuki, Hiromichi; Kato, Akira; Motomura, Kazuya; Hirano, Masaki; Ranjit, Melissa; Chalise, Lushun; Kurimoto, Michihiro; Kondo, Goro; Aoki, Kosuke; Kaji, Noritada; Tokeshi, Manabu; Matsubara, Toshio; Senga, Takeshi; Kaneko, Mika K; Suzuki, Hidenori; Hara, Masahito; Wakabayashi, Toshihiko; Baba, Yoshinobu; Kato, Yukinari; Natsume, Atsushi

    2016-01-01

    World Health Organization grade II and III gliomas most frequently occur in the central nervous system (CNS) in adults. Gliomas are not circumscribed; tumor edges are irregular and consist of tumor cells, normal brain tissue, and hyperplastic reactive glial cells. Therefore, the tumors are not fully resectable, resulting in recurrence, malignant progression, and eventual death. Approximately 69-80% of grade II and III gliomas harbor mutations in the isocitrate dehydrogenase 1 gene (IDH1), of which 83-90% are found to be the IDH1-R132H mutation. Detection of the IDH1-R132H mutation should help in the differential diagnosis of grade II and III gliomas from other types of CNS tumors and help determine the boundary between the tumor and normal brain tissue. In this study, we established a highly sensitive antibody-based device, referred to as the immuno-wall, to detect the IDH1-R132H mutation in gliomas. The immuno-wall causes an immunoreaction in microchannels fabricated using a photo-polymerizing polymer. This microdevice enables the analysis of the IDH1 status with a small sample within 15 min with substantially high sensitivity. Our results suggested that 10% content of the IDH1-R132H mutation in a sample of 0.33 μl volume, with 500 ng protein, or from 500 cells is theoretically sufficient for the analysis. The immuno-wall device will enable the rapid and highly sensitive detection of the IDH1-R132H mutation in routine clinical practice.

  15. Doctora Ana Larralde Pineda, ejemplo para nuestra profesión Doctor Ana Larralde Pineda, an example to our profession

    Directory of Open Access Journals (Sweden)

    Alberto James Pita

    2013-03-01

    Full Text Available El papel de la mujer en la Cirugía Maxilofacial es valioso, y más aún el de la doctora Ana Larralde Pineda, primera cirujana maxilofacial de Cuba. Con este trabajo nos hemos propuesto resaltar la figura de esta ejemplar profesional y transmitir, sobre todo a las nuevas generaciones de nuestra especialidad y de la Estomatología en general, su recuerdo imperecedero. Se realizó una investigación de tipo histórica, para recopilar los datos biográficos más generales de la profesora. Se realizaron entrevistas abiertas. A los entrevistados se les explicó el objetivo y la intención de los autores. Todos dieron su consentimiento para ser entrevistados. Se realizó una revisión bibliográfica mediante la consulta a de la base de datos Scielo Cuba y se consultó prensa escrita y el archivo de la Sociedad Cubana de Cirugía Maxilofacial. La doctora Ana Larralde Pineda supo en todo momento conjugar la responsabilidad profesional, docente, humana, con la vida familiar, y abrió las puertas a la incorporación de la mujer a esta especialidad de reconocida entrega, sacrificio y vocación para sus miembros, especialmente para las féminas.Women play a valuable role in maxillofacial surgery. A clear example is Doctor Ana Larralde Pineda, the first Cuban female maxillofacial surgeon. The purpose of this paper is to pay tribute to this outstanding professional and convey her imperishable example to the new generations of maxillofacial specialists and dental professionals at large. A historical study was conducted to gather the most general biographical information about the professor. Open interviews were carried out. Interviewees were informed of the authors' purpose and intention. All gave their consent to be interviewed. A bibliographic review was conducted based on Scielo Cuba database, the printed press and the archives of the Cuban Society of Maxillofacial Surgery. Doctor Ana Larralde Pineda was always able to combine her professional, teaching

  16. Datoru izmantošanas uzskaites sistēma

    OpenAIRE

    Martinkens, Ainārs

    2007-01-01

    Darbā ir izveidota datoru lietotāju uzskaites sistēma, kas nodrošina studentu darba organizāciju LU datorklasēs. Tiek aprakstīti un salīdzināti daži veidi, kā veikt informācijas uzkrāšanu elektroniskā veidā par datoru izmantošanas laiku un lietotājiem, tā realizējot sava veida “žurnālu", kas aizstāj lietotāju pierakstīšanos papīra žurnālā. Darba pirmajā daļā tiek analizēti vairāki sistēmas realizācijas varianti, atrasts piemērotākais variants un izvērtēta tā ieviešanas iespēja Latvijas Uni...

  17. 'Santa Ana' winds and upwelling filaments off Northern Baja California

    Science.gov (United States)

    Trasviña, A.; Ortiz-Figueroa, M.; Herrera, H.; Cosío, M. A.; González, E.

    2003-08-01

    An atmospheric condition known as a 'Santa Ana' wind occurred from 9 to 11 February 2002. Its effect was felt over a large portion of southern California and the northern half of the Baja California Peninsula. Santa Ana winds are dry, strong northwesterly through easterly mountain downslope winds, most common in winter. Satellite data from Quickscat show two large wind jets crossing the mountains of the peninsula and extending 300 km offshore. Data from a coastal station reveal that the event lasted over 52 h with average speeds of 11 m s -1 and gusts of 25 m s -1. The southernmost jet crosses the mountains at the San Matias mountain pass and generates a cold filament off Point Colonet. Satellite imagery shows this feature lasting at least two inertial periods ( Ti=22 h) and extending 100 km offshore during the observation period. Estimates of the stationary Ekman pumping produced vertical speeds of 20 m per day, consistent in time and location with the observed structures. The ocean off Point Colonet is well known for the existence of upwelling episodes. They occur mostly in the spring or early summer when persistent winds blow towards the equator and parallel to the coast. The events described here present a different phenomenon: upwelling filaments induced by short-lived, offshore winter winds.

  18. 75 FR 38441 - Endangered and Threatened Wildlife and Plants; Revised Critical Habitat for Santa Ana Sucker

    Science.gov (United States)

    2010-07-02

    ... sucker in this document. For more detailed information on the taxonomy, biology, and ecology of Santa Ana... km) of Bear Creek (identified as the Santa Ana River in the December 9, 2009, proposed rule) above... attributed to water management or transportation activities are expected to be borne by entities that meet...

  19. SQL komandas saturošu programmas fragmentu testēšana

    OpenAIRE

    Bakašs, Andrejs

    2012-01-01

    Darba mērķis ir izpētīt SQL komandu testēšanas problemātiku. Darbā ir apskatītas metodes šādu problēmu risināšanai: SQL komandas saturošu programmas pirmkoda fragmentu noteikšana, pārklājuma kritērija definēšana SQL komandu testēšanai, testa datu ģenerēšana SQL vaicājumiem un testa datubāzes adekvātuma novērtēšana. Darbā tiek piedāvātas esošo metožu uzlabošanas iespējas un to apvienošana savā starpā ar mērķi iegūt pilnu SQL komandu testēšanas stratēģiju no pirmkoda analīzes līdz testa datu...

  20. Hvorfor pro-ana/mia? - En kvalitativ undersøgelse af unge pigers brug af pro-ana/mia netværkssider.

    OpenAIRE

    Sandau, Mie Ballegaard; Ullerup, Marie-Louise Dalsgaard

    2014-01-01

    This dissertation sets out to discover the impact of pro-ana (pro anorexia) and pro-mia (pro bulimia) social networking sites on users and former users, based upon seven qualitative interviews, along with the positions made available through these websites. The dissertation contains a background chapter, where in the concepts of social media, pro-ana/mia social networking sites and eating disorders are defined. The scientific method of the dissertation is within social constructionism....

  1. Rapid geomagnetic field intensity variations in the Near East during the 6th millennium BC: New archeointensity data from Halafian site Yarim Tepe II (Northern Iraq)

    Science.gov (United States)

    Yutsis-Akimova, Stanislava; Gallet, Yves; Amirov, Shahmardan

    2018-01-01

    further suggests that the intensity secular variation in the Near East and in Eastern Europe during the 6th millennium BC was in fact principally punctuated by two successive short-lasting intensity peaks, the first around 5800 BC and the second around 5500 BC. The scarcity of the intensity data available worldwide, however, prevents us constraining the geomagnetic dipole or non-dipole origin of these features. The variation rates associated with the rapid intensity fluctuations observed in Yarim Tepe II are of ∼0.15-0.25 μT/yr. This range of values appears similar to that of rapid intensity variations that sporadically occurred in more recent times, such as in Western Europe around 700 BC and 1000 AD. In contrast, it is lower than the variation rates that were proposed for geomagnetic spikes. Our results also have interesting implications on Halafian archeology; in particular, they suggest that the Late Halaf-HUT boundary was older by ∼ one century than previously considered.

  2. Characterization of a rapid climate shift at the MIS 8/7 transition in central Spain (Valdocarros II, Autonomous Region of Madrid) by means of the herpetological assemblages

    Science.gov (United States)

    Blain, Hugues-Alexandre; Panera, Joaquin; Uribelarrea, David; Rubio-Jara, Susana; Pérez-González, Alfredo

    2012-07-01

    Climate instability with high-amplitude and rapid shifts during the Middle Pleistocene is well known from pollen records and deep-ocean sediment cores. Although poorly correlatable with such long climate/environment records, the successive fossil amphibian and reptile assemblages from the Middle Pleistocene site of Valdocarros II (Autonomous Region of Madrid, central Spain) provide a unique opportunity to characterize the climatic and environmental features of such rapid (certainly less than 1000 years) shifts from cold to warm conditions in a terrestrial sequence. As the amphibians and reptiles do not differ at species level from the extant herpetofauna of the Iberian Peninsula, they can contribute to the reconstruction of the landscape and climate. In this paper, the mutual climatic range and habitat weighting methods are applied to the herpetofaunistic assemblages in order to estimate quantitative data. The difference in mean annual temperature between "cold" and "warm" periods is estimated at 3.2 °C, with a greater increase in temperature during winter (+3 °C) than during summer (+1 °C). During "cold" periods the climate was more Oceanic (although preserving some dryness during the summers), whereas during "warm" periods the climate became Mediterranean (with mild winters and a long period of dryness in the summer and early autumn). Though higher during cold periods, the continentality (or atmospheric temperature range) remained roughly similar, in accordance with the geographical location of the site in the centre of the Iberian Peninsula. A greater amount of open landscape occurred during "cold" periods, whereas during "warm" periods the wooded areas expanded from 20% to 40% of the landscape surface. Such climatic/environmental changes, together with the numeric datings of the site, suggest that this shift may correspond to the transition from MIS 8 to MIS 7, also called Termination III.

  3. Projekts Autostāvvietas izveidošana

    OpenAIRE

    Derevjanniha, Oļesja

    2009-01-01

    Maģistra darbs ir veidots kā projekta apraksts, kurā izklāstīta šī projekta izveidošanas ideja par uzņēmumu, kas nodarbosies ar autostāvvietas, remonta boksu nomas, automazgātuves un neliela autoservisa pakalpojumu sniegšanu. Ir izvēlēts daudzstāvu namu un jaunceltņu rajons – Latgales priekšpilsētā, kurā šis pakalpojums būs aktuāls. Blakus tiek celts jauns rajons, kurā visām ēkām ir apakšzemes stāvvietas, bet toties nav pat savu mašīnu sīkas apkopes un remonta iespējas. Maģistra darba mēr...

  4. Erythrodiplax ana sp. nov. (Odonata: Libellulidae) from Brazilian palm swamps.

    Science.gov (United States)

    Guillermo-Ferreira, Rhainer; Vilela, Diogo S; Del-Claro, Kleber; Bispo, Pitágoras C

    2016-08-29

    Erythrodiplax ana sp. nov. (male holotype, six male and three female paratypes), collected in Vereda wetlands (a unique Neotropical savanna environment) in Uberlândia (Minas Gerais) and Chapada dos Guimarães (Mato Grosso), Brazil, is described and illustrated. The new species fits in Borror's Basalis Group, and can be distinguished from other species by the combination of the following traits: blue pruinosity dorsally on thorax and third to eighth abdominal segments; sides of the thorax olive-green; face ivory or olive-green; wings hyaline with a small apical brown spot on all four wings, well defined in females; male genitalia with sclerotized erectile posterior lobe and inflatable sac-like median process. Last instar larvae were reared in the laboratory, resulting in the description of the larva. We also followed this population for 13 months and present resulting biological notes and comments on ontogenetic color change in males, as well as longevity.

  5. MORPHOMETRY OF LAKE SFANTA ANA, ROMANIA (LAKE SAINT ANN

    Directory of Open Access Journals (Sweden)

    Gavril PANDI

    2008-06-01

    Full Text Available Lake Sfanta Ana is one of the most emblematic lacustrine complexes of our country. In this context, its monitoring is not only necessary but also compulsory. The study of its evolution and the forecasts are done easier because we have had hydrotopometric highs for about 100 years, even if the frequency of evaluations has not been periodical. The morphometric elements have had a normal evolution, of continuous diminution, specific to lacustrine complexes. The modification rates of the morphometric parameters are different, but they all highlight the necessity of taking urgent measures of protection, in order to slow down the filling speed of the lake basin. Silting is fast due to anthropic influences. The tourism activity produces, direct and indirectly, alluviums that reach inside the lake, due to the processes occurred on the slopes of the crater. We must find a modus vivendi, which is possible in theory, so that tourism and environment protection may “live together” in harmony.

  6. Position of Imam Malik bin Anas on Deviant Sects

    Directory of Open Access Journals (Sweden)

    Allaa Eddin Muhammad Esmail

    2014-06-01

    Full Text Available The study attempts to highlight the position of Imam Malik bin Anas on deviant sects which emerged and developed during his time. It discusses the views of Imam Malik on other Muslim sects like Shi’its and its school of thoughts, Qadarites, where he authored a specific book and a chapter in his “Muwatta” in response to their central teachings, Khariji, Murji”it and Mu’tazilites. This paper also discusses the views of Imam Malik and his response to important issues related to those sects such as “al-mutasyabihat” and the creation of Al-Quran. Imam Malik’s ways and methods in dealing with those sects are also highlighted.

  7. ANA - A framework for building ATHENA on ARM

    Science.gov (United States)

    Smith, Joshua Wyatt; Hamilton, Andrew

    2015-10-01

    The ATLAS software framework (ATHENA) is large and dynamic, comprised of around 6.5 million lines of code. It is compiled using the ATLAS monitoring system, NICOS which uses tools and scripts located and tuned for the CERN services, LXPLUS and AFS. Furthermore, the constraints placed on the hardware that the software is based, limits compilations to traditional x86 architecture. With the sudden interest in ARM processors for large scale high energy physics computing, a new system needs to be implemented to build ATHENA versions for ARM, on ARM. This letter serves to introduce a building framework called Atlas Nightly on ARM (ANA). This new framework implements patches to suit the ARM architecture with the goal of a final ATHENA version for ARM.

  8. A tangled tale of two teal: Population history of the grey Anas gracilis and chestnut teal a. castanea of Australia

    Science.gov (United States)

    Joseph, L.; Adcock, G.J.; Linde, C.; Omland, K.E.; Heinsohn, R.; Terry, Chesser R.; Roshier, D.

    2009-01-01

    Two Australian species of teal (Anseriformes: Anatidae: Anas), the grey teal Anas gracilis and the chestnut teal A. castanea, are remarkable for the zero or near-zero divergence recorded between them in earlier surveys of mitochondrial DNA (mtDNA) diversity. We confirmed this result through wider geographical and population sampling as well as nucleotide sampling in the more rapidly evolving mtDNA control region. Any data set where two species share polymorphism as is the case here can be explained by a model of gene flow through hybridization on one hand or by incomplete lineage sorting on the other hand. Ideally, analysis of such shared polymorphism would simultaneously estimate the likelihood of both phenomena. To do this, we used the underlying principle of the IMa package to explore ramifications to understanding population histories of A. gracilis and A. castanea. We cannot reject that hybridization occurs between the two species but an equally or more plausible finding for their nearly zero divergence is incomplete sorting following very recent divergence between the two, probably in the mid-late Pleistocene. Our data add to studies that explore intermediate stages in the evolution of reciprocal monophyly and paraphyletic or polyphyletic relationships in mtDNA diversity among widespread Australian birds. ?? 2009 J. Avian Biol.

  9. VIAJE AL PALENQUE CARIBE DE ANA MERCEDES HOYOS

    Directory of Open Access Journals (Sweden)

    Maria Cristina Laverde Toscano

    1995-01-01

    Full Text Available Transitar por el camino de un artista consagrado despierta en el espectador diversos y entrañables sentimientos. Recorrer la obra de Ana Mercedes Hoyos nos enfrenta al proceso coherente y mesurado de una creadora que se apropió de la luz majestuosa para dar vida a objetos del entorno cotidiano. Objetos que danzan, dueños del movimiento y la sensualidad que los convierte en sagrados. El encuentro con un cuadro de esta artista se transforma así en un acto sublime de contemplación. Esta Maestra vive hoy en función de su trabajo las veinticuatro horas de cada día: sus viajes continuos tienen que ver siempre con sus labores artísticas en Nueva York, con sus exposiciones en los más disímiles puntos del planeta, con su anhelo ferviente de conocer lo que grandes maestros de la plástica universal muestran en famosos museos y galerías del mundo. Así preserva la riqueza de esa relación constante en su obra entre temáticas locales y estilos y lenguajes contemporáneos e internacionales. En Bogotá, la vida de Ana Mercedes Hoyos transcurre alderredor de su taller donde infatigablemente lleva al lienzo sólo algunos de los múltiples proyectos que invaden su creativa imaginación. Los pocos compromisos que acepta giran también en torno al trabajo, al igual que sus amigos con quienes comparte actividades y labores de su quehacer artístico. Al final, como ella afirma «... todo se me vuelve el mismo cuento».

  10. Ana Enriqueta Terán: poetisa de la lengua

    Directory of Open Access Journals (Sweden)

    Luis Alberto Angulo

    2014-06-01

    Full Text Available Este año ha sido esencial en la vida de la escritora Ana Enriqueta Terán, tres libros estupendos suyos han sido publicados en los primeros seis meses. Uno de sonetos con dibujos de ella misma (Otros sonetos de todos mis tiempos. Casa Nacional de las Letras Andrés Bello, Caracas, una novela (Apuntes y congojas de una decadencia narrada en tres muertes. Fundación Editorial El Perro y la Rana, Caracas, y a finales del mes de junio - en el marco del XI Festival Mundial de Poesía de Venezuela -, la prestigiosa Biblioteca Ayacucho ha presentado con el Nº 252 de su Colección Clásica a Piedra de habla, antología poética con prólogo de Patricia Guzmán titulado Ana Enriqueta Terán Voz relampagueante de misterio y belleza, amén de la profusa cronología y concienzuda compilación de las fuentes bibliográficas. También este año, el Museo de Arte Valencia conjuntamente con la Red de Escritores de Venezuela y de un grupo de amigos de la poetisa constituidos como comité preparatorio para la celebración del centenario de la escritora, le rindió un cálido homenaje el domingo 4 de mayo, aniversario noventa y seis (96 de su nacimiento en Valera, estado Trujillo, de la ahora República Bolivariana de Venezuela

  11. Ana Carolina Escosteguy: Cenários dos estudos culturais

    Directory of Open Access Journals (Sweden)

    Thaisa Cristina Bueno

    2016-01-01

    Full Text Available Autora do livro “Cartografia dos Estudos Culturais”, “Comunicação e recepção” (em coautoria com Nilda Jacks, “Leituras em comunicação, cultura e tecnologia”, além de coautora e organizadora em outras obras de referência sobre o tema cultura e comunicação no Brasil, Ana Carolina Escosteguy é hoje um dos nomes mais importantes quando se pensa em Estudos Culturais no país. Doutora em Ciências da Comunicação pela Universidade de São Paulo (2000, com pós-doutorado no CAMRI (Communication and Media Research Institute, associado ao Department of Journalism and Mass Communication da School of Media, Art and Design da University of Westminster (UK, Ana Carolina Escosteguy é professora titular da Pontifícia Universidade Católica do Rio Grande do Sul (PUCRS e bolsista produtividade em pesquisa do CNPq, desde março 2001. Nesta entrevista ela discute pontos sensíveis da área, entre eles o pouco destaque das pesquisas desse campo têm tido no Jornalismo, o fato de a base teórica ser bem mais ampla que os tradicionais estudos de recepção a que são comumente aproximados, não se nega a tratar das confusões com a folkcomunicação, bem como as próprios limites e intersecções desse campo de estudos. Durante esta conversa, aproveita para apontar as obras que considera essenciais para adentrar na área e mostra coragem e segurança para se colocar como uma pesquisadora que busca entender o tempo atual, as tecnologias e as rupturas a partir da perspectiva do usuário. Confiram:

  12. Viaje al palenque Caribe de Ana Mercedes Hoyos

    Directory of Open Access Journals (Sweden)

    Maria Cristina Laverde Toscano

    1995-04-01

    Full Text Available Transitar por el camino de un artista consagrado despierta en el espectador diversos y entrañables sentimientos. Recorrer la obra de Ana Mercedes Hoyos nos enfrenta al proceso coherente y mesurado de una creadora que se apropió de la luz majestuosa para dar vida a objetos del entorno cotidiano. Objetos que danzan, dueños del movimiento y la sensualidad que los convierte en sagrados. El encuentro con un cuadro de esta artista se transforma así en un acto sublime de contemplación. Esta Maestra vive hoy en función de su trabajo las veinticuatro horas de cada día: sus viajes continuos tienen que ver siempre con sus labores artísticas en Nueva York, con sus exposiciones en los más disímiles puntos del planeta, con su anhelo ferviente de conocer lo que grandes maestros de la plástica universal muestran en famosos museos y galerías del mundo. Así preserva la riqueza de esa relación constante en su obra entre temáticas locales y estilos y lenguajes contemporáneos e internacionales. En Bogotá, la vida de Ana Mercedes Hoyos transcurre alderredor de su taller donde infatigablemente lleva al lienzo sólo algunos de los múltiples proyectos que invaden su creativa imaginación. Los pocos compromisos que acepta giran también en torno al trabajo, al igual que sus amigos con quienes comparte actividades y labores de su quehacer artístico. Al final, como ella afirma ... “todo se me vuelve el mismo cuento”.

  13. The use of pro-ana blogs for online social support.

    Science.gov (United States)

    Tong, Stephanie Tom; Heinemann-Lafave, Daria; Jeon, Jehoon; Kolodziej-Smith, Renata; Warshay, Nathaniel

    2013-01-01

    The aim of this research was to document the content on pro-ana blogs and to uncover how the unique socio-technical features of blogs (interactivity, self-disclosure, masspersonal communication) facilitate social support among members. A final sample of 48 pro-ana blogs provided 624 individual units for coding. Results indicate that prevalent forms of social support were emotional support, esteem support, and informational support. A new category, reciprocal self-disclosure, was also revealed to be quite frequent. Blogs are spaces where social support is sought and communicated among members of the pro-ana network. Interpretation of blog communication and implications for treatment and research are discussed.

  14. Heavy rainfall triggers increased nocturnal flight in desert populations of the Pacific black duck (Anas superciliosa).

    Science.gov (United States)

    McEvoy, J F; Ribot, R F H; Wingfield, J C; Bennett, A T D

    2017-12-14

    Understanding of avian nocturnal flight comes mainly from northern hemisphere species in seasonal temperate ecosystems where nocturnal flight is often precisely timed and entrained by annual photoperiod. Here we investigate patterns of nocturnal flight in waterbirds of Australian desert ecosystems that fly considerable distances to find temporary water bodies formed from rainfall which is highly unpredictable seasonally and spatially, and when there is sufficient water, they then breed. How they perform these feats of navigation and physiology remain poorly known. Using GPS tracking of 38 satellite tagged Pacific black ducks (Anas superciliosa) in two contrasting ecosystems, before and after heavy rainfall we revealed a key role for facultative nocturnal flight in the movement ecology of this species. After large rainfall events, birds rapidly increased nocturnal flight activity in the arid aseasonal ecosystem, but not in the mesic seasonal one. Nocturnal flights occurred throughout the night in both ecosystems. Long range flights (>50 km in 2 hours) occurred almost exclusively at night; at night the distance flown was higher than during the day, birds visited more locations, and the locations were more widely dispersed. Our work reveals that heavy rainfall triggers increased nocturnal flight activity in desert populations of waterbirds.

  15. Mutācijas testēšanas principu izmantošana SQL komandu testēšanā

    OpenAIRE

    Kirkiļevičs, Edgars

    2013-01-01

    Darbā ir izpētīts defektu balstīts testēšanas paņēmiens – mutāciju testēšana. Ir noskaidrots mutāciju testēšanas princips, aprakstīti dažādi mutāciju operatoru veidi, kas ir kopīgi vairākām programmēšanas valodām, kādi mutāciju operatori ir dažādās programmēšanas valodās, ir salīdzināti Java valodā piedāvātie mutāciju rīki. Lielāka uzmanība ir pievērsta SQL vaicājumu mutāciju iespējām. Ir izanalizēti vairāki mutāciju operatori, ir doti šo operatoru paskaidrojumi ar piemēriem. Ir apskatīti ...

  16. How did Japanese rural dwellers become rapidly healthier in the two decades following World War II?: Examining the diverse policy interventions that improved the population's health.

    Science.gov (United States)

    Yuasa, Motoyuki

    2017-01-01

    Objective During the two decades following Japan's World War II surrender in 1945, tremendous improvement in the population's health was observed, particularly in infant mortality and life expectancy. How did Japanese rural dwellers achieve such remarkable health improvement during this relatively short time span while its economy remained heavily damaged following the war? While the efforts from government-driven public health strategies and programs are well known, relatively little is known about the contributions of policies in non-health sectors. Therefore, the main aim is to verify, using literature based sources, whether non-health sectors contributed to the betterment of the population's health in addition to the public health sector policies.Hypotheses Synergistic efforts of diverse interventions from different policies and programs likely catalyzed the drastic health improvement observed in the Japanese population in the two decades after World War II. The Ministry of Health and Welfare, for example, implemented programs to provide health care services. These are thought to have contributed directly to reducing maternal and child mortality, as well as tuberculosis-related mortality. Additionally, the Ministry of Agriculture and Forestry carried out a nationwide livelihood improvement program to enhance individual and family lifestyles, improve indoor and outdoor environments, and strengthen social solidarity. The ministry also attempted to generate income stability for farmers through an agricultural improvement program to ensure allocation of household income to family health. The Ministry of Education also had an initiative to disseminate the concepts of democracy and rational thought to the Japanese population through a social education program. Through these efforts, superstition and pre-modern customs were reduced, and subsequently health awareness increased, leading to an improvement in the population's health.Conclusion The public health

  17. Missugused on teie kogemused väikeklassidega? / Villu Mengel, Ana Kontor, Katrin Betlem, Riina Kink

    Index Scriptorium Estoniae

    2013-01-01

    Küsimusele vastasid Sikupilli keskkooli direktor Villu Mengel, Tartu hariduse tugiteenuste keskuse eripedagoog Ana Kontor, Tabasalu ühisgümnaasiumi õppejuht-sotsiaalpedagoog Katrin Betlem, Keila kooli põhikooli õppejuht Riina Kink

  18. Evaluation of toxicity of sediment samples collected from the Santa Ana National Wildlife Refuge, Texas

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objective of this study was to evaluate the toxicity of sediments collected from the Santa Ana National Wildlife Refuge, Hidalgo Co in southern Texas, USA. A...

  19. Contract Audit Followup: Defense Contract Management Agency Santa Ana Office's Actions on Incurred Cost Audits

    National Research Council Canada - National Science Library

    2005-01-01

    This report addresses the DCMA Santa Ana District Office. DoD Directive 7640.2, "Policy for Follow-up on Contract Audit Reports," February 12, 1988, as amended August 16, 1995, implements OMB Circular A-50...

  20. Lower Rio Grande Valley and Santa Ana National Wildlife Refuges : Final Interim Comprehensive Management Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This CCP outlines a 15-year plan for the management of Lower Rio Grande Valley and Santa Ana NWRs. The general topics addressed in this plan include: wildlife...

  1. Teritorijas izmantošanas konflikti Ventspils un Rīgas ostās

    OpenAIRE

    Sniķere, Sandija

    2009-01-01

    Maģistra darba nosaukums „Teritorijas izmantošanas konflikti Ventspils un Rīgas ostās”. Darbs izstrādāts latviešu valodā, 51 lappušu apjomā. Maģistra darbā izvērtēti Ventspils un Rīgas ostas teritorijas izmantošanas konflikti. Osta ir specifisks teritorijas izmantošanas veids. Latvijā ostu teritorijām izmantošana tiek noteikta pašvaldību teritorijas plānojumos. Darbības ostas teritorijā var īstenot tikai ar ostas valdes akceptu. Plānojot teritoriju var rasties potenciālie konflikti, ja pē...

  2. Runāšanas prasmju pilnveide, izmantojot stāstus

    OpenAIRE

    Dakse, Madara

    2016-01-01

    Runāšanas prasmes tiek izmantotas katru dienu. Runa ir valodas prasme, kas palīdz komunicēt. Tas ir sarežģīts process, kas iekļauj citas valodu prasmes un runas orgānus. Tāpēc ir svarīgi attīstīt runāšanas prasmes. Bakalaura darba tēma ir "Runāšanas prasmju pilnveide, izmantojot stāstus". Darba mērķis ir pierādīt, ka, izmantojot stāstu metodi mācīšanā, var uzlabot runāšanas prasmes. Darbā izmantotās pētniecības metodes ir literatūras apskats, gadījumu izpēte un triangulācijas metode. Izvirzīt...

  3. Programmēšanas spēle "PyDrone"

    OpenAIRE

    Siliņš, Viesturs

    2010-01-01

    Darbā “Programmēšanas spēle “PyDrone”” ir dokumentēta atvērtā koda programmas PyDrone izstrāde. PyDrone ir programmēšanas spēle, kas paredzēta izklaidei un izglītošanai, spēles veidā iepazīstinot cilvēkus ar programmēšanu. Programma izstrādāta, izmantojot Python programmēšanas valodu. Programma izstrādāta, izmantojot spējo metodiku programmizstrādes principus. Atslēgvārdi: Python, spējās metodikas, programmēšanas spēle.

  4. The Trail Inventory of Santa Ana National Wildlife Refuge [Cycle 1

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The purpose of this report is to create a baseline inventory of all non-motorized trails on Santa Ana National Wildlife Refuge. Trails in this inventory are eligible...

  5. Abstrakta diagrammēšanas sistēma un tās lietojumi

    OpenAIRE

    Romanovskis, Didzis

    2012-01-01

    Dokumentā tiek aprakstīta abstraktas diagrammēšanas sistēmas izstrāde, kā arī tās pielietojums prototipa aplikācijā. Šī sistēma tiks izmantota kā modulis jau esksitējošās datu vizualizācijas lietotnēs, kuras izstrādā SIA Tom Sawyer Latvia. Prototipa aplikācija tiek izstrāda tikai abstraktās diagrammēšanas sistēmas demonstrēšanas un testēšanas nolūkiem.

  6. Metal contamination in interstitial waters of Doñana Park

    OpenAIRE

    Tovar-Sánchez, Antonio; Negro, Juan J.; Huerta-Diaz, Miguel A.; Bravo, Miguel A.; Sañudo-Wilhelmy, Sergio A

    2005-01-01

    The composition of interstitial waters in Spain’s Don˜ana National Park was assessed 4 years after a major pyrite slurry spill occurred from the Aznalcollar Mine. Metal and nutrient concentrations in pore waters from two of the most important watercourses traversing Don˜ana Park were measured: Guadiamar River (affected by the accident) and Partido Stream (unimpacted by the accident). Concentrations of dissolved constituents in interstitial waters varied according to land use in the t...

  7. Projekts: SIA "KEDL Finance" izveidošana

    OpenAIRE

    Daugiša, Lāsma

    2012-01-01

    Projekts ’’SIA ’’KEDL Finance’’ izveidošana’’ paredz nodibināt uzņēmumu, kurš sniegs ārpakalpojumus grāmatvedības, revīzijas un nodokļu konsultāciju jautājumos Latvijas, Lietuvas un Igaunijas valstu uzņēmumiem un privātpersonām, ar novitāti uzsverot video konsultācijas. Kā zināms, neviens uzņēmums, kā arī privātpersonas, kas darbojas uzņēmējdarbībā, piemēram, kā pašnodarbinātas personas, nevar iztikt bez grāmatvedības vešanas. Tādējādi projekta mērķis paredz izveidot ārpakalpojumu uzņēmumu...

  8. Updating movement estimates for American black ducks (Anas rubripes)

    Science.gov (United States)

    Robinson, Orin J.; McGowan, Conor P.; Devers, Patrick K.

    2016-01-01

    Understanding migratory connectivity for species of concern is of great importance if we are to implement management aimed at conserving them. New methods are improving our understanding of migration; however, banding (ringing) data is by far the most widely available and accessible movement data for researchers. Here, we use band recovery data for American black ducks (Anas rubripes) from 1951–2011 and analyze their movement among seven management regions using a hierarchical Bayesian framework. We showed that black ducks generally exhibit flyway fidelity, and that many black ducks, regardless of breeding region, stopover or overwinter on the Atlantic coast of the United States. We also show that a non-trivial portion of the continental black duck population either does not move at all or moves to the north during the fall migration (they typically move to the south). The results of this analysis will be used in a projection modeling context to evaluate how habitat or harvest management actions in one region would propagate throughout the continental population of black ducks. This analysis may provide a guide for future research and help inform management efforts for black ducks as well as other migratory species.

  9. Updating movement estimates for American black ducks (Anas rubripes

    Directory of Open Access Journals (Sweden)

    Orin J. Robinson

    2016-03-01

    Full Text Available Understanding migratory connectivity for species of concern is of great importance if we are to implement management aimed at conserving them. New methods are improving our understanding of migration; however, banding (ringing data is by far the most widely available and accessible movement data for researchers. Here, we use band recovery data for American black ducks (Anas rubripes from 1951–2011 and analyze their movement among seven management regions using a hierarchical Bayesian framework. We showed that black ducks generally exhibit flyway fidelity, and that many black ducks, regardless of breeding region, stopover or overwinter on the Atlantic coast of the United States. We also show that a non-trivial portion of the continental black duck population either does not move at all or moves to the north during the fall migration (they typically move to the south. The results of this analysis will be used in a projection modeling context to evaluate how habitat or harvest management actions in one region would propagate throughout the continental population of black ducks. This analysis may provide a guide for future research and help inform management efforts for black ducks as well as other migratory species.

  10. El ayer, el hoy y el mañana

    Directory of Open Access Journals (Sweden)

    Corredor Pardo Katya Anyud

    1999-12-01

    Full Text Available

    Culturalmente, el anciano de hoy en nuestra sociedad, o en las grandes urbes, es considerado algunas veces por los jóvenes como un ser extraño y desagradable, como punto de partida de los  valores transmitidos en la familia los cuales deben ser revaluados y nosotros, los ancianos del mañana con los ancianos de hoy, cambiar de adentro hacia fuera. A su vez, evitar la transmisión generacional de estos valores a nuestros hijos realizando un análisis retrospectivo de la vida; cuando bebes, se tiene conciencia del uno al otro, y los niños en edad preescolar empiezan a conseguir compañeros, pero el grupo de amigos se fortalece a partir de los cinco o siete años, con frecuencia se escucha hablar con nostalgia de la vida en el colegio. Este lugar común es grato y feliz, adornado con carcajadas y anécdotas que despiertan e incentivan la imaginación y la realidad creada a partir del propio yo social, individual y cultural.

  11. Surogasijas legalizēšanas tiesiskie aspekti

    OpenAIRE

    Ridere, Agnese

    2011-01-01

    Šī bakalaura darba tēma ir „Surogasijas legalizēšanas tiesiskie aspekti”. Šī darba mērķi ir noskaidrot kā ārvalstu normatīvajos aktos tiek regulēti jautājumi, saistībā ar surogasijas tiesisko regulējumu, vai pastāv pārnacionāla līmeņa regulējums attiecībā uz šiem jautājumiem, vai ir iespējams legalizēt surogasiju Latvijas Republikā un kādi ir nepieciešamie normatīvo aktu grozījumi. Šajā darbā tiek apkopota un analizēta Eiropas Savienības nostāja attiecībā uz surogasijas legalizēšanu Eiropa...

  12. Projekts: Koka rotaļlietu ražošanas uzņēmuma "Wood toys factory" dibināšana

    OpenAIRE

    Čoičs, Andris

    2013-01-01

    Maģistra darba nosaukums ir „Projekts: Koka rotaļlietu ražošanas uzņēmuma „Wood toys factory” dibināšana”. Maģistra darba mērķis ir izveidot projektu jaundibināma uzņēmuma sekmīgas saimnieciskās darbības izvērtēšanai. Plānotā uzņēmuma pamatdarbības veids ir koka rotaļlietu ražošana, bērnu rotaļu laukumu ražošana un nestandarta koka konstrukciju ražošana. Darbā analizētais periods ir no 2013. gada aprīļa, līdz 2016. gada decembrim. Uzņēmuma plānotā koncepcija balstās uz ekoloģiski t...

  13. Apdrošināšanas krāpšana saistībā ar automašīnu zādzībām

    OpenAIRE

    Kalēja, Madara

    2013-01-01

    Apdrošināšanas krāpšana ir viena no nopietnākajām apdrošināšanas kompāniju problēmām ne tikai Latvijā, bet visā pasaulē, ar to tiek nodarīti milzīgi zaudējumi apdrošināšanas kompānijām. Apdrošināšanas krāpšanas novēršana ir nesaraujami saistīta gan ar ekonomisko situāciju valstī, gan indivīdu tiesiskās apziņas līmeni. Apdrošināšanas krāpšanas gadījumi, kas saistīti ar inscenētām automašīnu zādzībām, ir ar tendenci palielināties, pamatojoties uz vēlmi gūt materiālu labumu un atbrīvoties no fin...

  14. Mortality in the endangered Laysan teal, Anas laysanensis: conservation implications

    Science.gov (United States)

    Reynolds, M.H.; Work, Thierry M.

    2005-01-01

    The Laysan Teal Anas laysanensis is an endangered anatid of the Hawaiian Islands, currently restricted to an emergent atoll, Laysan Island. Laysan Island lacks terrestrial mammalian predators, which permits the examination of mortality rates and causes without the anthropogenic effects of introduced predators. Mass and morophometrics were measured during the colour-marking of 297 Laysan Teal between 1998 and 2001. Intensive mark-resighting and recovery methods were used to estimate adult and juvenile mortality. One hundred and nineteen carcasses were collected on Laysan between 1998 and 2003, and systematic gross and microscopic examinations were undertaken on 63 of these. Causes of mortality were categorised as trauma, emaciation, miscellaneous or undetermined. Annual adult mortality rates were low, 0.05-0.10 (s.e. <0.01), but duckling mortality was much higher, varying from approximately 0.7-0.9 during 1998-2000 and 2003. Body condition of both sexes deteriorates during the breeding season, and most adult mortality (88%) occurred during or post-breeding (May-October). Cause of mortality was determined via necropsy in 22 ducks. Of three adults, one died from bacterial infections, one was egg bound, and one died from botulism concomitant with nematode infestation. Fourteen ducklings died from acute trauma, four from emaciation sometimes associated with nematode infection, and one from bacterial pneumonia Trauma is a significant factor in Laysan duckling mortalities, and elucidating the cause of and preventing such trauma may allow for management measures to enhance duckling survivability. High duckling mortality rates and emaciation also indicate that habitat on Laysan Island may have limited capacity to support broods.

  15. The prevalence of ANA antibodies, anticentromere antibodies, and anti-cyclic citrullinated peptide antibodies in patients with primary Sjögren's syndrome compared to patients with dryness symptoms without primary Sjögren's syndrome confirmation.

    Science.gov (United States)

    Maślińska, Maria; Mańczak, Małgorzata; Wojciechowska, Bożena; Kwiatkowska, Brygida

    2017-01-01

    Our study analyses the prevalence of ANA, anti-SS-A, anti-SS-B, and ACA and ACPA antibodies in patients with pSS and with dryness symptoms without pSS confirmation, and the association of ACPA and ACA antibodies with specific clinical symptoms. 113 patients were divided into two groups: I - with diagnosed pSS (N = 75); and II - with dryness without pSS evidence (N = 38). Diagnostics: indirect immunofluorescence (IF; Hep-2 cell line) of antinuclear antibodies (ANA), anti-SS-A anti-SS-B antibodies determined with semi-quantitative method, autoantibody profile (14 antigens, ANA Profil 3 EUROLINE); basic laboratory, ophthalmic examination tests, minor salivary gland biopsy with focus score (FS), joint and lung evaluation, and ESSDAI questionnaire (pSS activity). 88% of group I had ANA antibodies (1 : 320 titre), 5.3% at 1 : 160. Anti-SS-A antibodies were present in 88% of group I, including all ANA 1 : 160. Anti-SS-A antibodies positively correlated with greater and moderate activity of ESSDAI 5 (p = 0.046) and FS. The presence of SS-B antibodies significantly affected disease activity. ACPA present: group I - 13% (associated with higher arthritis incidence; p = 0.003); group II - 8%. ACA antibodies present in 4% of group I, but not in group II. No ACA association with interstitial lung changes (small ACA + group excludes full conclusions). ANA antibodies should also be considered in a titre of less than 1 : 320, but the presence of anti-SS-A antibodies is still the most important immunological marker for pSS. Anti-SS-A antibodies correlate with higher disease activity (ESSDAI ≥ 5) and higher FS. The presence of the anti-SS-B antibody was significantly affected by higher activity of the disease. The incidence of arthritis was higher in patients with ACPA+ pSS compared to ACPA- (p = 0.003). There was no relationship between ACPA and arthritis in patients with dry-type syndrome without diagnosis of pSS.

  16. THE ROMANIZATION PROCESS IN CRIȘANA IN THE LIGHT OF ARCHAEOLOGICAL RESEARCHES

    Directory of Open Access Journals (Sweden)

    Laura ARDELEAN

    2017-08-01

    Full Text Available In this paper the 2nd to 4th century period for Crişana is highlighted, when this area was massively inhabited by the tribes of free Dacians, the ones not incorporated in the Roman Empire. They lived between the Iazyg Sarmatians and the Germanic people from the West and North-West and the Roman province Dacia. Their material culture lives on, changes in their structure are made by the appearance of black grainy pottery and the brick-red usual roman pottery. Gradually their culture is metamorphosed in a provincial Roman one. The settlements belonging to the free Dacians on the Crişul Repede, Crişul Alb, Crişul Negru, Barcău and Ier valleys were archaeologically researched. We mention the settlement from Medieşul Aurit where dozens of pottery kilns were discovered and where Roman style pottery was produced on a grand scale destined for trade. Researches showed that the free Dacians continued their lives even after the Roman conquest. They had contacts with Sarmatians and Germanic people but the strong Roman influence cannot be contested, especially through trade and social relations. After the Romans left the province one can observe movements of romanized Dacians towards West and North-West but also movements of free Dacians’ territory towards the once Roman Dacia. The process of romanization continues here until the arrival of the Slavs and in the 9th-10th century the Romanians form here a separate political formation.PROCESUL DE ROMANIZARE ÎN CRIȘANA ÎN LUMINA CERCETĂRILOR ARHEOLOGICEÎn această lucrare este evidențiată perioada secolelor II-IV d.Hr. în Crișana, când această zonă a fost locuită masiv de triburile dacilor liberi, cei care nu au fost încorporați în Imperiul Roman. Ei au trăit între sarmații iazygi și populațiile germanice din vest și nord-vest și provincia romană Dacia. Cultura lor materială continuă, schimbările în structura ei constau în apariția ceramicii negre zgrunțuroase și a

  17. Türkiye’de Ana Arı Üretiminin Değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    Murat EMİR

    2015-11-01

    Full Text Available Bu çalışmanın temel amacı, Türkiye'de ana arı üretiminin mevcut durumunu tespit etmektir. Bu amaç çerçevesinde ülkemiz ana arı üretim kapasitesi ve üreticilerin durumuna ilişkin çözümler önerilecektir. Çalışmanın ana veri kaynağı, Türkiye ve diğer ülkelerde yapılan ilgili çalışmalardır. Bu çalışma, bu alanda yapılan çalışmaları gözden geçirerek genel çıkarımlara ulaşmak için sentezlemiştir. Ana arının performansı koloni performansını etkilemektedir. Ana arının kalitesi, koloni bal veriminde son derece önemlidir. Türkiye'nin koloni başına bal verimi 2014 yılında sadece 14 kg olurken, düşük verimin önemli nedenlerinden biri ana arı faktörüdür. Bakanlık tarafından yetkilendirilmiş 104 ana arı üreticisinin toplam yıllık kapasitesi 351 bin adettir. Bu üreticiler, ülkenin 28 ilinde faaliyet göstermektedirler. Türkiye genelinde yedi milyonu aşan koloni bulunmasından dolayı mevcut üreticilerin yıllık 351 bin ana arı üretim kapasitesi yeterli olmamaktadır. Türkiye’de ana arı üreticilerinin teknik ve ekonomik faaliyetlerini içeren işletme düzeyinde çalışma bulunmamaktadır. Ayrıca ana arı üretiminde üretici unsurları ve kalitesi konusunda yeterince çalışma mevcut değildir. Bunun yanında mevcut ana arı üretim işletmelerinin kapasitelerini artırabilme kabiliyeti ve sermaye gereksinimi üzerine çalışmalar bulunmamaktadır. Belirtilen ihtiyaca mevcut ana arı üreticilerinin kapasite artırım eğilimleri ve mevcut arıcılık işletmelerinin ana arı üreticiliği için ihtiyaç duyacağı ilave yatırım maliyetinin hesaplanması ile veriye dayalı yanıt aranmalıdır.

  18. Sediment Dynamics Affecting the Threatened Santa Ana Sucker in the Highly-modified Santa Ana River and Inset Channel, Southern California, USA

    Science.gov (United States)

    Minear, J. T.; Wright, S. A.

    2015-12-01

    In this study, we investigate the sediment dynamics of the low-flow channel of the Santa Ana River that is formed by wastewater discharges and contains some of the last remaining habitat of the Santa Ana Sucker (Catostomus santaanae). The Santa Ana River is a highly-modified river draining the San Bernardino Mountains and Inland Empire metropolitan area east of Los Angeles. Home to over 4 million people, the watershed provides habitat for the federally-threatened Santa Ana Sucker, which presently reside within the mainstem Santa Ana River in a reach supported by year-round constant discharges from water treatment plants. The nearly constant low-flow wastewater discharges and infrequent runoff events create a small, approximately 8 m wide, inset channel within the approximately 300 m wide mainstem channel that is typically dry except for large flood flows. The sediment dynamics within the inset channel are characterized by constantly evolving bed substrate and sediment transport rates, and occasional channel avulsions. The sediment dynamics have large influence on the Sucker, which rely on coarse-substrate (gravel and cobble) for their food production. In WY 2013 through the present, we investigated the sediment dynamics of the inset channel using repeat bathymetric and substrate surveys, bedload sampling, and discharge measurements. We found two distinct phases of the inset channel behavior: 1. 'Reset' flows, where sediment-laden mainstem discharges from upstream runoff events result in sand deposition in the inset channel or avulse the inset channel onto previously dry riverbed; and 2. 'Winnowing' flows, whereby the sand within the inset channel is removed by clear-water low flows from the wastewater treatment plant discharges. Thus, in contrast to many regulated rivers where high flows are required to flush fine sediments from the bed (for example, downstream from dams), in the Santa Ana River the low flows from wastewater treatment plants serve as the flushing

  19. A high repetition rate TEA CO II laser operating at λ=9.3-μm for the rapid and conservative ablation and modification of dental hard tissues

    Science.gov (United States)

    Fan, Kenneth; Fried, Daniel

    2006-02-01

    TEA CO II lasers tuned to the strong mineral absorption of hydroxyapatite near λ=9-μm are ideally suited for the efficient ablation of dental hard tissues if the laser-pulse is stretched to greater than 5-10-μs to avoid plasma shielding phenomena. Such CO II lasers are capable of operating at high repetition rates for the rapid removal of dental hard tissues. An Impact 2500 TEA CO II laser system from GSI Lumonics (Rugby, UK) custom modified by LightMachinery (Ottawa, Canada) with a repetition rate of 0-500 Hz was used for rapid tissue removal. The single pulse ablation rates through enamel were determined for incident fluence ranging from (1-160 J/cm2). Lateral incisions using a computer controlled scanning stage and water spray were produced and the crater morphology and chemical composition were measured using optical microscopy and high-resolution synchrotron radiation infrared spectromicroscopy. The transmission through 2-meter length 300, 500, 750 and 1000-μm silica hollow waveguides was measured and 80% transmission was achieved with 40-mJ per pulse. The λ=9.3-μm laser pulses efficiently removed dental enamel at rates exceeding 15-μm per pulses with minimal heat accumulation. The residual energy remaining in tooth samples was measured to be 30-40% without water cooling, significantly lower than for longer CO II laser pulses. These results suggest that high repetition rate TEA CO II laser systems operating at λ=9.3-μm with pulse durations of 10-20-μs are ideally suited for dental application.

  20. Satelīttelevīzijas kodēšana

    OpenAIRE

    Beļajeva, Lidija

    2010-01-01

    Bakalaura darbs ir veltīts satelīttelevīzijas signāla kodēšanas izpētīšanai. Tiek apskatītās populārākās kodēšanas metodes, kurus lieto mūsdienā, kā arī nelegālās TV kanālu pieejas problēma. Darba mērķis ir sniegt satelīttelevīzijas kodēšanas attēlojumu un izpētīt to no legālas un nelegālas puses.

  1. A rapid extractive spectrophotometric determination of copper(II) in environmental samples, alloys, complexes and pharmaceutical samples using 4-[N,N(dimethyl)amino]benzaldehyde thiosemicarbazone.

    Science.gov (United States)

    Karthikeyan, J; Naik, P Parameshwara; Shetty, A Nityananda

    2011-05-01

    4-[N,N-(Dimethyl)amino]benzaldehyde thiosemicarbazone (DMABT) is proposed as an analytical reagent for the extractive spectrophotometric determination of copper(II). DMABT forms yellow colored complex with copper(II) in the pH range 4.4-5.4. Beer's law is obeyed in the concentration range up to 4.7 μg mL(-1). The optimum concentration range for minimum photometric error as determined by Ringbom plot method is 1.2-3.8 μg mL(-1). The yellowish Cu(II)-DMABT complex shows a maximum absorbance at 420 nm, with molar absorptivity of 1.72 × 10(4)dm(3) mol(-1) cm(-1) and Sandell's sensitivity of the complex obtained from Beer's data is 0.0036 μg cm(-2). The composition of the Cu(II)-DMABT complex is found to be 1:2 (M/L). The interference of various cations and anions in the method were studied. Thus the method can be employed for the determination of trace amount of copper(II) in water, alloys and other natural samples of significant importance.

  2. A sensitive, selective and rapid determination of lead(II) ions in real-life samples using an electrochemically reduced graphene oxide-graphite reinforced carbon electrode.

    Science.gov (United States)

    Hamsawahini, Kunashegaran; Sathishkumar, Palanivel; Ahamad, Rahmalan; Yusoff, Abdull Rahim Mohd

    2015-11-01

    In this study, a sensitive and cost-effective electrochemically reduced graphene oxide (ErGO) on graphite reinforced carbon (GRC) was developed for the detection of lead (Pb(II)) ions present in the real-life samples. A film of graphene oxide (GO) was drop-casted on GRC and their electrochemical properties were investigated using cyclic voltammetry (CV), amperometry and square wave voltammetry (SWV). Factors influencing the detection of Pb(II) ions, such as grades of GRC, constant applied cathodic potential (CACP), concentration of hydrochloric acid and drop-casting drying time were optimised. GO is irreversibly reduced in the range of -0.7 V to -1.6 V vs Ag/AgCl (3 M) in acidic condition. The results showed that the reduction behaviour of GO contributed to the high sensitivity of Pb(II) ions detection even at nanomolar level. The ErGO-GRC showed the detection limit of 0.5 nM and linear range of 3-15 nM in HCl (1 M). The developed electrode has potential to be a good candidate for the determination of Pb(II) ions in different aqueous system. The proposed method gives a good recovery rate of Pb(II) ions in real-life water samples such as tap water and river water. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Veinte años de investigaciones alrededor de Doñana

    Directory of Open Access Journals (Sweden)

    Arambarri, Pablo

    1998-10-01

    Full Text Available Not available.La rotura de la balsa de decantado de lodos de la empresa Boliden-Apirsa en Aznalcóllar ha demostrado que el Parque Nacional de Doñana está indefenso ante accidentes de gran calibre, que deben prevenirse. Doñana no puede permanecer aislada ni ajena al territorio que la rodea, pero sí debe estar protegida por suficientes medios descontaminantes, sistemas de alarma en tiempo real, planes de emergencia operativos y estudios y proyectos I+D como sean necesarios para evitar percances como el ocurrido, que ponen en terrible peligro su propia existencia.

  4. A coordinated set of ecosystem research platforms open to international research in ecotoxicology, AnaEE-France.

    Science.gov (United States)

    Mougin, Christian; Azam, Didier; Caquet, Thierry; Cheviron, Nathalie; Dequiedt, Samuel; Le Galliard, Jean-François; Guillaume, Olivier; Houot, Sabine; Lacroix, Gérard; Lafolie, François; Maron, Pierre-Alain; Michniewicz, Radika; Pichot, Christian; Ranjard, Lionel; Roy, Jacques; Zeller, Bernd; Clobert, Jean; Chanzy, André

    2015-10-01

    The infrastructure for Analysis and Experimentation on Ecosystems (AnaEE-France) is an integrated network of the major French experimental, analytical, and modeling platforms dedicated to the biological study of continental ecosystems (aquatic and terrestrial). This infrastructure aims at understanding and predicting ecosystem dynamics under global change. AnaEE-France comprises complementary nodes offering access to the best experimental facilities and associated biological resources and data: Ecotrons, seminatural experimental platforms to manipulate terrestrial and aquatic ecosystems, in natura sites equipped for large-scale and long-term experiments. AnaEE-France also provides shared instruments and analytical platforms dedicated to environmental (micro) biology. Finally, AnaEE-France provides users with data bases and modeling tools designed to represent ecosystem dynamics and to go further in coupling ecological, agronomical, and evolutionary approaches. In particular, AnaEE-France offers adequate services to tackle the new challenges of research in ecotoxicology, positioning its various types of platforms in an ecologically advanced ecotoxicology approach. AnaEE-France is a leading international infrastructure, and it is pioneering the construction of AnaEE (Europe) infrastructure in the field of ecosystem research. AnaEE-France infrastructure is already open to the international community of scientists in the field of continental ecotoxicology.

  5. Personāla vadīšanas pilnveidošana organizācijā SIA "AXON CABLE"

    OpenAIRE

    Malāne, Jekaterina

    2013-01-01

    Bakalaura darba „Personāla vadīšanas pilnveidošana organizācijā SIA „AXON CABLE”” mērķis ir, balstoties uz uzņēmuma „AXON CABLE” personāla vadīšanas izpēti, izstrādāt priekšlikumus tās pilnveidošanai. Bakalaura darbs sastāv no trim nodaļām. Pirmajā nodaļā ir izpētīta personālvadības vieta uzņēmuma stratēģijā, raksturotas personālvadības funkcijas. Otrajā nodaļā ir sniegts uzņēmuma darbības, vīzijas, misijas, struktūras, darba satura raksturojums. Trešajā nodaļā veikts pētījums par personāl...

  6. A novel, highly sensitive, selective, reversible and turn-on chemi-sensor based on Schiff base for rapid detection of Cu(II)

    Science.gov (United States)

    Saleh, Sayed M.; Ali, Reham; Ali, Ibrahim A. I.

    2017-08-01

    In this work, a novel optical fluoro-chemisensor was designed and synthesized for copper (II) ions detection. The sensor film is created by embedded N,N-Bis(2-hydroxo-5-bromobenzyl)ethylenediamine in poly vinyl chloride (PVC) film in presence of dioctyl phthalate (DOP) as plasticizer. The receptor Schiff base reveals ;off-on; mode with high selectivity, significant sensitivity to Cu(II) ions. The selectivity of optical sensor for Cu(II) ions is the result of chelation enhanced fluorescence (CHEF). The optimal conditions of pH and response time at which higher efficiency of sensor film is performed was found to be 6.8 and 2.48 min. The possible interference of other metal ions in solution was examined in presence of different types of metal ions. This film shows high selectivity and ultra-sensitivity with low detection limit LOD (1.1 × 10- 8 M). Thus, these considerable properties make it viable to monitor copper metal ions within very low concentration range (0-15 × 10- 6 M Cu(II)) and highly selective even in the presence of different types of metal ions. The sensor reversibility was achieved by utilizing EDTA solution with concentration of 0.1 M solution.

  7. Rapid adsorption of toxic Pb(II) ions from aqueous solution using multiwall carbon nanotubes synthesized by microwave chemical vapor deposition technique.

    Science.gov (United States)

    Mubarak, Nabisab Mujawar; Sahu, Jaya Narayan; Abdullah, Ezzat Chan; Jayakumar, Natesan Subramanian

    2016-07-01

    Multiwall carbon nanotubes (MWCNTs) were synthesized using a tubular microwave chemical vapor deposition technique, using acetylene and hydrogen as the precursor gases and ferrocene as catalyst. The novel MWCNT samples were tested for their performance in terms of Pb(II) binding. The synthesized MWCNT samples were characterized using Fourier Transform Infrared (FT-IR), Brunauer, Emmett and Teller (BET), Field Emission Scanning Electron Microscopy (FESEM) analysis, and the adsorption of Pb(II) was studied as a function of pH, initial Pb(II) concentration, MWCNT dosage, agitation speed, and adsorption time, and process parameters were optimized. The adsorption data followed both Freundlich and Langmuir isotherms. On the basis of the Langmuir model, Qmax was calculated to be 104.2mg/g for the microwave-synthesized MWCNTs. In order to investigate the dynamic behavior of MWCNTs as an adsorbent, the kinetic data were modeled using pseudo first-order and pseudo second-order equations. Different thermodynamic parameters, viz., ∆H(0), ∆S(0) and ∆G(0) were evaluated and it was found that the adsorption was feasible, spontaneous and endothermic in nature. The statistical analysis revealed that the optimum conditions for the highest removal (99.9%) of Pb(II) are at pH5, MWCNT dosage 0.1g, agitation speed 160r/min and time of 22.5min with the initial concentration of 10mg/L. Our results proved that microwave-synthesized MWCNTs can be used as an effective Pb(II) adsorbent due to their high adsorption capacity as well as the short adsorption time needed to achieve equilibrium. Copyright © 2016. Published by Elsevier B.V.

  8. Composition and size class structure of tree species in Ihang'ana ...

    African Journals Online (AJOL)

    Ihang'ana Forest Reserve is part of the Udzungwa Mountains ecosystem that falls under the Eastern Arc Mountains (EAM). Previous plant biodiversity studies in this ecosystem concentrated on large-sized Forest Reserves of greater than 20,000 ha (FR) such as the Uzungwa Scarp ignoring small-sized forests of less than ...

  9. Atzīšanas vēlmju komunikācija Youtube vlogos

    OpenAIRE

    Antonova, Kristīne

    2017-01-01

    Mūsdienās sociālajiem medijiem jauniešu dzīvē ir neatņemama loma. Vecuma posmā, kad viena no pamatvajadzībām pašapzināšanās norisē ir atzīšana no citiem, Youtube un šobrīd gan ārzemēs, gan Latvijā aktuālā vlogošana var kalpot par vienu no veidiem, kā to iegūt ļoti plašā un personību ietekmējošā veidā. Bakalaura darba „Atzīšanas vēlmju komunikācija Youtube vlogos” galvenā pētāmā problēma ir vlogošanas ietekme un nozīme pusaudža attīstības un pašapzināšanās procesā. Darbā tiek pētīts, kā pusaud...

  10. Slenga tulkošanas aspekti televīzijas seriālos

    OpenAIRE

    Vēbere, Ilze

    2015-01-01

    Maģistra darbā ir apskatīts un analizēts slenga lietojums un tulkojums televīzijas seriālos. Darba mērķis ir apzināt slenga tulkošanas aspektus un problēmas, kā arī analizēt televīzijas seriālā “Modern Family” lietotos slengismus un to tulkojumus, lai noteiktu, kas jāievēro, tulkojot slenga vārdus televīzijas seriālos. Darbā ņemta vērā audiovizuālo tekstu tulkošanas specifika. Pētījuma teorētiskajā daļā aplūkota tulkošanas definīcija, kā arī aprakstīta audiovizuālo tekstu tulkošana kā atseviš...

  11. Seeking explanations for recent changes in abundance of wintering Eurasian Wigeon (Anas penelope) in northwest Europe

    DEFF Research Database (Denmark)

    Fox, Anthony David; Dalby, Lars; Christensen, Thomas Kjær

    2016-01-01

    We analysed annual changes in abundance of Eurasian Wigeon (Anas penelope) derived from mid-winter International Waterbird Census data throughout its northwest European flyway since 1988 using log-linear Poisson regression modelling. Increases in abundance in the north and east of the wintering...

  12. Seasonal variation in Eurasian Wigeon Anas penelope sex and age ratios from hunter-based surveys

    DEFF Research Database (Denmark)

    Clausen, Kevin Kuhlmann; Dalby, Lars; Sunde, Peter

    2013-01-01

    schemes. This study found consistent seasonal variation in Eurasian Wigeon Anas penelope sex and age ratios among Danish hunter-based wing surveys, and describes how accounting for this variation might explain reported discrepancies between this and other monitoring methods. Early season flocks were...

  13. Braukšanas maršruta optimizācija

    OpenAIRE

    Nire, Eva

    2008-01-01

    Bakalaura darbs veltīts braukšanas maršruta analīzei ar mērķi optimizēt braukšanas laiku. Braukšanas maršruts tiek optimizēts izmantojot Dijkstras algoritmu, braukšanas laiku ietekmējošos faktorus un navigācijas programmu „Autoroute” (Europe). Aprakstītās metodes ir pielietotas konkrēta maršruta optimizācijai un salīdzinot iegūtos rezultātus ir pierādīts – īsākais ceļš ne vienmēr ir ātrākais. Atslēgvārdi: īsākā ceļa problēma, Dijkstras algoritms, maršruta optimizācija....

  14. OBJETOS SIMBÓLICOS EN LA NARRATIVA DE ANA MARÍA MATUTE

    Directory of Open Access Journals (Sweden)

    Xiaojie Cai (Capital Normal University, Beijin

    2013-10-01

    Full Text Available Neste aritigo, está esboçado o simbolismo pessoal que faz Ana Maria Matute em objetos cotidianos e materiais. Através de análise da caracterização que transmitem imagens como a ilha, o boneco, o teatro de bonecos, o fogo, a torre e a pedra azul, está realizada uma sistematização de simbolismo na narrativa de Matute e revela uma faceta fundamental e novel da poética da escritora.PALAVRAS-CHAVE: Ana María Matute, Simbolismo, Metáforas, Alegorias, Objetos Materiais. Resumen  En este artículo se reseña el simbolismo personal que elabora Ana María Matute sobre objetos cotidianos y materiales. Por medio del análisis de la caracterización que transmiten imágenes como la isla, el muñeco, el teatro de marionetas, el fuego, la torre y la piedra azul, se realiza una sistematización del simbolismo en la narrativa de Matute y se revela una faceta fundamental y novedosa de la poética de la escritora. PALABRAS CLAVE: Ana María Matute, Simbolismo, Metáforas, Alegorías, Objetos Materiales. 

  15. composition and size class structure of tree species in ihang'ana ...

    African Journals Online (AJOL)

    nb

    R. lucida. R. m ela nop hlo eos. R . vulg aris. P.e xcelsa. N . florib und a. Plant species. D. B. H s ize s. Figure 5: Population structure and DBH size class distribution. (a) The DBH size class distribution for all trees and (b) Average. DBH size classes for the 14 most dominant tree species,. Ihang'ana Forest Reserve, Tanzania.

  16. Forecast skill of synoptic conditions associated with Santa Ana winds in Southern California

    Science.gov (United States)

    Charles Jones; Francis Fujioka; Leila M.V. Carvalho

    2010-01-01

    Santa Ana winds (SAW) are synoptically driven mesoscale winds observed in Southern California usually during late fall and winter. Because of the complex topography of the region, SAW episodes can sometimes be extremely intense and pose significant environmental hazards, especially during wildfire incidents. A simple set of criteria was used to identify synoptic-scale...

  17. New dinosaur fossils from ANA locality, Arcillas de Morella Formation (Aptian, Lower Cretaceous, Cinctorres, Spain)

    Science.gov (United States)

    Santos-Cubedo, A.; de Santisteban, C.; Suñer, M.; Galobart, A.

    2009-04-01

    Ana is one of the several dinosaur bone sites located in the Arcillas de Morella Formation (Aptian, Lower Cretaceous; eastern Iberian Chain, Spain). This site was discovered in 1998, but it remained unexcavated until 2002, when a palaeontologist team formed by members of the Institut Paleontología Miquel Crusafont from Sabadell and the Grup Guix from Vila-real unearthed the first fossil from the locality. Nowadays there are five hundred fossils collected, including vertebrate and invertebrate species. Dinosaur bones (Theropoda and Ornithopoda) are abundant in this assemblage and in the last field season bones determined as Sauropoda were found. Taxonomically, Ana is dominated by disarticulated remains of Ornithopoda, which are usually fragmentary and abraded. Many of the elements may have been reworked (spatial averaging and/or time averaging), and the fossil concentration constitutes an autochthonous to parautochthonous association, in a spatial sense. The remains found in the Ana fossils site are placed in sandstones and limes containing marine autochthonous fauna. These deposits were formed during the transgressive infilling of an incised valley. Sedimentological features indicate that fossils were finally deposited in starved shallow estuarine environment. Mineralogically, the sediment including the fossils contains grains of quartz, illite/mica, kaolinite/clorite, K-feldspar and plagioclase, distributed in two mainly grain populations, a silty-clay and a coarse sand size grain, indicating that the sediments were bedded in a low-medium energy depositional environment. Nowadays we identified in Ana, teeth of Theropoda indet. and Baryonychinae indet., and bones of Iguanodon sp. Herein, we report new fossil findings from Ana site. These materials have been determined as Iguanodontia, Titanosauriformes and Theropoda. These new findings will help to understand the dinosaur fauna present in the Lower Cretaceous of Els Ports (Castellón, Spain). Acknowledgments This

  18. Cranial joint histology in the mallard duck (Anas platyrhynchos): new insights on avian cranial kinesis.

    Science.gov (United States)

    Bailleul, Alida M; Witmer, Lawrence M; Holliday, Casey M

    2017-03-01

    The evolution of avian cranial kinesis is a phenomenon in part responsible for the remarkable diversity of avian feeding adaptations observable today. Although osteological, developmental and behavioral features of the feeding system are frequently studied, comparatively little is known about cranial joint skeletal tissue composition and morphology from a microscopic perspective. These data are key to understanding the developmental, biomechanical and evolutionary underpinnings of kinesis. Therefore, here we investigated joint microstructure in juvenile and adult mallard ducks (Anas platyrhynchos; Anseriformes). Ducks belong to a diverse clade of galloanseriform birds, have derived adaptations for herbivory and kinesis, and are model organisms in developmental biology. Thus, new insights into their cranial functional morphology will refine our understanding of avian cranial evolution. A total of five specimens (two ducklings and three adults) were histologically sampled, and two additional specimens (a duckling and an adult) were subjected to micro-computed tomographic scanning. Five intracranial joints were sampled: the jaw joint (quadrate-articular); otic joint (quadrate-squamosal); palatobasal joint (parasphenoid-pterygoid); the mandibular symphysis (dentary-dentary); and the craniofacial hinge (a complex flexion zone involving four different pairs of skeletal elements). In both the ducklings and adults, the jaw, otic and palatobasal joints are all synovial, with a synovial cavity and articular cartilage on each surface (i.e. bichondral joints) ensheathed in a fibrous capsule. The craniofacial hinge begins as an ensemble of patent sutures in the duckling, but in the adult it becomes more complex: laterally it is synovial; whereas medially, it is synostosed by a bridge of chondroid bone. We hypothesize that it is chondroid bone that provides some of the flexible properties of this joint. The heavily innervated mandibular symphysis is already fused in the

  19. Histomorphological study of the parathyroid gland in female Kuttanad ducks (Anas platyrhynchos domesticus

    Directory of Open Access Journals (Sweden)

    Firdous Ahmad Dar

    2013-11-01

    Full Text Available Aim: The present work was targeted to form the baseline data of normal morphological and histological picture of parathyroid gland in female Kuttanad ducks.Materials and Methods: A Histomorphological study of the parathyroid gland was carried out in twelve adult female Kuttanad ducks (Anas platyrhynchos domesticus of 20 weeks of age. Birds reared semintensively were procured from Kerala Veterinary and Animal Sciences University Poultry and Duck Farm and sacrificed humanely. Glands were collected and gross parameters were recorded. The glands were fixed in 10 percent neutral buffered formalin. The small sized glands were processed as such by routine histological methods, paraffin blocks were prepared and sectioned to a thickness of 5µ. The tissues were stained by Haematoxylin and Eosin (H&E for routine histological studies and Gomori's rapid one step trichrome method for connective tissue fibres. Micrometric parameters were recorded using ocular micrometer. Results: Parathyroid glands in Kuttanad ducks lay just caudal to the division of the innominate artery into the subclavian and common carotid arteries. Parathyroids were oval to spherical in shape, yellow in colour and smaller than thyroid gland of the representative sides. The arterial blood supply was from common carotid artery and blood from gland was drained directly into jugular vein. Although it lied close to the thyroid, thymus and ultimobranchial gland, parathyroid tissue did not merge to any of the above mentioned three glands. Parenchyma was composed irregular anatomizing cords of cells supplied by connective tissue stroma penetrated by blood capillaries. Parenchyma was predominantly made of lightly stained cell, the chief cell. The nuclei were round and contain one or two nucleoli. Oxyphil cells present in parathyroid glands of other mammals were not seen in the present study. Conclusion: Histomorphological features or characteristics of Parathyroid gland in Kuttanad duck were

  20. Comportamiento del asma bronquial en adolescentes tratados en el Policlínico Universitario "Ana Betancourt" Course of bronchial asthma in adolescents seen in "Ana Betancourt" University Polyclinic

    Directory of Open Access Journals (Sweden)

    Tatiana de la Vega Pazitková

    2010-03-01

    Full Text Available Introducción: el asma infantil representa una entidad que aún no ha logrado ser bien definida y delimitada, lo que establece variadas interpretaciones de su epidemiología, diagnóstico y, consecuentemente de su tratamiento. Objetivos: estimar la prevalencia global de asma en adolescentes tratados en consultorios médicos de familia del Policlínico Universitario "Ana Betancourt". Métodos: se realizó un estudio descriptivo, de corte transversal, que incluyó a 81 adolescentes de ambos sexos con edades entre 11 y 18 años, pertenecientes a dos consultorios médicos de familia del Grupo Básico de Trabajo No. 2, del Policlínico Universitario "Ana Betancourt", del municipio Playa, en el período comprendido entre enero de 2006 y enero de 2007. Como herramienta de trabajo se utilizó el cuestionario: The International Study of Asthma and Allergies in Childhood, instrumento validado internacionalmente. Resultados: la cifra total de asmáticos ascendió a 52 adolescentes con un discreto predominio del sexo masculino y de los casos ligeros de la enfermedad, para una prevalencia global de 64,1 %. Se encontró un subregistro de 20,9 %. Conclusiones: en ambos consultorios se constata una elevada prevalencia de asma bronquial en la población de adolescentes con mayor afectación en los varones. Los pacientes exhiben mayoritariamente las formas ligeras de la enfermedad. Se encuentra un importante subregistro para el asma bronquial en los adolescentes tratados en el Policlínico Universitario "Ana Betancourt"Introduction: the bronchial asthma is a even defined entity establishing some interpretations of its epidemiology, diagnosis and consequently of its treatment. Objectives: to estimate the global prevalence of asthma in adolescents seen in family medical consulting rooms from "Ana Betancourt" University Polyclinic. Methods: a descriptive, cross-sectional study was conducted including 81 adolescents of both sexes aged between 11 and 18 from family

  1. Complejo parroquial de Santa Ana, en Moratalaz, Madrid

    Directory of Open Access Journals (Sweden)

    Fisac, Miguel

    1967-06-01

    Full Text Available This church is sited at Moratalaz, a modern district of low rent houses in Madrid, and the architect has attempted to represent in the design the liturgical concepts developed in the Vatican II Council. These precise ideas have been expressed in the architecture by means of highly plastic symbols. In addition, the planform is very functional and the reinforced and prestressed concrete have been almost the only material used: so that the construction medium is also in accord with the modern nature of the design. The shapes, the space arrangement and everything which might seem a capricious creation of the artist in fact are the result of a detailed analysis of function and reason.Este complejo parroquial se ha levantado en Moratalaz, que es un barrio popular de la capital de España, procurando imprimir y recoger todas las premisas litúrgicas marcadas por el Concilio Vaticano II. El arquitecto ha plasmado sus precisas ideas en un edificio de gran expresividad plástica y de planta orgánica y eficaz, utilizando, casi exclusivamente, un material de nuestro tiempo: hormigón armado y pretensado. Las formas, la disposición de espacios y todo cuanto puede parecer caprichosa creación del artista, no son, en realidad, sino resultado de un cuidadoso estudio de funcionalismo racional y utilitario.

  2. Pro-ana versus Pro-recovery: A Content Analytic Comparison of Social Media Users' Communication about Eating Disorders on Twitter and Tumblr.

    Science.gov (United States)

    Branley, Dawn B; Covey, Judith

    2017-01-01

    Objectives: To compare how people communicate about eating disorders on two popular social media platforms - Twitter and Tumblr. Materials and Methods: Thematic analysis was conducted to characterize the types of communications posted, and a content analysis was undertaken of between-platform differences. Results: Three types of content (pro-ana, anti-ana, and pro-recovery) were posted on each platform. Overall, across both platforms, extreme pro-ana posts were in the minority compared to anti-ana and pro-recovery. Pro-ana posts (including 'thinspiration') were more common on Twitter than Tumblr, whereas anti-ana and pro-recovery posts were more common on Tumblr. Conclusion: The findings have implications for future research and health care relating to the treatment and prevention of eating disorders. Developers of future interventions targeting negative pro-ana content should remain aware of the need to avoid any detrimental impact on positive online support.

  3. Pro-ana versus Pro-recovery: A Content Analytic Comparison of Social Media Users’ Communication about Eating Disorders on Twitter and Tumblr

    Science.gov (United States)

    Branley, Dawn B.; Covey, Judith

    2017-01-01

    Objectives: To compare how people communicate about eating disorders on two popular social media platforms – Twitter and Tumblr. Materials and Methods: Thematic analysis was conducted to characterize the types of communications posted, and a content analysis was undertaken of between-platform differences. Results: Three types of content (pro-ana, anti-ana, and pro-recovery) were posted on each platform. Overall, across both platforms, extreme pro-ana posts were in the minority compared to anti-ana and pro-recovery. Pro-ana posts (including ‘thinspiration’) were more common on Twitter than Tumblr, whereas anti-ana and pro-recovery posts were more common on Tumblr. Conclusion: The findings have implications for future research and health care relating to the treatment and prevention of eating disorders. Developers of future interventions targeting negative pro-ana content should remain aware of the need to avoid any detrimental impact on positive online support. PMID:28848472

  4. Optofluidics-based DNA structure-competitive aptasensor for rapid on-site detection of lead(II) in an aquatic environment.

    Science.gov (United States)

    Long, Feng; Zhu, Anna; Wang, Hongchen

    2014-11-07

    Lead ions (Pb(2+)), ubiquitous and one of the most toxic metallic pollutants, have attracted increasing attentions because of their various neurotoxic effects. Pb(2+) has been proven to induce a conformational change in G-quadruplex (G4) aptamers to form a stabilizing G4/Pb(2+) complex. Based on this principle, an innovative optofluidics-based DNA structure-competitive aptasensor was developed for Pb(2+) detection in an actual aquatic environment. The proposed sensing system has good characteristics, such as high sensitivity and selectivity, reusability, easy operation, rapidity, robustness, portability, use of a small sample volume, and cost effectiveness. A fluorescence-labeled G4 aptamer was utilized as a molecular probe. A DNA probe, a complementary strand of G4 aptamer, was immobilized onto the sensor surface. When the mixture of Pb(2+) solution and G4 aptamer was introduced into the optofluidic cell, Pb(2+) and the DNA probe bound competitively with the G4 aptamer. A high Pb(2+) concentration reduced the binding of the aptamer and the DNA probe; thus, a low-fluorescence signal was detected. A sensitive sensing response to Pb(2+) in the range of 1.0-300.0 nM with a low detection limit of 0.22 nM was exhibited under optimal conditions. The potential interference of the environmental sample matrix was assessed with spiked samples, and the recovery of Pb(2+) ranged from 80 to 105% with a relative standard deviation value of <8.5%. These observations clearly illustrate that with the use of different DNA or aptamer probes, the sensing strategy presented can be easily extended to the rapid on-site monitoring of other trace analytes. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Portugali saadik : Venemaaga räägime kõigest / Ana Paula Zacarias ; interv. Raimo Poom

    Index Scriptorium Estoniae

    Zacarias, Ana Paula

    2007-01-01

    Euroopa Liidu uue eesistujamaa Portugali suursaadik Eestis Ana Paula Zacarias Euroopa Liidu välispoliitika kujundamise põhimõtetest, suhetest Venemaaga, tööst EL-i põhiseaduslepingut asendava reformilepinguga

  6. Zabbix uzraudzības sistēmas ieviešana un optimizācija

    OpenAIRE

    Smilga, Jānis

    2013-01-01

    Darbā „Zabbix uzraudzības ieviešana un optimizācija” stāstīts par Zabbix pārraudzības rīka ieviešanu Valsts Ieņēmumu Dienesta Infrastruktūras uzturēšanas nodaļā. Darbā dokumentēts esošas Zabbix sistēmas novērtējums, pārraudzības risinājuma ieviešanas plānojums, ieviešanas process. Darba rezultātā, tika realizēta Valsts Ieņēmumu Dienesta infrastruktūras iekārtu uzraudzība. Atslēgas vārdi: Zabbix, pārraudzība, infrastruktūra, Valsts Ieņēmumu Dienests....

  7. Laysan Teal (Anas laysanensis) Microsatellite DNA Data; Laysan Island 1999-2009, Midway Atoll 2007-2010

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The geographically closed, non-migratory populations of endangered Laysan Teal (Anas laysanensis) were sampled in the wild. This species was once widespread across...

  8. An assessment of optical properties of dissolved organic material as quantitative source indicators in the Santa Ana River basin, Southern California

    Science.gov (United States)

    Bergamaschi, Brian A.; Kalve, Erica; Guenther, Larry; Mendez, Gregory O.; Belitz, Kenneth

    2005-01-01

    The ability to rapidly, reliably, and inexpensively characterize sources of dissolved organic material (DOM) in watersheds would allow water management agencies to more quickly identify problems in water sources, and to more efficiently allocate water resources by, for example, permitting real-time identification of high-quality water suitable for ground-water recharge, or poor-quality water in need of mitigation. This study examined the feasibility of using easily measurable intrinsic optical properties' absorbance and fluorescence spectra, as quantitative indicators of DOM sources and, thus, a predictor of water quality. The study focused on the Santa Ana River Basin, in southern California, USA, which comprises an area of dense urban development and an area of intense dairy production. Base flow in the Santa Ana Basin is primarily tertiary treated wastewater discharge. Available hydrologic data indicate that urban and agricultural runoff degrades water quality during storm events by introducing pathogens, nutrients, and other contaminants, including significant amounts of DOM. These conditions provide the basis for evaluating the use of DOM optical properties as a tracer of DOM from different sources. Sample spectra representing four principal DOM sources were identified among all samples collected in 1999 on the basis of basin hydrology, and the distribution of spectral variability within all the sample data. A linear mixing model provided quantitative estimates of relative endmember contribution to sample spectra for monthly, storm, and diurnal samples. The spectral properties of the four sources (endmembers), Pristine Water, Wastewater, Urban Water, and Dairy Water, accounted for 94 percent of the variability in optical properties observed in the study, suggesting that all important DOM sources were represented. The scale and distribution of the residual spectra, that not explained by the endmembers, suggested that the endmember spectra selected did not

  9. Antibodies to Mycobacterium bovis in wild carnivores from Doñana National Park (Spain).

    Science.gov (United States)

    Martín-Atance, P; León-Vizcaíno, L; Palomares, F; Revilla, E; González-Candela, M; Calzada, J; Cubero-Pablo, M J; Delibes, M

    2006-07-01

    We conducted a retrospective serologic survey for antibodies against the MPB70 protein of Mycobacterium bovis in wild carnivores from Doñana National Park (southwestern Spain). Serum samples from 118 red foxes (Vulpes vulpes), 39 Iberian lynx (Lynx pardinus), 31 Eurasian badgers (Meles meles), five Egyptian mongoose (Herpestes ichneumon), four European genet (Genetta genetta), and one Eurasian otter (Lutra lutra) were analyzed using an indirect competitive enzyme-linked immunoassay. Antibodies against the MPB70 protein of M. bovis were detected in seven badgers, five foxes, and one lynx. The frequency of positive animals was significantly higher in badger (23%) than in lynx (3%) and fox (4%). Antibodies were not detected in other species. Annual antibody frequency peaked at 38% in badgers and 11% for red fox. These species may contribute to persistence of bovine tuberculosis in Doñana.

  10. OBJETOS SIMBÓLICOS EN LA NARRATIVA DE ANA MARÍA MATUTE

    OpenAIRE

    Xiaojie Cai (Capital Normal University, Beijin); Ascensión Rivas Hernández (Universidad de Salamanca)

    2013-01-01

    Neste aritigo, está esboçado o simbolismo pessoal que faz Ana Maria Matute em objetos cotidianos e materiais. Através de análise da caracterização que transmitem imagens como a ilha, o boneco, o teatro de bonecos, o fogo, a torre e a pedra azul, está realizada uma sistematização de simbolismo na narrativa de Matute e revela uma faceta fundamental e novel da poética da escritora.PALAVRAS-CHAVE: Ana María Matute, Simbolismo, Metáforas, Alegorias, Objetos Materiais. Resumen  En este artículo se ...

  11. Intellectual Property as a Drive for Sustainable Medical Tourism – The Ana Aslan case

    Directory of Open Access Journals (Sweden)

    Bolos Mihaela Daciana

    2014-11-01

    Full Text Available The present paper studies the way intellectual property rights may encourage sustainable medical tourism, meaning the advantages that a patent, traditional knowledge, a trademark, or other IP right may offer to a hospital in order to attract foreign patients. The analysis is done trough the Institute of Gerontology and Geriatrics “Ana Aslan” case study, seen not from a medical point of view but from the perspective of the intellectual property importance for the development of medical tourism. The Institute of Gerontology and Geriatrics “Ana Aslan” was founded in 1952 and become an international renowned center in the study and the diminishing of old age effects. Many celebrities (artist and state presidents came to receive treatment here, even though Romania had, at that time, a communist regime.

  12. Efficiency strategies in building conservation in natural protected areas. The experience of Doñana

    Directory of Open Access Journals (Sweden)

    José María Rincón Calderón

    2018-01-01

    Full Text Available It is remarkable the amount of buildings that have existed and still exist in Doñana. These constructions, which are very diverse, are examples of the local identity. Some have been lost, but others are in a process of degradation that raises the question of building conservation in a unique natural environment. In this paper, the available information on the current state of the Doñana built heritage is compiled, updated and completed. The geographical distribution structure of the buildings’ locations is also analyzed. This study verifies how these buildings have evolved throughout the park history to the condition we see now, how they have been useful to their inhabitants in this environment, how they have performed their roles of sheltering and protecting men, and how they could face the future using the same strategies they have developed to survive until our day.

  13. Vegāna identitātes iegūšana un pilnveidošana caur ikdienas praksēm

    OpenAIRE

    Gleizde, Indra

    2013-01-01

    Bakalaura darbā „Vegāna identitātes iegūšana un pilnveidošana caur ikdienas praksēm,” tiek apskatīta problēma, ka ētiskā vegānisma principu - nedarīt nekādas darbības, kas varētu būt saistītas ar dzīvnieku ekspluatāciju, - dzīvē pilnībā īstenot ir gandrīz neiespējami, taču neskatoties uz to, Latvijas ētiskie vegāni spēj uzturēt savas identitātes apziņu. Kā galveno teorētisko ietvaru izmantojot Fredrika Bārta etnisko grupu robežu teoriju un Pītera Burka identitātes kontroles teoriju, darbā ...

  14. Experimental infection with low and high pathogenicity H7N3 Chilean avian influenza viruses in Chiloe wigeon (Anas sibilatrix) and cinnamon teal (Anas cyanoptera).

    Science.gov (United States)

    Sá e Silva, Mariana; Mathieu-Benson, Christian; Kwon, Yong-Kuk; Pantin-Jackwood, Mary; Swayne, David E

    2011-09-01

    Two different wild duck species common in Chile and neighboring countries, Chiloe wigeon (Anas sibilatrix) and cinnamon teal (Anas cyanoptera), were intranasally inoculated with 10(6) mean embryo infective dose (EID50) of the H7N3 low pathogenicity (LP) avian influenza virus (AIV) (A/chicken/Chile/176822/02) or high pathogenicity (HP) AIV (A/chicken/Chile/ 184240-1/02), in order to study the infectivity and pathobiology of these viruses. None of the virus-inoculated ducks had clinical signs or died, but most seroconverted by 14 days postinoculation (DPI), indicating a productive virus infection. Both LPAIV and HPAIV were isolated from oral swabs from two of six Chiloe wigeons and from oral and/or cloacal swabs from all five of the cinnamon teal at 2 DPI. Both LPAIV and HPAIV were efficiently transmitted to cinnamon teal contacts but not to Chiloe wigeon contacts. This study demonstrates that the cinnamon teal and Chiloe wigeons were susceptible to infection with both Chilean H7N3 LPAIV and HPAIV, but only the cinnamon teal showed contact transmission of the virus between birds, suggesting that the cinnamon teal has the potential to be a reservoir for these viruses, especially the LPAIV, as was demonstrated in 2001 with isolation of a genetically related H7N3 LPAIV strain in a cinnamon teal in Bolivia. However, the definitive source of the H7N3 Chilean LPAIV still remains unknown.

  15. AnaWEGE: a weather generator based on analogues of atmospheric circulation

    OpenAIRE

    Yiou, P.

    2014-01-01

    This paper presents a stochastic weather generator based on analogues of circulation (AnaWEGE). Analogues of circulation have been a promising paradigm to analyse climate variability and its extremes. The weather generator uses precomputed analogues of sea-level pressure over the North Atlantic. The stochastic rules of the generator constrain the continuity in time of the simulations. The generator then simulates spatially coherent time series of a climate variable, drawn fr...

  16. Complete mitochondrial genome of the Baikal teal Anas formosa (Aves, Anseriformes, Anatidae).

    Science.gov (United States)

    Ryu, Shi Hyun; Hwang, Ui Wook

    2011-08-01

    The Baikal teal Anas formosa (Aves, Anseriformes, Anatidae) is classified as "Vulnerable" on the IUCN Red List. Here, whole mitochondrial genome of A. formosa was amplified and sequenced. The total length of the Baikal teal mitochondrial genome is 16,594 bp, which consists of 13 protein-coding, 2 rRNA, 22 tRNA genes and 1 control region. The characteristics of the mitochondrial genomes were analyzed and discussed in detail.

  17. Reproduktīvās klonēšanas ētiskie aspekti.

    OpenAIRE

    Urbāne, Dārta

    2011-01-01

    Reproduktīvā klonēšana ir viena no jaunākajām zinātnes inovācijām. Klonēšanas būtība ir radīt kādas būtnes ģenētiski identisku indivīdu. Klonēšana ir specifiska reproduktīvā metode, tādēļ tā ir izraisījusi ievērojamu skaitu ētikas jautājumu un radījusi morālās problēmas. Kā sava darba mērķi esmu izvirzījusi noskaidrot, šīs tehnoloģijas specifiku, apzināt tās izraisīto problēmu loku, kā arī izpētīt, kā klonēšanu vērtē citas ar sabiedrību saistītās nozares, piemēram, medicīna un reliģija. V...

  18. Filmu tulkošana : izaicinājums tulkotājam

    OpenAIRE

    Sergejeva, Nataļja

    2007-01-01

    Diplomdarba nosaukums ir „Filmu tulkošana: izaicinājums tulkotājam” un tajā ir aprakstīta filmu tulkošana un dažādas problēmas, ar kuram tulkotājs sastopas, tulkojot filmas. Filma kļuva par vispopulārāko saziņas līdzekļi starp dažādam kultūrām un tulkošana padara filmu saprotamu dažādu kultūru pārstāvjiem. Šajā diplomdarbā autors mēģināja izpētīt ar filmu tulkošanu saistītus jautājumus, lai darbs būtu noderīgs tulkotājiem viņu darbā. Diplomdarba autors sniedza dažādus piemērus ar tulkojumu la...

  19. Recent coastal evolution of the Doñana National Park (SW Spain)

    Science.gov (United States)

    Rodríguez-Ramírez, Antonio; Rodríguez-Vidal, Joaquín; Cáceres, Luis; Clemente, Luis; Belluomini, Giorgio; Manfra, Luigia; Improta, Salvatore; de Andrés, JoséRamon

    Since the last Holocene sea level rise, about 6900 BP, a series of depositional littoral landforms has been generated at the outlet of the Guadalquivir River, with progradation along the predominant longshore drift (towards the east). The first coastal progradation occurred between 6900 and 4500 BP. The Doñana and (perhaps) La Algaida spits, both associated with the oldest and highest marshland in the Doñana National Park, are assumed to have been developed at an early stage. Originally, the Guadalquivir estuary was wider and deeper than now, and its environment was mainly marine. The oldest littoral formations have been dated as ca. 4735 BP. They show erosional events, and indicate the breaking-up of earlier spit-barriers to form inlets. The marine environment became increasingly dominant, with heavy erosion of cliffs and a retreating coastline. This period was followed by another sedimentary cycle (4200-2600 BP) that surrounded the earlier eroded barriers. The size of the estuary decreased due to the increasing marsh deposits, and a fluvial environment was born. About 2600 years ago, progradation gave way to a new period of intense erosion. The resulting morphology of littoral strands and erosional surfaces permitted the return to a marine environment. The shoreline again retreated. From 2300 BP, coastal progradation has prevailed, with an erosional interruption at 1000 BP. The present-day outlet of the Guadalquivir is an estuarine delta of inactive marshland (the Doñana National Park), the dominant environment is fluvial.

  20. Synthesis and catalytic properties of metal clusters encapsulated within small-pore (SOD, GIS, ANA) zeolites.

    Science.gov (United States)

    Goel, Sarika; Wu, Zhijie; Zones, Stacey I; Iglesia, Enrique

    2012-10-24

    The synthesis protocols for encapsulation of metal clusters reported here expand the diversity in catalytic chemistries made possible by the ability of microporous solids to select reactants, transition states, and products on the basis of their molecular size. We report a synthesis strategy for the encapsulation of noble metals and their oxides within SOD (Sodalite, 0.28 nm × 0.28 nm), GIS (Gismondine, 0.45 nm × 0.31 nm), and ANA (Analcime, 0.42 nm × 0.16 nm) zeolites. Encapsulation was achieved via direct hydrothermal synthesis for SOD and GIS using metal precursors stabilized by ammonia or organic amine ligands, which prevent their decomposition or precipitation as colloidal hydroxides at the conditions of hydrothermal synthesis (12), thereby causing precipitation of even ligand-stabilized metal precursors as hydroxides. As a result, encapsulation was achieved by the recrystallization of metal clusters containing GIS into ANA, which retained these metal clusters within voids throughout the GIS-ANA transformation.

  1. The Reliability of a Novel Automated System for ANA Immunofluorescence Analysis in Daily Clinical Practice

    Directory of Open Access Journals (Sweden)

    Mohammed Alsuwaidi

    2016-01-01

    Full Text Available Automated interpretation (AI systems for antinuclear antibody (ANA analysis have been introduced based on assessment of indirect immunofluorescence (IIF patterns. The diagnostic performance of a novel automated IIF reading system was compared with visual interpretation (VI of IIF in daily clinical practice to evaluate the reduction of workload. ANA-IIF tests of consecutive serum samples from patients with suspected connective tissue disease were carried out using HEp-2 cells according to routine clinical care. AI was performed using a visual analyser (Zenit G-Sight, Menarini, Germany. Agreement rates between ANA results by AI and VI were calculated. Of the 336 samples investigated, VI yielded 205 (61% negative, 42 (13% ambiguous, and 89 (26% positive results, whereas 82 (24% were determined to be negative, 176 (52% ambiguous, and 78 (24% positive by AI. AI displayed a diagnostic accuracy of 175/336 samples (52% with a kappa coefficient of 0.34 compared to VI being the gold standard. Solely relying on AI, with VI only performed for all ambiguous samples by AI, would have missed 1 of 89 (1% positive results by VI and misclassified 2 of 205 (1% negative results by VI as positive. The use of AI in daily clinical practice resulted only in a moderate reduction of the VI workload (82 of 336 samples: 24%.

  2. A rapid and efficient method for quantitation of genogroups I and II norovirus from oysters and application in other complex environmental samples.

    Science.gov (United States)

    Gentry, Jennifer; Vinjé, Jan; Lipp, Erin K

    2009-03-01

    The human health risk associated with the consumption of molluscan shellfish grown in sewage-contaminated waters is well established. Noroviruses are the principal agent of shellfish-related illness. This study describes the evaluation of two silica-based viral RNA extraction protocols as well as two real time RT-PCR assays for norovirus detection in shellfish and plankton. Using a GII RNA transcript, the Qiagen RNeasy method was able to recover 80%, 1.85%, and 0.14% of the RNA copies in seeded oyster, small plankton (63-200microm), and large plankton (>200microm) samples, respectively, whereas a silica-bead based method was able to recover only 0.175%, 0.0044%, and 0.0006% in the same seeded samples. The detection limit of two published TaqMan RT-PCR assays (A and B) evaluated with RNA run-off transcripts established RT-PCR assay A was more sensitive for detecting low copies of GI.3 RNA whereas RT-PCR assay B was more sensitive for detecting GI.4 and GII.4; however, only assay A was able to detect GI and GII in naturally contaminated shellfish whereas only assay B was able to detect GI and GII in naturally contaminated plankton. The combination of a rapid RNA extraction method followed by both TaqMan RT-PCR assays offers significant advantages for development of routine assays for norovirus detection in bivalve shellfish and shows promise for detection in other high inhibitor environmental sources, such as plankton.

  3. Los rostros de Ana: Tres comentarios sobre Darío Morales

    Directory of Open Access Journals (Sweden)

    Paul Marcelo Velázquez Sabogal

    2016-03-01

    Full Text Available El presente escrito es una aproximación a la obra del artista colombiano Darío Morales desde la perspectiva dialéctica “vida-muerte”, alentada por el acontecimiento de lo ambiguo y sus implicaciones en la deconstrucción de una corporeidad estable regida por parámetros sociales, jurídicos y biológicos que desembocan en la caracterización de un “otro” en el cual se encuentran figuras como el anormal, el incorregible, el monstruo. Desde ellos pretendo trazar un punto de vista sobre aquellos Rostros de Ana donde se manifiestan figuras como el onanista y la vampira, para desembocar en un comentario que amplíe el espectro de sentido alrededor la obra del artista cartagenero. Palabras claves Cuerpo ambiguo, vida-muerte, sagrado-profano, onanismo. Ñawekuna kai warmi Ana Sutipa: Kimsa pariai ksi runa Dario Morales Sugllapi Kai kilkai kame ñalla regcha kai tacha runa colombiano Dario Morales Kilkakasina rimangapa “ kausai- wamui” aida chingapa kaikuna Mana allilla llugsichu tukuikunamanda icharichu llanga “sug manda” Kaipe turrerreme ¡ kauancheme man aillakaska, man allilla rurasla! Kirú. Kaipi pudenchi kauanga imasami kauacheca kai warme Ana paipa ñawekuna Kai ruraikuna sutikame onanista Chasallata vampira, Kaiwa munakume Allilla intendechengapa imasame parlaku sug iacha Cartagenero. Ima suti Rimai Simi: Cuerpo ambiguo, kaugsai, muerte, sagrado - profano, onanismo. The Faces of Ana: Three Comments on Dario Morales Abstract This paper is an approach to the work of Colombian artist Dario Morales from the perspective of the dialectic of “life and death”, encouraged by the occurrence of the ambiguous and its implications for the deconstruction of a stable corporeality governed by social, legal and biological parameters that lead to the characterization of an “other”, in which figures such as the abnormal, the incorrigible, the monster are to be found. From them, I intend to plot a point of view on those faces of Ana

  4. Cervantes y Felipe II

    Directory of Open Access Journals (Sweden)

    Ludovik Osterc

    1999-12-01

    Full Text Available Como es sabido, el 13 de septiembre de 1598, a las cinco de la mañana, falleció en el Escorial el Rey Felipe II. Sevilla que según sus historiadores siempre se distinguió entre todas las ciudades de España por el fausto y suntuosidad de los sucesos solemnes, ya sea cuando los monarcas se dignaban visitarla, ya sea cuando se trataba de honrar su memoria con ocasión de su muerte, se habia excedido a si misma en el reinado de Felipe II. La pública y señorial entrada de su padre, el emperador Carlos V cuando en 1526 vino a esta ciudad para realizar sus bodas con la Infanta Isabel de Portugal, que por su magnificencia consignan sus anales, como superior a cuantas hubo antes en análogas circunstancias, no puede compararse con el recibimiento dispensado a Felipe II, el año de 1570, que por encargo de su Cabildo describió la docta pluma de Mal Lara.

  5. Pro-ana versus Pro-recovery: A Content Analytic Comparison of Social Media Users’ Communication about Eating Disorders on Twitter and Tumblr

    OpenAIRE

    Dawn B. Branley; Judith Covey

    2017-01-01

    Objectives: To compare how people communicate about eating disorders on two popular social media platforms – Twitter and Tumblr. Materials and Methods: Thematic analysis was conducted to characterize the types of communications posted, and a content analysis was undertaken of between-platform differences. Results: Three types of content (pro-ana, anti-ana, and pro-recovery) were posted on each platform. Overall, across both platforms, extreme pro-ana posts were in the minority compared ...

  6. Analysis and Experimentation on Ecosystems (AnaEE): a new research distributed infrastructure to tackle ecosystem complexity.

    Science.gov (United States)

    Chabbi, Abad; Roy, Jacques; Beier, Claus; Miglietta, Franco

    2013-04-01

    Terrestrial ecosystems represent a critical zone that provide key ecological services to human populations in the form of food, fibre and energy climate protection or nutrient recycling, to name a few. In this critical zone, human activities are directly or indirectly generating major environmental pressures, such as pollution, global warming, and the destruction and alteration of natural habitats. Altogether, these global changes result in a rapid erosion of biodiversity and a major perturbation of ecological systems and services. It is therefore vital to understand how ecological systems respond and adapt to such pressures and perturbations and to test sustainable land use and innovative green technologies in order to address societal challenges. Today, a major focus in ecological and agricultural sciences is on the production of quantitative, experimentally reproducible and testable approaches using advances in our ability to characterize complex ecological systems from genes to ecosystem levels. The need for experimental approaches that require sophisticated equipment and instruments, technological advances, and strong theoretical foundation through conceptualization and modelling of ecosystem functioning is addressed by a new ESFRI FP7 distributed research infrastructures called AnaEE (Analysis and Experimentation on Ecosystems). Such approaches are the mechanistic bases of adaptation and impacts on eco- and agrosystem functioning to be deciphered. ANAEE is setting up and offers a distributed infrastructure of open-access platforms providing facilities to conduct experiments and analyse and model complex ecological systems. ANAEE through its integrated and experimental approach to ecosystem functioning will provide a quantum leap in the quality and availability of data and projections on continental ecosystems responses to global changes and to management, enabling policy makers and stakeholders to sustainably manage ecosystem services for all citizens.

  7. Avocado fruit quality with applications of ANA, boron, nitrogen, saccharose and girdling

    Directory of Open Access Journals (Sweden)

    Joaquín Guillermo Ramírez Gil

    2017-09-01

    Full Text Available The objective of this study was to evaluate the effect of foliar application of products for fruit set, production and quality of Hass avocado. This research was performed in a terrain that is located in a moderately cold weather, in Antioquia, Colombia. Factors for inducing flowering, types of inflorescence and production alternation were determined. In addition to the aforementioned, simple and combined foliar application of acid 1–naphthaleneacetic (ANA, boron, nitrogen, saccharose as source energy, and girding branches, was performed. For the experiment we used a complete block experimental design, with five replicates per treatment and a single tree as experimental unit, with three evaluations over time (2010, 2011 and 2012. The variables evaluated were initial and final fruit set, quantity, and quality of produced fruit. Results associated with this study indicate that floral induction in this variety occurs in periods of low rainfall and low temperatures, the inflorescences were mostly of an indeterminate type, and a slight alternation of production occurred. Initial fruit and final set increased with girdling branches and with the application of boron and girdling branches in 28% and 33% respectively, but this treatments did not improve the production, instead the production was favored by adding saccharose alone, and in combination with boron, nitrogen and ANA, it presented increments of 14,5, 15.9, 14.9 and 14.4% respectively. Results indicate that the addition of an individual external energy source combined with the foliar application of boron, nitrogen and ANA, improves the quality and quantity of fruit in the Hass avocado.

  8. ANA-Negative Presentation of SLE in Man with Severe Autoimmune Neutropenia

    Directory of Open Access Journals (Sweden)

    Melissa Zhao

    2016-01-01

    Full Text Available Background. Systemic lupus erythematosus (SLE is a chronic, inflammatory, connective tissue disease that commonly affects the joints and a variety of organs due to an overactivation of the body’s immune system. There is wide heterogeneity in presentation of SLE patients, including lung, central nervous system, skin, kidney, and hematologic manifestations. Case Presentation. We report a case of atypical manifestation of SLE in a 53-year-old man who presented with neutropenic fever. Physical findings of interest included oral ulcers on the lower lip, a malar-like rash across the bridge of the nose, and a discoid-like rash on extensor surfaces of the elbows and knees. Labs include ANC <100, weakly positive anti-dsDNA, negative ANA, ferritin 1237 ng/mL, low C3/C4, and positive direct Coombs’ test. A thorough workup for infection and hematologic malignancy was negative. Two days after initiation of therapy with 25 mg IV solumedrol twice a day, the patient’s daily fevers resolved. ANC drastically improved to 2000 after two weeks of steroid treatment. He was later found to have a high titer of anti-neutrophil antibodies. Discussion. Autoimmune leukopenia is a common presentation in SLE, occurring in 50–60% of patients. Severe autoimmune neutropenia is uncommon and may correlate with high anti-neutrophil antibody activity despite a negative ANA. As neutropenia is usually mild, there are currently no guidelines for therapy. For our patient, we started him on low dose IV solumedrol and found that he responded drastically to treatment. Given strongly positive nonspecific anti-neutrophil antibodies in the setting of a negative ANA noted in our patient, it is likely that there are other currently unknown antibodies associated with SLE which may correlate strongly with autoimmune neutropenia.

  9. Dynamics of a thermo-Mediterranean coastal environment the Coto Doñana National Park

    Science.gov (United States)

    Finlayson, Geraldine; Finlayson, Clive; Espejo, J. M. Recio

    2008-11-01

    Using data collected from existing habitats found in the southwestern Iberian Peninsula, and including data collected in the Biological Reserve of the Parque Nacional de Doñana, Spain, this study considers the seasonal and inter-annual variability of a thermo-Mediterranean, subhumid, environment and the significance of the presence of surface water in the system. This extant environment is then used together with the fossil record from Gorham's Cave in Gibraltar, where Neanderthals lived, as a proxy for the ecology of the emerged landscape outside the cave.

  10. Experimental reintroduction reveals novel life-history variation in Laysan Ducks (Anas laysanensis)

    Science.gov (United States)

    Walters, Jeffrey R.; Reynolds, Michelle H.

    2013-01-01

    Subfossil remains indicate that the Laysan Duck (Anas laysanensis) formerly occurred throughout the Hawaiian archipelago, but for more than 150 years it has been confined to a single, small atoll in the northwestern chain, Laysan Island. In 2004–2005, 42 ducks were reintroduced from Laysan to Midway Atoll, where they exhibited variation in life history never observed on Laysan. On Laysan, females have never been observed to breed successfully at age 1 year and few attempt it, whereas on Midway, females routinely raised young at reintroductions of this species may provide opportunities to test hypotheses about mechanisms underlying phenotypic plasticity.

  11. Gregarismo de la Perdiz Roja (Alectoris rufa) en Doñana

    OpenAIRE

    Braza, Francisco; Álvarez, Fernando; Pintos, Rosario

    1985-01-01

    La Perdiz Roja en Doñana se organiza en parejas durante la segunda mitad del invierno y casi toda la primavera; a continuación, y aproximadamente por un mes, se observan bandos con pollos y durante casi todo el verano, otoño y primera mitad del invierno se agrupa en bandos sin pollos. La representación adulta en los bandos con pollos y el tamaño medio de los bandos sin pollos presentan valores con escasa variación. La intensa sequía del invierno de 1980-81 tuvo al parecer gran influencia, ret...

  12. Los santuarios de So na Caçana: propuesta de revalorización patrimonial

    OpenAIRE

    Zotes Flores, Luis

    2015-01-01

    En este texto se presentan los planteamientos teóricos propuestos por TANYT Asociación Cultural para el desarrollo de un correcto Programa de Gestión Patrimonial válido para el lugar de So na Caçana (Alayor, Menorca). Desde un primer momento nos planteamos poner este yacimiento arqueológico a disposición de la sociedad comprobando la respuesta del público ante las actuaciones emprendidas, iniciando el trabajo conducente a su Revalorización Patrimonial e intentando crear un espacio científico ...

  13. Early imprinting in wild and game-farm mallards (Anas platyrhynchos): genotype and arousal

    Science.gov (United States)

    Cheng, K.M.; Shoffner, R.N.; Phillips, R.E.; Shapiro, L.J.

    1979-01-01

    Early imprinting was studied under laboratory conditions in five lines of mallards (Anas platyrhynchos) with different degrees of wildness obtained through pedigreed breeding. Data were analyzed by the least squares method. Wild ducklings imprinted better than game-farm (domesticated) ducklings, and heterosis was demonstrated to exist in imprinting traits. Nonadditive genetic variations and genotype-environmental interactions are discussed as possible causes for the heterosis observed. Differences in imprinting between genetic lines are attributed, at least partly, to differences in arousal level during the ducklings' first exposure to the imprinting stimulus.

  14. Muzeja IT infrastruktūras modernizēšana

    OpenAIRE

    Liparts, Arnis

    2014-01-01

    Kvalifikācijas darba nosaukums ir „Muzeja IT infrastruktūras modernizācija”. Darbā tiek aprakstīts kā tika modernizēts jau esošs un salīdzinoši sarežģīts datoru tīkls. Darbā lielā mērā tika izmantoti Mikrotik maršrutētāji IT infrastruktūras modernizācijai. Atslēgas vārdi : Karstvieta, automatizēšana, Mikrotik, IT

  15. Hermenéutica de los derechos humanos en la obra de Ana Luisa Guerrero

    Directory of Open Access Journals (Sweden)

    Orlando Inocencio Aguirre Martínez

    2015-06-01

    Full Text Available La obra de Ana Luisa Guerrero se caracteriza por su abordaje filosófico-político sobre los derechos humanos y su aplicación. Su hermenéutica intercultural, dirigida, principalmente, a los derechos humanos de tercera generación, identifica el componente de la intersubjetividad que encamina hacia la construcción de un diálogo intercultural. Este componente permite, además, discutir sobre los fundamentos de los derechos humanos colocando las percepciones individuales y colectivas del paradigma.

  16. Hermenéutica de los derechos humanos en la obra de Ana Luisa Guerrero

    OpenAIRE

    Orlando Inocencio Aguirre Martínez

    2015-01-01

    La obra de Ana Luisa Guerrero se caracteriza por su abordaje filosófico-político sobre los derechos humanos y su aplicación. Su hermenéutica intercultural, dirigida, principalmente, a los derechos humanos de tercera generación, identifica el componente de la intersubjetividad que encamina hacia la construcción de un diálogo intercultural. Este componente permite, además, discutir sobre los fundamentos de los derechos humanos colocando las percepciones individuales y colectivas del paradigma. ...

  17. Gale Digital Collections: Ray Abruzzi Interviewed by Luisa Calè and Ana Parejo Vadillo

    Directory of Open Access Journals (Sweden)

    Ray Abruzzi

    2015-12-01

    Full Text Available This interview addresses the commercial dimensions of the nineteenth-century digital archive. Luisa Calè and Ana Parejo Vadillo ask Ray Abruzzi, Vice President and Publisher for 'Gale Digital Collections' at Gale, about the company’s origins, its commercial approach to digital collections, and the challenges of digitization. In the context of the open access movement, the architecture of participation, and crowdsourcing, Abruzzi discusses how the company works with academic partners and interfaces with other digital libraries and platforms.

  18. Representações da sexualidade na obra de Ana Saldanha

    OpenAIRE

    Fonseca, Ana Daniela Tavares da

    2012-01-01

    A presente dissertação analisa as diferentes representações da sexualidade na obra literária para jovens de Ana Saldanha. A leitura analítica incide sobre as narrativas da autora que abordam a temática da sexualidade juvenil e as suas problemáticas, com o objetivo de estudar a forma como as mesmas contribuem para a construção da identidade pessoal e sexual do potencial recetor juvenil. Desta forma, pretende-se detetar os conflitos psicológicos dos protagonistas, os seus valores e problemas, a...

  19. La hidrofobia en los suelos arenosos del parque natural de Doñana

    OpenAIRE

    Moral, Francisco Jesús; Laguna Luna, Ana María; Giráldez Cervera, Juan Vicente

    2002-01-01

    La hidrofobia, o repelencia al agua que se manifiesta en algunos suelos, dificulta la infiltración del agua, y, consecuentemente, el establecimiento de vegetación. Como la repelencia aparece en zonas aisladas se favorecen los flujos preferenciales en su contorno. En este trabajo se muestran algunas características hidrofóbicas detectadas en los suelos arenosos del cordón dunar del litoral atlántico próximo al Parque Nacional de Doñana, analizando su origen y extensión en las áreas analizadas....

  20. Specializētu maršrutētajiem paredzētu Linux distributīvu pētīšana un to ieviešana mazā datortīklā

    OpenAIRE

    Andrejevs, Jevgenijs

    2010-01-01

    Kvalifikācijas darba „Specializētu maršrutētājiem paredzētu Linux distributīvu pētīšana un to ieviešana mazā datortīklā”, galvenais mērķis ir izstrādāt maza mājas datortīkla modernizēšanas risinājumu, izmantojot brīvi pieejamus produktus. Darba gaitā tas arī bija izdarīts, izveidotais risinājums bāzējas uz specializēta Linux distributīva, vārtejas lomā, tam papildus pievienoti vel dažādas funkcionalitātes, kuri tika pieprasīti no lietotāju puses.

  1. LDAP un Samba risinājuma ieviešana uzņēmumā

    OpenAIRE

    Logina, Baiba

    2012-01-01

    Kvalifikācijas darba "LDAP un Samba risinājuma ieviešana uzņēmumā" galvenais mērķis ir izveidot risinājumu vairāku uzņēmumu grupas datortīkla vienotās autentificēšanās un koplietošanas resursu sistēmas modernizēšanai. Darbā tiek aprakstīta dotā risinājuma ieviešanas gaita, kas ietver Samba servera konfigurēšanu, LDAP autentifikācijas sistēmas uzstādīšanu, automatizētu tīkla resursu pievienošanu darba videi un vienotu pielaides tiesību sistēmu dokumentiem. Rezultātā tika sastādīta instrukcija ...

  2. Projekts: SIA Ģimenes centrs" dibināšana

    OpenAIRE

    Mensaha, Elizabete

    2016-01-01

    Maģistra darba tēma ir projekts SIA „Ģimenes centrs” dibināšana. Ikviena cilvēka dzīvē ģimene ir pati svarīgākā. Ģimenē veidojas galvenie uzskati par to, kas ir labi vai slikti, pareizi vai nepareizi, godīgi vai negodīgi. Bērni, kuri jau no bērnības dzīvo labvēlīgās ģimenēs, zina, kā veidot labas attiecības savā un savu bērnu ģimenē, zina, kā pārvarēt sadzīviskas vai ikdienišķas problēmas, kuras bieži kļūst par ģimenes šķiršanās iemesliem. Laulības šķiršana ir viena no aktuālākajām mūsdienas ...

  3. D-penicillamine-induced ANA (+) ANCA (+) vasculitis in pediatric patients with Wilson's disease.

    Science.gov (United States)

    Lee, Yeonhee; Lee, Sang Taek; Cho, Heeyeon

    2016-05-01

    Anti-neutrophil cytoplasmic antibodies (ANCA) are associated with systemic vasculitis. The pathophysiology of ANCA-associated vasculitis (AAV) has not been clearly proven, and drug-induced ANCA-associated vasculitis has been reported. Wilson's disease is an inborn error of copper metabolism caused by a mutation in the copper transporting gene ATP7B, and traditional treatment is based on copper chelation with agents such as D-penicillamine. There have been rare reports that prolonged D-penicillamine therapy might cause adverse renal events such as membranous nephropathy and minimal change disease, but it is questionable if D-penicillamine induces ANCA-associated vasculitis. We describe 2 patients with Wilson's disease treated with D-penicillamine who presented with ANCA (+) vasculitis and renal involvement. The 2 patients also showed positive results for antinuclear antibody (ANA). Their kidney biopsy findings were compatible with crescentic/necrotizing glomerulonephritis, pauci-immune type. After diagnosis of AAV, D-penicillamine was stopped. Patients were then treated with plasmapheresis and immunosuppressants, including methylprednisolone pulse therapy and intravenous cyclophosphamide. One patient progressed to end-stage renal disease and the other showed persistent proteinuria. These cases suggest that D-penicillamine may induce ANA (+) ANCA (+) vasculitis with severe renal involvement in pediatric patients, and plasmapheresis combined with immunosuppressant should be considered.

  4. Os blogs pró-Ana e a experiência da anorexia no sexo masculino

    Directory of Open Access Journals (Sweden)

    Thamires Citadini de Almeida

    2015-09-01

    Full Text Available Este artigo analisa os blogs pró-anorexia, ou blogs pró-ana, produzidos por indivíduos do sexo masculino, para entender o comportamento anoréxico masculino e o espaço que os blogs ocupam na vida desses sujeitos. Nosso objetivo foi explorar elementos relacionados com a cultura de magreza disponível nos blogs, tendo em vista analisar a questão da anorexia em homens, bem como compreender como os mesmos vivenciam essa experiência. Trata-se de pesquisa qualitativa, realizada em blogs brasileiros e estrangeiros cujos autores das páginas eram homens. Os resultados sugerem que essa população faz da internet uma rede de apoio, com características de ajuda mútua e de produção de autonomia. Por meio dos blogs, os homens discutem alternativas para ludibriar a família e socializam estratégias entre os pares para atingir o objetivo da manutenção do baixo peso. Percebemos que os profissionais da saúde devem prestar atenção para esta "rede informal" de apoio mútuo, uma vez que os blogs pró-ana têm contribuído para a promoção do comportamento anoréxico no sexo masculino.

  5. Kreditēšanas tirgus attīstības tendences Latvijā

    OpenAIRE

    Kuzmenko, Ilona

    2007-01-01

    Pašreizēja situācija Latvijā liecina par to, ka mainoties jebkuram no labvēlīgajiem apstākļiem, kas šobrīd valda kreditēšanas tirgū (vēsturiski zemākās aizdevumu procentu likmes, augošas nekustama īpašuma cenas, mājokļu deficīts un augsts pieprasījums pēc tiem), var izraisīties krīze nekustama īpašuma tirgū, kas var nopietni apdraudēt banku sistēmas stabilitāti valstī. Bakalaura darba mērķis ir izpētīt kreditēšanas tirgus attīstības tendences un sniegt priekšlikumus kredītresursu tirgus ...

  6. GAMBARAN PROFIL DARAH ITIK PEKING (ANAS PLATYRHYNCHOS SETELAH DIBERIKAN EKSTRAK AKUADES DAUN KEDONDONG PAGAR (LANNEA COROMANDELICA

    Directory of Open Access Journals (Sweden)

    Safrida Safrida

    2017-10-01

    Full Text Available ABSTRACTThis study was designed to determine the effect aqueous extract of Lannea coromandelica leaf at concentrations of erythrocytes and leukocytes in peking duck (Anas platyrhynchos. Experimental design used was Completely Randomized Design (CRD consisted of 3 experimental treatments, each consisted of 8 ducks i.e., P0 (control, P1 (given aqueous extract of Lannea coromandelica leaf as much as 780 mg / mL / day / kg body weight, P2 (given aqueous extract of Lannea coromandelica leaf as much as 1560 mg / mL / day / kg body weight. Data were analyzed using analysis of variance (ANOVA. The results showed that the aqueous extract of Lannea coromandelica significant effect (p <0.01 in concentrations of erythrocytes peking duck, but had no effect (P>  0.01 in concentrations of the leukocytes. Average erythrocytes in all treatments, 2081667-2300000 per mm 3. The average number of leukocytes in all treatments, 23175-23500 per mm3. It was concluded that the aqueous extract of Lannea coromandelica leaf have effect on the increase concentrations of erythrocytes peking duck (Anas platyrhynchos.

  7. Estrella de la mañana de Jacobo Fijman: poesía y apocalipsis

    Directory of Open Access Journals (Sweden)

    Naomi Lindstrom

    2016-03-01

    Full Text Available Este estudio se propone una lectura de la poesía ostensiblemente católica del poeta judeoargentino Jacobo Fijman (1898-1970 en su Estrella de la mañana (1931 como un ejemplo modernizado, ecléctico e idiosincrásico del género apocalíptico. A pesar de la fuerte intertextualidad con el Libro de Revelación, la característica que más diferencia los poemas de Estrella del discurso apocalíptico tradicional, y en efecto de la expresión visionaria o mística en general, es la autocaracterización del sujeto hablante como una entidad dotada de atributos divinos. This study proposes a reading of the ostensibly Catholic poetry of the Jewish Argentine poet Jacobo Fijman (1898-1970 in his Estrella de la mañana (1931 as a modernized, eclectic, and idiosyncratic example of the apocalyptic genre. Despite the strong intertextuality with the book of Revelation, the feature that mostly sets the poems of Estrella apart from traditional apocalyptic discourse, and indeed from visionary or mystical expression in general, is the self-characterization of the speaking subject as an entity endowed with divine attributes.

  8. Jaunas darba stacijas uzstādīšana un konfigurācija.

    OpenAIRE

    Linge, Edgars

    2010-01-01

    Kvalifikācijas darbā „Jaunas darbstacijas uzstādīšana un konfigurācija” tiek izpētītas galvenās datorsistēmu un datortīklu administrēšanas problēmas, ar kurām bija iespēja sastapties studiju prakses laikā. Darbā minētās un pētītās problēmas vairāk saistītas ar maziem vai nelieliem uzņēmumiem. Darba teorētiskajā daļā tiek izklāstītas galvenās problēmas, ar kurām bija iespēja sastapties studiju prakses laikā. Tiek apskatīta teorētiskā informācija par Microsoft Windows XP Professional, v...

  9. Integration of Long term experiments on terrestrial ecosystem in AnaEE-France Research Infrastructure : concept and adding value

    Science.gov (United States)

    Chanzy, André; Chabbi, Abad; Houot, Sabine; Lafolie, François; Pichot, Christian; Raynal, Hélène; Saint-André, Laurent; Clobert, Jean; Greiveldinger, Lucile

    2015-04-01

    Continental ecosystems represent a critical zone that provide key ecological services to human populations like biomass production, that participate to the regulation of the global biogeochemical cycles and contribute and contribute to the maintenance of air and water quality. Global changes effects on continental ecosystems are likely to impact the fate of humanity, which is thus facing numerous challenges, such as an increasing demand for food and energy, competition for land and water use, or rapid climate warming. Hence, scientific progress in our understanding of the continental critical zone will come from studies that address how biotic and abiotic processes react to global changes. Long term experiments are required to take into account ecosystem inertia and feedback loops and to characterize trends and threshold in ecosystem dynamics. In France, 20 long-term experiments on terrestrial ecosystems are gathered within a single Research Infrastructure: ANAEE-France (http://www.anaee-s.fr), which is a part of AnaEE-Europe (http://www.anaee.com/). Each experiment consist in applying differentiated pressures on different plot over a long period (>20 years) representative of a range of management options. The originality of such infrastructure is a combination of experimental set up and long-term monitoring of simultaneous measurements of key ecosystem variables and parameters through a multi-disciplinary approach and replications of each treatment that improve the statistical strength of the results. The sites encompass gradients of climate conditions, ecosystem complexity and/or management, and can be used for calibration/validation of ecosystem functioning models as well as for the design of ecosystem management strategies. Gathering those experiments in a single research infrastructure is an important issue to enhance their visibility and increase the number of hosting scientific team by offering a range of services. These are: • Access to the ongoing long

  10. Efeitos transversais da expansão rápida da maxila em pacientes com má oclusão de Classe II: avaliação por Tomografia Computadorizada Cone-Beam Transverse effects of rapid maxillary expansion in Class II malocclusion patients: a Cone-Beam Computed Tomography study

    Directory of Open Access Journals (Sweden)

    Carolina Baratieri

    2010-10-01

    Full Text Available OBJETIVO: avaliar por meio de Tomografia Computadorizada Cone-Beam (TCCB os efeitos transversais, imediatos e após o período de contenção, da expansão rápida da maxila (ERM em pacientes com má oclusão de Classe II. MÉTODOS: dezessete crianças (idade inicial média de 10,36 anos com má oclusão de Classe II e deficiência transversal esquelética da maxila foram submetidas ao protocolo de ERM com aparelho expansor de Haas. TCCBs foram realizadas antes dos procedimentos clínicos (T1, imediatamente após a estabilização do parafuso expansor (T2 e após completados 6 meses de contenção e removido o aparelho (T3. Com o software Dolphin, foram possíveis a manipulação das imagens e as mensurações. O teste t de Student pareado foi utilizado para identificar significância estatística (pOBJECTIVE: The aim of this study was to evaluate by Cone-Beam Computed Tomography (CBCT transversal responses, immediately and after the retention period, to rapid maxillary expansion (RME, in Class II malocclusion patients. METHODS: Seventeen children (mean initial age of 10.36 years, with Class II malocclusion and skeletal constricted maxilla, underwent Haas´ protocol for RME. CBCT scans were taken before treatment (T1, at the end of the active expansion phase (T2 and after the retention period of six months (T3. The scans were managed in Dolphin software, where landmarks were marked and measured, on a coronal slice passing through the upper first molar. The paired Student´s t-test was used to identify significant differences (p<0.05 between T2 and T1, T3 and T2, and T3 and T1. RESULTS: Immediately after RME, the mean increase in maxillary basal, alveolar and dental width was 1.95 mm, 4.30 mm and 6.89 mm, respectively. This was accompanied by buccal inclination of the right (7.31° and left (6.46° first molars. At the end of the retention period, the entire transverse dimension increased was maintained and the dentoalveolar inclination resumed

  11. Comportamiento de la sexualidad en ancianos del Policlínico "Ana Betancourt" Behavior of sexuality among the elderly in "Ana Betancourt" Polyclinic"

    Directory of Open Access Journals (Sweden)

    Víctor T Pérez Martínez

    2008-06-01

    Full Text Available Se realizó un estudio descriptivo y longitudinal en 125 sujetos en edad geriátrica, de ambos sexos, que asistieron a las consultas de psicogeriatría y/o disfunción sexual del Policlínico Docente "Ana Betancourt" durante el pasado año, con el propósito de definir el patrón sexual característico de las personas en edad geriátrica. Predominaron, en ambos sexos, los ancianos con vínculo conyugal. El 75 % de los ancianos mantienen el interés por el sexo y manifestaron deseo sexual, mientras que el 69,6 % realiza el acto sexual. El coito vaginal, seguido del sexo oral, fueron las formas de actividad sexual preferidas por ambos sexos. La pérdida de la erección en el hombre, y la disminución de la lubricación vaginal en la mujer, fueron los principales trastornos del funcionamiento sexual. El 78,4 % de los ancianos exhibió un bajo índice general de conocimiento sobre los cambios que ocurren en la sexualidad con el transcurso de los años.125 subjects at geriatric age of both sexes that visited the outpatient departments of psychogeriatrics and/or sexual dysfunction of "Ana Betancourt" Teaching Policlinic the last year were included in a descriptive and longitudinal study aimed at defining the sexual pattern characteristic of the persons at geriatric age. The married elderly predominated in both sexes. 75 % of the aged were interested in sex and manifested sexual desire, whereas 69.6 % have sexual relations. Vaginal coitus followed by oral sex were the forms of sexual activity preferred by both sexes. The loss of erection in men and the reduction of vaginal lubrication in women were the main disorders of sexual functioning. 78.4 % of the elderly showed a low general index of knowledge about the changes occurring in sexuality along the years.

  12. Preparation of Palladium(II) Ion-Imprinted Polymeric Nanospheres and Its Removal of Palladium(II) from Aqueous Solution

    Science.gov (United States)

    Tao, Hu-Chun; Gu, Yi-Han; Liu, Wei; Huang, Shuai-Bin; Cheng, Ling; Zhang, Li-Juan; Zhu, Li-Li; Wang, Yong

    2017-11-01

    Three kinds of functional monomers, 4-vinylpridine(4-VP), 2-(allylthio)nicotinic acid(ANA), and 2-Acetamidoacrylic acid(AAA), were used to synthetize palladium(II) ion-imprinted polymeric nanospheres (Pd(II) IIPs) via precipitation-polymerization method in order to study the effects of different functional monomers on the adsorption properties of ion-imprinted materials. The results of UV spectra in order to study the interaction between template ion PdCl4 2- and functional monomers showed that there were great differences in structure after the template reacted with three functional monomers, 4-VP and ANA caused a large structural change, while AAA basically did not change. Further results on the adsorption performance of Pd(II) IIPs on Pd(II) confirmed 4-VP was the most promising candidate for the synthesis of Pd(II) IIPs with an adsorption capacity of 5.042 mg/g as compared with ANA and AAA. The influence of operating parameters on Pd(II) IIP's performance on Pd(II) adsorption was investigated. There was an increase in the adsorption capacity of Pd(II) IIPs at higher pH, temperature, and initial concentration of Pd(II). The results of multi-metal competitive adsorption experiments showed that Pd(II) IIPs had selectivity for Pd(II). An adsorption equilibrium could be reached at 180 min. Kinetic analysis showed that the adsorption test data fitted best to the pseudo-second order kinetic model, and the theoretical equilibrium adsorption capacity was about 5.085 mg/g. The adsorption isotherms of Pd(II) by Pd(II) IIPs agreed well with the Freundlich equation, suggesting a favorable adsorption reaction under optimal conditions. These results showed that Pd(II) IIPs have potential application in the removal of Pd(II) from aqueous solutions and may provide some information for the selection of functional monomers in the preparation of Pd(II) IIPs.

  13. SPRACHFEHLER ALS LITERARISCHES AUSDRUCKSMITTEL ANA BILIC DAS KLEINE STÜCK VOM GROSSEN HIMMEL

    Directory of Open Access Journals (Sweden)

    Goran Lovrić

    2015-03-01

    Full Text Available This paper elaborates a theme at the interface between linguistics and literature on the case example of a novel which belongs to the immigrant literature as part of the contemporary Austrian literature. The Croatian author Ana Bilic describes in her first novel written in German language Das kleine Stück vom großen Himmel (The small part of the big sky published in 2002 the love relationship between a Croatian unnamed female student and the Austrian student Ernst which takes place in Vienna. The unusual thing in this novel is the fact that in numerous sentences and passages the author uses a strange German language which is characterized by interference mistakes, or to be precise a Croatian-German language variation which more or less differs grammatically and lexically from standard German language. In the paper this consciously alienated language is being investigated concerning the influence of the Croatian mother tongue of the author, but also concerning common mistakes while learning German language. The paper also analyses the motivation of Ana Bilic for such in the context of immigrant literature unusual language use, which is also connected with the plot of the novel. Thus qualitative as well as quantitative methods of analysis are being used, whereby the former ones refer to the content and the latter ones to the frequency of interference mistakes in the book. The interference mistakes belong on one side to the fictional (text-internal world and on the other side to the factual (text-external level, because they reflect the plot of the book and establish on the level of content and language a connection between the first-person narrator and the author, who also had to learn German after her arrival to Vienna. As a result of this most interference mistakes appear in the first chapters of the novel, which reflects the first phase in German language learning of the female narrator. Further on in the novel the quantity of the mistakes

  14. 75 FR 74056 - Request for Public Comment on the Proposed Adoption of Administration for Native Americans (ANA...

    Science.gov (United States)

    2010-11-30

    ... HUMAN SERVICES Administration for Children and Families Request for Public Comment on the Proposed Adoption of Administration for Native Americans (ANA) Program Policies and Procedures AGENCY... members of the public at the Administration for Native Americans, 901 D Street, SW., Washington, DC 20447...

  15. Evidence for seasonal patterns in the relative abundance of avian influenza virus subtypes in blue-winged teal (Anas discors).

    Science.gov (United States)

    Ramey, Andrew M; Poulson, Rebecca L; González-Reiche, Ana S; Wilcox, Benjamin R; Walther, Patrick; Link, Paul; Carter, Deborah L; Newsome, George M; Müller, Maria L; Berghaus, Roy D; Perez, Daniel R; Hall, Jeffrey S; Stallknecht, David E

    2014-10-01

    Seasonal dynamics of influenza A viruses (IAVs) are driven by host density and population immunity. Through an analysis of subtypic data for IAVs isolated from Blue-winged Teal (Anas discors), we present evidence for seasonal patterns in the relative abundance of viral subtypes in spring and summer/autumn.

  16. 78 FR 53780 - Notice of Realty Action: Direct Sale of Public Land in Doña Ana County, NM

    Science.gov (United States)

    2013-08-30

    ... in Do a Ana County, New Mexico. The public land would be sold to the Union Pacific Railroad for $11... Union Pacific Railroad, the adjoining landowner, in accordance with Sections 203 and 209 of the Federal... as follows: New Mexico Principal Meridian, New Mexico T. 28 S., R. 2 E., Sec. 11, lot 2; Sec. 14, lot...

  17. 78 FR 23769 - Notice of Final Issuance on the Adoption of Administration for Native Americans (ANA) Program...

    Science.gov (United States)

    2013-04-22

    ... in reference to ANA's new administrative policy focused on conflict of interest standards that states... as it currently allows two teachers to serve as members of the school board, as required by their... personnel to align with this policy due to the extreme shortage of certified ] teachers with requisite...

  18. Parent and conjugated estrogens and progestagens in surface water of the Santa Ana River: Determination, occurrence, and risk assessment

    Science.gov (United States)

    This study presents a sensitive analytical method using high performance liquid chromatography tandem mass spectrometry for the simultaneous monitoring of five estrogen conjugates, six estrogens and two progestagens in surface water of the Santa Ana River. Samples at ten representative sites along t...

  19. Darbinieku motivācijas pilnveidošanas iespējas uzņēmumā "X"

    OpenAIRE

    Vējiņš, Artūrs

    2013-01-01

    Bakalaura darbā „Darbinieku motivācijas pilnveidošanas iespējas uzņēmumā „x”” apskatītas un analizētas motivācijas teorijas, autors pētījis motivēšanas kā uzņēmuma vadības funkciju, kā arī apkopojis informāciju par mazo uzņēmumu motivēšanas pieredzi. Bakalaura darba mērķis ir analizēt uzņēmuma „x” motivācijas sistēmu un izstrādāt priekšlikumus tās pilnveidošanai. Autors izvirza sekojošus darba uzdevumus: 1.Pētīt un analizēt personāla motivēšana teorijas un literatūras avotus, kā ...

  20. Conscientizacion of the Oppressed Language and the Politics of Humor in Ana Castillo's "So Far from God"

    Science.gov (United States)

    Thananopavarn, Susan

    2012-01-01

    This essay explores the relationship between Ana Castillo's novel "So Far from God" (1993) and her development of an activist poetics inspired by Paulo Freire's influential 1970 treatise "Pedagogy of the Oppressed." "So Far from God" may be understood as the practical application of Castillo's theory of "conscienticized poetics"; that is, the…

  1. Siebel atskaišu modulis un tā iespēju uzlabošana

    OpenAIRE

    Heniņš, Aivis

    2014-01-01

    Lai klientiem nodrošinātu efektīvu atskaišu veidošanas risinājumu ieviešanu, nepieciešams labi pārvaldīt Siebel CRM atskaišu sagatavošanas moduļa Oracle BI Publisher iespējas un apzināties potenciālās problēmas un to iespējamos risinājumus. Bakalaura darba mērķis ir Siebel CRM atskaišu sagatavošanas moduļa Oracle BI Publisher iespēju analīze un uzlabošana. Darba teorētiskajā daļā tiek apskatīti Siebel CRM un BI Publisher darbības principi un iespējamās problēmas, bet praktiskā daļa balstās...

  2. Wander Lust: Genre, Sexuality and Identity in Ana Kokkinos’s Head On

    Directory of Open Access Journals (Sweden)

    Joe Hardwick

    2011-04-01

    Full Text Available While the road movie has long held a privileged place in Australian cinema, less prevalent, though increasingly present, has been the street movie, which—like its road movie cousin—poses important questions about identity in tracing the trajectory of its wanderer protagonists. The most remarkable recent example of an Australian street movie is Ana Kokkinos’s 1997 feature Head On. The film recounts a day in the life of a late adolescent Greek-Australian male who wanders the streets participating in sexual encounters with mainly, though not exclusively, other men. Whereas reviews and articles have generally read the film as a coming out narrative, this article—with reference to Ross Chambers’ theories on digressive narratives in his book Loiterature—will argue that Head On rejects the simplistic teleology of the coming out story in favour of a much more complex understanding of adolescent male sexuality.

  3. Biomimicry of multifunctional nanostructures in the neck feathers of mallard (Anas platyrhynchos L.) drakes

    Science.gov (United States)

    Khudiyev, Tural; Dogan, Tamer; Bayindir, Mehmet

    2014-04-01

    Biological systems serve as fundamental sources of inspiration for the development of artificially colored devices, and their investigation provides a great number of photonic design opportunities. While several successful biomimetic designs have been detailed in the literature, conventional fabrication techniques nonetheless remain inferior to their natural counterparts in complexity, ease of production and material economy. Here, we investigate the iridescent neck feathers of Anas platyrhynchos drakes, show that they feature an unusual arrangement of two-dimensional (2D) photonic crystals and further exhibit a superhydrophobic surface, and mimic this multifunctional structure using a nanostructure composite fabricated by a recently developed top-down iterative size reduction method, which avoids the above-mentioned fabrication challenges, provides macroscale control and enhances hydrophobicity through the surface structure. Our 2D solid core photonic crystal fibres strongly resemble drake neck plumage in structure and fully polymeric material composition, and can be produced in wide array of colors by minor alterations during the size reduction process.

  4. Translocation of wild Laysan Teal Anas laysanensis from Laysan Island to Midway Atoll: Project update

    Science.gov (United States)

    Reynolds, M.H.; Breeden, J.H.; Klavitter, J.L.

    2007-01-01

    The Laysan Teal Anas laysanensis is endemic to the Hawaiian Islands, where it has been restricted to Laysan Island over the last 150 years. Individuals of this endangered species have recently been translocated to the two largest islands that comprise Midway Atoll National Wildlife Refuge, to reduce the risk of the Laysan Teal becoming extinct. Post-release monitoring with the aid of radio-telemetry was conducted to determine the success of the reintroduction attempt during October 2004-2007. The population was found to have increased after three breeding seasons, from forty-two founders sourced directly from Laysan, to a population of ??? 192 post-fledglings juveniles and adults. ?? Wildfowl & Wetlands Trust.

  5. Nature does not exist: conservationisms and international relations in Doñana

    Directory of Open Access Journals (Sweden)

    Lino Camprubí

    2017-02-01

    Full Text Available The paper starts by discarding the methodological approach to the history of Natural Parks that sees them as steps towards the “conservation of Nature” - with a capital N. Rather, it situates the history of Doñana within its political, personal and scientific contexts. These contexts bring us to an international scale marked by the decolonization of the British Empire and the transformation of ornithology and ecology as disciplines. Bird migratory routes contributed to the Park’s international dimension, in which context the agreement between the World Wildlife Fund (WWF and the Consejo Superior de Investigaciones Científicas (CSIC took place. Creation of the Park opened the door to new conflicts among diverging ways of understanding conservation and different scientific categorizations of Doñana’s territory. The resolution of these conflicts depended on strengths and alliances, which allows us to conclude by refining our methodological starting point.

  6. SQL injekciju uzbrukumu analīze un novēršana

    OpenAIRE

    Kudiņa, Monta

    2015-01-01

    Šī darba mērķis ir iepazīties ar populārākajiem SQL injekciju uzbrukumu veidiem, apzināties kā uzbrukumi tiek realizēti, un noskaidrot preventīvos pasākumus uzbrukumu novēršanai. Bakalaura darbā “SQL injekciju uzbrukumu analīze un novēršana” tiek apskatīti SQL injekciju uzbrukumu veidi un metodes, uzbrukumu realizācijas dažādās datubāzes platformās, SQL injekciju uzbrukumu atklāšana un pasākumi uzbrukumu novēšanai. Darba gaitā tika gan teorētiski, gan praktiski iepazīti SQL uzbrukumi, un apsk...

  7. A Cinema’s Female Worker in a Musical Key: Ana Satrova

    Directory of Open Access Journals (Sweden)

    Virginia Sánchez Rodríguez

    2017-01-01

    Full Text Available Despite the remote origin of women in music, today the presence of names of women dedicated to musical composition remains limited in historiography. Also references to fi lm music composers are even more unusual, although cinema is probably the most important art in the 20th Century. According to these circumstances, in this paper we propose an approach to Ana Satrova, a composer of original soundtracks who worked in the Spanish film area between 1969 and 1985. In this occasion, we offer a stylistic and visual studio about his first work in the Spanish cinema of Franco’s regime: Homicidios en Chicago (1969, José María Zabalza

  8. Pārskatu ģenerēšanas bibliotēka Python valodai

    OpenAIRE

    Paltovs, Deniss

    2012-01-01

    Kvalifikācijas darba pamatā ir pārskatu ģenerēšanas bibliotēka Python valodai - PythonReports, kura ļauj Python izstrādātajiem no datiem un šablona izveidot izdruku uz ekrāna vai printera. Gala produkts ir vizuālais redaktors, kurš ļauj ērti un uzskatāmi veidot un rediģēt PythonReports šablonus, izmantojot mūsdienu lietotāju saskarnes tehnoloģijas operētājsistēmās ar grafisku lietotāja saskarni. Kvalifikācijas darbs balstās uz iepriekšējo pieredzi, iegūto izmantojot līdzīgus rīkus citās sist...

  9. Palabras como espejos: la identidad en la poesía de Ana Istarú

    Directory of Open Access Journals (Sweden)

    Alejandra M. Aventín Fontana

    2013-08-01

    Full Text Available La poesía de Ana Istarú se erige a principios del siglo XXI como un imaginario rico y de obligada visita, pues refleja el resultado del proceso histórico de la forja de la identidad del pueblo costarricense tras la independencia de la metrópoli en el marco de su historia literaria, de la centroamericana y en el de habla hispana con toda la problemática que ello implica en territorio tico. Los poemas de La estación de fiebre manifiestan el deseo de independencia e integración de la mujer en el ámbito de lo público a través del cuerpo y de la palabra en el último tercio del siglo XX. Para ello la escritora no duda en denunciar igualmente en su discurso las consecuencias negativas que ha tenido el patriarcado. Ana Istarú’s poetry began to develop in the early twenty-first century as a rich imaginary not to be missed. It reflects the result of a historical process to forge the identity of Costa Ricans after their independence in the framework of literary history and in particular of Central America and the Spanish-speaking community with all the complexity that this involves in Costa Rica. The poems in La estación de fiebre show a desire for independence and the integration of the woman in the public sphere through her body and through her words in the last third of the twentieth century. Likewise, in her writing Istarú does not hesitate to denounce the negative effects of patriarchy.

  10. Pro-ana versus Pro-recovery: A Content Analytic Comparison of Social Media Users’ Communication about Eating Disorders on Twitter and Tumblr

    Directory of Open Access Journals (Sweden)

    Dawn B. Branley

    2017-08-01

    Full Text Available Objectives: To compare how people communicate about eating disorders on two popular social media platforms – Twitter and Tumblr.Materials and Methods: Thematic analysis was conducted to characterize the types of communications posted, and a content analysis was undertaken of between-platform differences.Results: Three types of content (pro-ana, anti-ana, and pro-recovery were posted on each platform. Overall, across both platforms, extreme pro-ana posts were in the minority compared to anti-ana and pro-recovery. Pro-ana posts (including ‘thinspiration’ were more common on Twitter than Tumblr, whereas anti-ana and pro-recovery posts were more common on Tumblr.Conclusion: The findings have implications for future research and health care relating to the treatment and prevention of eating disorders. Developers of future interventions targeting negative pro-ana content should remain aware of the need to avoid any detrimental impact on positive online support.

  11. Bilingvālās audzināšanas pieredze Rīgas pirmsskolas izglītības iestādēs

    OpenAIRE

    Anufrijeva, Larisa

    2008-01-01

    Darbā analizēti bilingvālās audzināšanas pedagoģiskie pamati, pirmsskolas bilingvālās audzināšanas ieviešanas pedagoģiskie nosacījumi. Veikts pētījums par bilingvālās audzināšanas nosacījumu ievērošanu audzināšanas darbā. Darba mērķis: Noteikt bilingvālās audzināšanas pozitīvas pieredzes attīstības nosacījumus. Pētījuma hipotēze: Bilingvālās audzināšanas pozitīvā pieredze attīstās, ja: pirmsskolas skolotājam (audzinātājam) ir pozitīva attieksme pret bilingvismu; bērnam tiek sniegts atba...

  12. Vibrational coherence in polar solutions of Zn(II) tetrakis(N-methylpyridyl)porphyrin with Soret-band excitation: rapidly damped intermolecular modes with clustered solvent molecules and slowly damped intramolecular modes from the porphyrin macrocycle.

    Science.gov (United States)

    Dillman, Kevin L; Shelly, Katherine R; Beck, Warren F

    2009-04-30

    Ground-state coherent wavepacket motions arising from intermolecular modes with clustered, first-shell solvent molecules were observed using the femtosecond dynamic absorption technique in polar solutions of Zn(II) meso-tetrakis(N-methylpyridyl)porphyrin (ZnTMPyP) with excitation in the Soret absorption band. As was observed previously in bacteriochlorophyll a solution, the pump-probe transients in ZnTMPyP solutions are weakly modulated by slowly damped (effective damping time gamma > 1 ps) features that are assigned to intramolecular modes, the skeletal normal modes of vibration of the porphyrin. The 40 cm(-1) and 215 cm(-1) modes from the metal-doming and metal-solvent-ligand modes, respectively, are members of this set of modulation components. A slowly damped 2-4 cm(-1) component is assigned to the internal rotation of the N-methylpyridyl rings with respect to the porphyrin macrocycle; this mode obtains strong resonance Raman intensity enhancement from an extensive delocalization of pi-electron density from the porphyrin in the ground state onto the rings in the pi* excited states. The dominant features observed in the pump-probe transients are a pair of rapidly damped (gamma modes with solvent molecules. This structural assignment is supported by an isotope-dependent shift of the average mode frequencies in methanol and perdeuterated methanol. The solvent dependence of the mean intermolecular mode frequency is consistent with a van der Waals intermolecular potential that has significant contributions only from the London dispersion and induction interactions; ion-dipole or ion-induced-dipole terms do not make large contributions because the pi-electron density is not extensively delocalized onto the N-methylpyridyl rings. The modulation depth associated with the intermolecular modes exhibits a marked dependence on the electronic structure of the solvent that is probably related to the degree of covalency; the strongest modulations are observed in acetonitrile

  13. Traditional ecological knowledge trends in the transition to a market economy: empirical study in the Doñana natural areas.

    Science.gov (United States)

    Gómez-Baggethun, Erik; Mingorría, Sara; Reyes-García, Victoria; Calvet, Laura; Montes, Carlos

    2010-06-01

    Researchers and conservation managers largely agree on the relevance of traditional ecological knowledge for natural resource management in indigenous communities, but its prevalence and role as societies modernize are contested. We analyzed the transmission of traditional knowledge among rural local people in communities linked to protected areas in Doñana, southwestern Spain. We studied changes in knowledge related to local practices in agriculture and livestock farming among 198 informants from three generations that cover the period in which the area transited from an economy strongly dependent on local ecosystem services to a market economy with intensified production systems. Our results suggest an abrupt loss of traditional agricultural knowledge related to rapid transformations and intensification of agricultural systems, but maintenance of knowledge of traditional livestock farming, an activity allowed in the protected areas that maintains strong links with local cultural identity. Our results demonstrate the potential of protected areas in protecting remaining bodies of traditional ecological knowledge in developed country settings. Nevertheless, we note that strict protection in cultural-landscape-dominated areas can disrupt transmission of traditional knowledge if local resource users and related practices are excluded from ecosystem management.

  14. Elektrovadītspējas noteikšana poli(ēter ēter ketona) membrānām ar dažādām sulfonēšanas pakāpēm

    OpenAIRE

    Fedorenko, Deniss

    2017-01-01

    Darbā ir veikta poli(ēter ētera ketona) sulfonēšana un ir iegūti paraugi ar dažādām sulfonēšanas pakāpēm, no kurām tika izgatavotas membrānas. Sulfonēšanas pakāpe tika noteikta ar titrēšanas metodi. Izmantojot impedances metodi, tika noteikta sulfonēta poli(ēter ētera ketona) membrānu elektrovadītspēja atkarībā no sulfonēšanas pakāpes. Membrānas tika analizētas ar rentgendifraktometrijas metodi un termogravimetrijas metodi.

  15. Latvian Waste Management Modelling in View of Environmental Impact Reduction / Latvijas Atkritumu SAIMNIECĪBAS ATTĪSTĪBA un TĀS RADĪTĀS Ietekmes UZ Vidi SAMAZINĀŠANAS MODELĒŠANA

    Science.gov (United States)

    Teibe, I.; Bendere, R.; Arina, D.

    2013-12-01

    In the work, the life-cycle assessment approach is applied to the planning of waste management development in a seaside region (Piejūra) using the Waste Management Planning System (WAMPS) program. In Latvia, the measures to be taken for the climate change mitigation are of utmost importance - especially as related to the WM performance, since a disposal of biodegradable waste presents the primary source of GHG emissions. To reduce the amount of such waste is therefore one of the most significant goals in the State WM plan for 2013-2020, whose adoption is the greatest challenge for municipalities. The authors analyse seven models which involve widely employed biomass processing methods, are based on experimental data and intended for minimising the direct disposal of organic mass at the solid waste landfills. The numerical results obtained evidence that the thermal or biotechnological treatment of organic waste substantially reduces the negative environmental impact of WM practices - by up to 6% as compared with the currently existing. Klimata pārmaiņu samazināšanas pasākumi Latvijā atkritumu saimniecības sektorā ir īpaši svarīgi. jo bioloģiski sadalāmo atkritumu apglabāšana ir viens no būtiskākajiem SEG emisiju avotiem valstī. Pētījumā modelēti virkne sadzīves atkritumu apsaimniekošanas modeļi. kas ietver plašāk izmantotās biomasas pārstrādes metodes un samazina tiešu organiskās masas apglabāšanu cieto sadzīves atkritumu poligonos. Atkritumu apsaimniekošanas modeļu radītās vides ietekmes novērtēšanai izmantota WAMPS (Waste Management Planning System) programma, kas balstīta uz atkritumu apsaimniekošanas procesu dzīves cikla novērtējumu vienā no desmit Latvijas atkritumu apsaimniekošanas reģioniem - Piejūra. Iegūtie kvantitatīvie rezultāti norāda. ka organiskās atkritumu masas pārstrāde un stabilizēšana, izmantojot biotehnoloģijas vai termisko pārstrādi, būtiski samazina atkritumu apsaimniekošanas rad

  16. Laulības slēgšana un laulības šķiršana musulmaņu tiesības

    OpenAIRE

    Slobodeņuka, Anastasija

    2012-01-01

    Bakalaura darbs ”Laulības slēgšana un laulības šķiršana musulmaņu tiesībās” sastāv no četram daļām. Pirmajā daļā tiek pētīti laulības slēgšanas nosacījumi. Viens no galvenajiem principiem ir reliģiozitāte, kā teicis Pravietis: «Neprecat meiteni [tikai] tās skaistuma dēļ, jo tas var viņu pazudināt; un neprecaties [tikai] viņas bagātības dēļ, jo tas padarīs viņu nepakļāvīgu. Precieties ar meiteni viņas reliģiozitātes dēļ!» Otrajā daļā tiek apskatīti noteikumi, kas aizliedz laulību. Pastāv l...

  17. Smilšaino grunšu īpašību mehāniska uzlabošana ar sablīvēšanas metodi

    OpenAIRE

    Seile, Gundega

    2012-01-01

    Bakalaura darbā pētījumā „Smilšainu grunšu īpašību mehāniska uzlabošana ar sablīvēšanas metodi” ir apskatītas un raksturotas visas plašāk izmantotās smilšaino grunšu mehāniskās uzlabošanas metodes, ieverot metožu aprakstu. Darba ietvaros tika noteiktas dažādu smilšaino grunšu sākontējās fizikālās īpašības- granulometriskais sastāvs, grunts daļiņu blīvums, grunts blīvums, porainības koefcinets, poru tilpums utt., kā arī veiktas 24 grunts kompresijas pārbaudes, kuru rezultāti ļāva noteikt pē...

  18. Jaunākā skolas vecuma skolēnu kritiskās domāšanas attīstīšana latviešu valodas stundās.

    OpenAIRE

    Kauķe, Zaiga

    2006-01-01

    Diplomdarba “ Jaunākā skolas vecuma bērnu kritiskās domāšanas attīstīšana latviešu valodas stundās” aktualitāti nosaka jaunais Latvijas Valsts pamatizglītības standarts. Viens no tā izglītojošajiem aspektiem - analītiski kritiskais - paredz, ka skolēni, apkopojot savu iepriekšējo pieredzi, mācās paši apgūt jaunas zināšanas, tās kritiski izvērtējot. Tādēļ bērniem jādod iespēja veidot savas domas patstāvīgi un neatkarīgi no citiem, apgūt garīgās darbības prasmes. Pētījuma mērķis ir izanalizē...

  19. Memoria, infancia y guerra civil: El mundo narrativo de Ana María Matute

    Directory of Open Access Journals (Sweden)

    Nestor Horacio Bórquez

    2011-12-01

    Full Text Available Ana María Matute has created a tightly closed narrative world where fiction and reality are mixed through a particular style, thoroughly lyric but full of cruelty. This world is largely shaped by the coexistence of the children's innocent gaze with the disenchanted look of the adults. Paraíso inhabitado (2008, her latest novel, meets most of the topics that make up Matute's own style: Against the historical background of the Spanish Civil War, the central matter is once again related to the clash of the already mentioned conflicting realities. This paper attempts to analyze the intersection between both features: the distantiated look of the children -who shall live in a world of fantasy until his final defeat and subsequent entry in the world of adults, like every children in Matute's work- displaying a 'translucent' view of the Civil War, an appeal to the memory of a grown-up narrator who introduces her childhood?s remembrances almost without any interventionAna María Matute ha creado un cerrado mundo narrativo que mezcla ficción y realidad con un estilo particular, pleno de poesía pero cargado de crueldad. Parte de este mundo se forja por la convivencia de la mirada inocente de los niños con la desencantada de los adultos. Paraíso inhabitado (2008, última novela de Matute, cumple con la mayoría de los 'tópicos' que conforman el particular estilo de la autora: prevalece este choque de realidades enfrentadas que además tiene a la Guerra Civil como trasfondo histórico. El trabajo analizará el cruce de estas dos características: la mirada 'extrañada' de los niños protagonistas de la obra -que como todo niño 'matuteano' vivirá en un mundo de fantasía efímero antes de ingresar ya 'derrotado' al mundo adulto- que presenta una visión ?traslúcida? de la guerra civil, una apelación a la memoria de la narradora ya adulta que presenta casi sin intervenciones sus recuerdos de niña

  20. Spēles Sudoku izstrāde JAVA programmēšanas valodā

    OpenAIRE

    Plisko, Andrejs

    2011-01-01

    Kvalifikācijas darba mērķis ir izveidot prāta spēli Sudoku un tās paveidu JigSaw Sudoku, kas kalpos kā attīstoša un aizraujoša brīvā laika pavadīšanas iespēja, kas būs pieejama kā parasta lietotne. Lietotne ļaus lietotājam izvēlēties 1 no 3 dažādiem sarežģītības līmeņiem. Pareizo ievaddatu pārbaudīšanas metodes neļaus lietotājam ievadīt nepareizu skaitli. Darba gaitā tika radīta „Sudoku” spēle, kas atbilst dotajām prasībām.

  1. Noliktavas sistēmas pilnveidošana uzņēmumā „ATN”.

    OpenAIRE

    Ramazanova, Marina

    2008-01-01

    M.Ramazanova Noliktavas sistēmas pilnveidošana uzņēmumā „ATN”. Bakalaura darbs bez pielikumiem sastāv no 69 lapaspusēm, 11 attēliem, 6 tabulām, 4 formulām, ka arī no 3 pielikumiem un 23 informācijas avotiem. Bakalaura darba temats ir „Noliktavas sistēmas pilnveidošana uzņēmumā „ATN”. Bakalaura darba mērķis ir izanalizēt uzņēmuma noliktavas sistēmas funkcionēšanu saimniecības procesā, pamatojoties uz teorētiskām atziņām, izcelt trūkumus un izstrādāt priekšlik...

  2. Klausīšanās mācīšana vidusskolā

    OpenAIRE

    Mihailova, Aļona

    2010-01-01

    Bakalaura darbs „Klausīšanās mācīšana vidusskolā” uzsver vidusskolas skolēnu klausīšanās prasmes attīstību. Darbs ne tikai sniedz ieskaitu klausīšanās attīstības teorijas principos, bet iekļauj praktiskas vingrinājumus, padomus skolēnu klausīšanās prasmes uzlabošanai. Bakalaura darbs ir palīgs skolotājiem, ja ietver dažādas metodes, klausīšanas uzdevumu aprakstus, kurus skolotāji var pieteikt stundās klausīšanās prasmes attīstīšanai. Bakalaura darbā ir aprakstīti dažādi metodiskie aspekti,...

  3. La enseñanza de la lectura y la escritura hoy. Entrevista a Ana Teberosky Coronado.

    OpenAIRE

    Moisés Selfa Sastre; Juan de Dios Villanueva Roa

    2015-01-01

    Ana Teberosky Coronado es miembro del OED y Profesora Catedrática del Departamento de Psicología Evolutiva y de la Educación de la Facultad de Psicología de la Universitat de Barcelona. Sus intereses de investigación giran en torno a la interacción entre la oralidad y la escritura, el aprendizaje del lenguaje escrito y el desarrollo metalingüístico.

  4. Ana Vaz Milheiro, Nos Trópicos Sem Le Corbusier: Arquitectura Luso-africana no Estado Novo

    OpenAIRE

    Agarez, Ricardo

    2013-01-01

    Nos Trópicos Sem Le Corbusier: Arquitectura Luso-africana no Estado Novo examines the circulation of architectural cultures and actors in and between the historically-related contexts of Portugal, Brazil and the former Portuguese colonies in Africa, during the first three quarters of the twentieth century. This generously illustrated, Portuguese-language volume is a collection of ten essays written by Ana Vaz Milheiro between 2006 and 2011, and previously published either in the proceedings o...

  5. Innate BDNF expression is associated with ethanol intake in alcohol-preferring AA and alcohol-avoiding ANA rats.

    Science.gov (United States)

    Raivio, Noora; Miettinen, Pekka; Kiianmaa, Kalervo

    2014-09-04

    We have shown recently that acute administration of ethanol modulates the expression of brain-derived neurotrophic factor (BDNF) in several rat brain areas known to be involved in the development of addiction to ethanol and other drugs of abuse, suggesting that BDNF may be a factor contributing to the neuroadaptive changes set in motion by ethanol exposure. The purpose of the present study was to further clarify the role of BDNF in reinforcement from ethanol and in the development of addiction to ethanol by specifying the effect of acute administration of ethanol (1.5 or 3.0 g/kg i.p.) on the expression profile of BDNF mRNA in the ventral tegmental area and in the terminal areas of the mesolimbic dopamine pathway in the brain of alcohol-preferring AA and alcohol-avoiding ANA rats, selected for high and low voluntary ethanol intake, respectively. The level of BDNF mRNA expression was higher in the amygdala and ventral tegmental area of AA than in those of ANA rats, and there was a trend for a higher level in the nucleus accumbens. In the amygdala and hippocampus, a biphasic change in the BDNF mRNA levels was detected: the levels were decreased at 3 and 6h but increased above the basal levels at 24h. Furthermore, there was a difference between the AA and ANA lines in the effect of ethanol, the ANA rats showing an increase in BDNF mRNA levels while such a change was not seen in AA rats. These findings suggest that the innate levels of BDNF expression may play a role in the mediation of the reinforcing effects of ethanol and in the control of ethanol intake. Copyright © 2014 Elsevier B.V. All rights reserved.

  6. Assessment of mangrove flora of Palaui Island Protected Landscape and Seascape (PIPLS) San Vicente, Sta. Ana Cagayan valley, Philippines

    OpenAIRE

    Melanie A. Calicdan; Carmelita Rebancos; Rico Ancog; Nestor Baguinon

    2015-01-01

    The status and species composition of mangrove forest is a basic and pre-requisite for the management and conservation of mangrove resource. The study was conducted to determine the status and species composition of mangrove forests of Palaui Island Protected Landscape and Seascape (PIPLS), San Vicente Sta. Ana, Cagayan, Philippines. A Transect Line Plot (TLP) method was employed to obtain data on the structure of mangrove community. Results revealed that there were 16 true mangrove species b...

  7. Fish composition and assemblage in the anthropogenic-modified tidally-restricted Doñana (Spain) marshlands

    Science.gov (United States)

    Moreno-Valcárcel, Raquel; Oliva-Paterna, Francisco J.; Arribas, Carmen; Fernández-Delgado, Carlos

    2013-03-01

    The Guadalquivir estuary is the largest estuarine area on the southern Atlantic coast of Europe; its anthropogenic tidally-restricted marshes are partly within the boundary of the Doñana National Park, southern Spain. Our two-year study describes the spatial and temporal patterns of the fish assemblages in the Doñana marshlands in terms of species richness, abundance and biomass. The main families were Mugilidae and Cyprinidae, which accounted for 40.9% of the total species richness. Unlike the fish assemblages found in other European estuaries, Doñana was dominated in both biomass and abundance by freshwater species, mainly invasive exotic species. The spatial analysis of the assemblage showed four significant fish groups corresponding to different habitats established a priori and related to the salinity gradient. Assemblages did not show a seasonal pattern and the temporal fish groups observed were mainly related to the hydrological cycle and the extreme drought that occurred during the study period.

  8. Frazeoloģismi angļu valodas mācīšanas procesā

    OpenAIRE

    Dmitrenko, Gaļina

    2009-01-01

    Bakalaura darba nosaukums ir „Frazeoloģismi angļu valodas mācīšanas procesā. Zinātniskā darba mērķis ir parādīt, ka angļu valodas frazeoloģismi satur lielu apjomu informācijas par angļu kultūru un ieviest jaunu kultūras mācīšanas metodi. Galvenais pētījuma veids ir eksperiments, kas tika vadīts vidusskolas klasēs. Rezultātā darba autors atklāja, ka informācija par kultūru var palīdzēt frazeoloģismu apgūšanas procesā, un otrādi – kultūra var tikt mācīta ar frazeoloģismu palīdzību. Turk...

  9. The ecology of avian influenza viruses in wild dabbling ducks (Anas spp. in Canada.

    Directory of Open Access Journals (Sweden)

    Zsuzsanna Papp

    Full Text Available Avian influenza virus (AIV occurrence and transmission remain important wildlife and human health issues in much of the world, including in North America. Through Canada's Inter-Agency Wild Bird Influenza Survey, close to 20,000 apparently healthy, wild dabbling ducks (of seven species were tested for AIV between 2005 and 2011. We used these data to identify and evaluate ecological and demographic correlates of infection with low pathogenic AIVs in wild dabbling ducks (Anas spp. across Canada. Generalized linear mixed effects model analyses revealed that risk of AIV infection was higher in hatch-year birds compared to adults, and was positively associated with a high proportion of hatch-year birds in the population. Males were more likely to be infected than females in British Columbia and in Eastern Provinces of Canada, but more complex relationships among age and sex cohorts were found in the Prairie Provinces. A species effect was apparent in Eastern Canada and British Columbia, where teal (A. discors and/or A. carolinensis were less likely to be infected than mallards (A. platyrhynchos. Risk of AIV infection increased with the density of the breeding population, in both Eastern Canada and the Prairie Provinces, and lower temperatures preceding sampling were associated with a higher probability of AIV infection in Eastern Canada. Our results provide new insights into the ecological and demographic factors associated with AIV infection in waterfowl.

  10. Kulinārais diskurss un tā tulkošanas aspekti

    OpenAIRE

    Ļuļe, Zane

    2013-01-01

    21. gadsimtā vairāk nekā jebkad vēsturē uzmanība tiek pievērsta kulināriskajam dzīvesveidam, gastronomijas dažādiem aspektiem. Taču valodniecībā nozare vēl nav tik detalizēti un sistemātiski pētīta, lai varētu runāt par vienotiem principiem, pieejamiem leksikogrāfiskajiem avotiem un priekšrocībām šaurās un specifiskās nozares tulkošanā. Maģistra darbā „Kulinārais diskurss un tā tulkošanas aspekti” pētītas nozares un kulinārā diskursa īpatnības, analizējot teoriju un valodas lietojumu recepšu ...

  11. Svešvalodu mācīšana indigo bērniem

    OpenAIRE

    Bernsone, Inese

    2008-01-01

    Ar terminu „indigo bērns” tiek apzīmēti talantīgie un hiperaktīvie mūsdienu bērni. Pastāv viedoklis, ka tradicionālā izglītības sistēma būtu jāpieskaņo indigo bērniem, lai veiksmīgi attīstītu viņu potenciālu. Pētījuma mērķis ir popularizēt indigo jēdzienu un pievērst uzmanību izglītības jautājumiem. Izmantotās pētījuma metodes ir literatūras analīze un svešvalodu skolotāju aptauja. Rezultāti apstiprina, ka jaunie bērni pieprasa uzmanību, godīgumu un visaptverošas zināšanas, kas atbilst viņu m...

  12. Assessing helminth community structure and patterns in gizzard helminths of blue-winged teal (Anas discors).

    Science.gov (United States)

    Graves, David W; Fedynich, Alan M

    2013-10-01

    Helminth community structure (prevalence and abundance) and patterns (associations and distributions) of gizzard worms were examined in blue-winged teal (Anas discors) migrating through south Texas to their wintering grounds (n = 50) and as they migrated back to their breeding grounds (n = 50). Three species of nematodes (Amidostomum acutum, Epomidiostomum uncinatum, and Streptocara crassicauda) and 1 species of cestode (Gastrotaenia cygni) were recovered, representing 1,164 helminth individuals. Amidostomum acutum was the most prevalent (92%) and abundant (817 individuals; 70% of total worms), while G. cygni was the least prevalent (16%) and abundant (23 individuals; 2%). Ninety-eight blue-winged teal were infected with 1 to 4 species. Amidostomum acutum and E. uncinatum were the most frequently (45%) observed association of 2 or more species, followed by A. acutum, E. uncinatum, and S. crassicauda (19%), and A. acutum and S. crassicauda (14%). Significant positive correlations were mainly between A. acutum and E. uncinatum, whereas negative correlations were found between each of these 2 species and S. crassicauda. Prevalence and abundance of A. acutum and S. crassicauda were not influenced by season, host age, or host sex. However, E. uncinatum varied by season and host age. The percent similarity index indicated a relatively consistent component community pattern of high similarity irrespective of season, host age, and sex. The same helminth species were found in both fall and spring, indicating that other helminth species were not being acquired on the wintering grounds.

  13. Histomorphological features of the tongue of the Eurasian teal (Anas crecca).

    Science.gov (United States)

    Marzban Abbasabadi, B; Sayrafi, R

    2017-12-04

    This study presents the histomorphological features of tongue in Eurasian teal (Anas crecca); the smallest extant dabbling duck. Heads of four adult males and four adult females were used in this study. The results illustrate a tongue with three different parts; the apex with a lingual nail in ventral surface, the body with a lingual prominence in caudal part and some large and small conical papillae in lateral sides and the root, that was covered with many conical papillae in different sizes. Histological results revealed two types of keratinized and non-keratinized epithelium covering parts of the tongue. The lingual salivary glands were observed in the lamina propria of the body and root of the tongue showed strongly periodic acid-Schiff (PAS)-positive reaction. The yellow adipose tissue was located under the lamina propria on the body and root of the tongue. The filiform papillae between the conical papillae of the body were arranged densely. The sensory organs, which contain sensory receptors (Grandry and Herbst corpuscles), were located in the lamina propria of the body of the tongue. In conclusion, the anatomical and histological structure of the Eurasian teal' tongue was generally similar to its family members such as domestic goose and duck but showed some differences that may be adoptions to the bird's habitat and mode of feeding. © 2017 Blackwell Verlag GmbH.

  14. Spread of avian influenza viruses by common teal (Anas crecca in Europe.

    Directory of Open Access Journals (Sweden)

    Camille Lebarbenchon

    Full Text Available Since the recent spread of highly pathogenic (HP H5N1 subtypes, avian influenza virus (AIV dispersal has become an increasing focus of research. As for any other bird-borne pathogen, dispersal of these viruses is related to local and migratory movements of their hosts. In this study, we investigated potential AIV spread by Common Teal (Anas crecca from the Camargue area, in the South of France, across Europe. Based on bird-ring recoveries, local duck population sizes and prevalence of infection with these viruses, we built an individual-based spatially explicit model describing bird movements, both locally (between wintering areas and at the flyway scale. We investigated the effects of viral excretion duration and inactivation rate in water by simulating AIV spread with varying values for these two parameters. The results indicate that an efficient AIV dispersal in space is possible only for excretion durations longer than 7 days. Virus inactivation rate in the environment appears as a key parameter in the model because it allows local persistence of AIV over several months, the interval between two migratory periods. Virus persistence in water thus represents an important component of contamination risk as ducks migrate along their flyway. Based on the present modelling exercise, we also argue that HP H5N1 AIV is unlikely to be efficiently spread by Common Teal dispersal only.

  15. Spread of avian influenza viruses by common teal (Anas crecca) in Europe.

    Science.gov (United States)

    Lebarbenchon, Camille; Albespy, Frédéric; Brochet, Anne-Laure; Grandhomme, Viviane; Renaud, François; Fritz, Hervé; Green, Andy J; Thomas, Frédéric; van der Werf, Sylvie; Aubry, Philippe; Guillemain, Matthieu; Gauthier-Clerc, Michel

    2009-10-05

    Since the recent spread of highly pathogenic (HP) H5N1 subtypes, avian influenza virus (AIV) dispersal has become an increasing focus of research. As for any other bird-borne pathogen, dispersal of these viruses is related to local and migratory movements of their hosts. In this study, we investigated potential AIV spread by Common Teal (Anas crecca) from the Camargue area, in the South of France, across Europe. Based on bird-ring recoveries, local duck population sizes and prevalence of infection with these viruses, we built an individual-based spatially explicit model describing bird movements, both locally (between wintering areas) and at the flyway scale. We investigated the effects of viral excretion duration and inactivation rate in water by simulating AIV spread with varying values for these two parameters. The results indicate that an efficient AIV dispersal in space is possible only for excretion durations longer than 7 days. Virus inactivation rate in the environment appears as a key parameter in the model because it allows local persistence of AIV over several months, the interval between two migratory periods. Virus persistence in water thus represents an important component of contamination risk as ducks migrate along their flyway. Based on the present modelling exercise, we also argue that HP H5N1 AIV is unlikely to be efficiently spread by Common Teal dispersal only.

  16. Gastrointestinal helminthes of green-winged teal (Anas crecca) from North Iran.

    Science.gov (United States)

    Youssefi, Mohammad Reza; Hosseini, Seyed Hossein; Tabarestani, Amir Hossein Alizadeh; Ardeshir, Hadi Alijani; Jafarzade, Farshid; Rahimi, Mohammad Taghi

    2014-05-01

    To determine the helminth parasites of Anas crecca (A. crecca) in one of proper refuges of Iran, Fereydunkenar. A total number of one hundred thirty-six gastrointestinal tracts of green-winged teal (A. crecca) were collected from Fereydunkenar, Mazandaran province during September and October 2011. The gastrointestinal tracts were examined for helminth infection. The total infection rate was 70.50% (96) that 68.96% (40) of males and 71.79% (56) of females shown helminthes infection. The examined A. crecca harbored one species of Nematoda, Cestoda and two species of Digenea which were as following: Contracaecum larvae (from stomach wall), Diorchis stefanskii (D. stefanskii) (from small intestine), Hypoderaeum conoideum (from small intestine) and Notocotylus attenuatus (N. attenuatus) (from caecum), respectively. There was no significant difference in the prevalence of infection between examined males and females ducks in Hypoderaeum conoideum, D. stefanskii and N. attenuatus (P>0.05) whereas a significant relationship was observed between males and females in Contracaecum larvae (P<0.05). Based on the results of the present study, we conclude that A. crecca plays a prominent role in transmission of mentioned parasites. In addition, this is the first report of Contracaecum larvae, D. stefanskii and N. attenuatus from A. crecca in Iran.

  17. Cyanobacteria, algae and microfungi present in biofilm from Božana Cave (Serbia

    Directory of Open Access Journals (Sweden)

    Slađana Popović

    2015-05-01

    Full Text Available Phototrophic microorganisms (cyanobacteria and algae and microfungi, were identified from biofilm on the walls of the entrance of BožanaCavein west Serbia. Temperature, relative humidity and light intensity were measured, and chlorophyll a content determined. Light intensity differed from the entrance inwards. However, Chl a content was not proportional to light intensity, instead it was positively correlated to biofilm weight. Biofilm samples from two sites were also observed using a scanning electron microscope. Coccoid forms of cyanobacteria were abundant at the sampling site with the lowest light intensity, while members of the order Nostocales were predominant at the sampling site with the highest light intensity measured. Cyanobacteria were the dominant group of phototrophs colonizing cave walls (29 taxa, with the order Chroococcales prevailing (21 taxa. The most frequently documented cyanobacteria were species from genera Gloeocapsa, Scytonema, Aphanocapsa and Chroococcus. Desmococcus olivaceus and Trentepohlia aurea were the only green algae documented on cave walls. Ascomycetes were common (e.g. Alternaria, Aspergillus, Cladosporium, Epicoccum, Penicillum and Trichoderma, while zygomycetes and oomycetes were less frequent. The different color of each biofilm sample was ascribed to the presence of various different species of cyanobacteria and algae.

  18. Spread of Avian Influenza Viruses by Common Teal (Anas crecca) in Europe

    Science.gov (United States)

    Lebarbenchon, Camille; Albespy, Frédéric; Brochet, Anne-Laure; Grandhomme, Viviane; Renaud, François; Fritz, Hervé; Green, Andy J.; Thomas, Frédéric; van der Werf, Sylvie; Aubry, Philippe; Guillemain, Matthieu; Gauthier-Clerc, Michel

    2009-01-01

    Since the recent spread of highly pathogenic (HP) H5N1 subtypes, avian influenza virus (AIV) dispersal has become an increasing focus of research. As for any other bird-borne pathogen, dispersal of these viruses is related to local and migratory movements of their hosts. In this study, we investigated potential AIV spread by Common Teal (Anas crecca) from the Camargue area, in the South of France, across Europe. Based on bird-ring recoveries, local duck population sizes and prevalence of infection with these viruses, we built an individual-based spatially explicit model describing bird movements, both locally (between wintering areas) and at the flyway scale. We investigated the effects of viral excretion duration and inactivation rate in water by simulating AIV spread with varying values for these two parameters. The results indicate that an efficient AIV dispersal in space is possible only for excretion durations longer than 7 days. Virus inactivation rate in the environment appears as a key parameter in the model because it allows local persistence of AIV over several months, the interval between two migratory periods. Virus persistence in water thus represents an important component of contamination risk as ducks migrate along their flyway. Based on the present modelling exercise, we also argue that HP H5N1 AIV is unlikely to be efficiently spread by Common Teal dispersal only. PMID:19802387

  19. The syrinx of the male mallard (Anas platyrhynchos): special anatomical features.

    Science.gov (United States)

    Frank, T; Probst, A; König, H E; Walter, I

    2007-04-01

    The aim of this study was to investigate the special anatomical and topographical features of the syrinx in male adult stock ducks (Anas platyrhynchos). The syrinx of the mallard is a tracheobronchial type, consisting of a tympanum, a pessulus, medial tympaniform membranes, interanular membranes, an interbronchial ligament (bronchidesmus), and bronchosyringeal cartilage semi-rings. Using a frozen sagittal section, it was possible to document the syringeal valve at the right lateral side of the tympanum. In the male stock duck the pessulus was massive and showed a longish oval, transparent area ventrally. The middle part of the pessulus had a nose-shaped process on its left side, on which the left medial tympaniform membrane originated. The left-sided, pear-shaped syringeal bulla was divided into a left major and right minor chamber by a double-walled, semilunar and opaque septum, approximately 5-6 mm in height. The first left and right C-shaped bronchosyringeal cartilage was more prominent than the other ones and showed partial ossification. In addition, the first left bronchosyringeal cartilage was obviously thicker than the right one. In conclusion, it can be stated that the syrinx in male adult mallards shows some notable specific anatomical features that might have an influence on vocalization. However, to understand the complex mechanism of vocalization in mallards, more investigations, especially obtained by sonography and endoscopy, will be needed.

  20. Projekts: Sporta kluba SIA "Gribasspēks" dibināšana Ventspilī

    OpenAIRE

    Rutkovska, Jana

    2016-01-01

    Projekta mērķis ir nodibināt sabiedrību ar ierobežotu atbildību „Gribasspēks”, kas sniegs klientiem iespēju apmeklēt trenažieru zāli, dažādas veida aerobikas nodarbības, CrossFit zāles treniņus, apļa treniņus un jogas nodarbības. Tādējādi, Ventspils pilsētas un tā novada iedzīvotājiem, būs iespēja saņemt kvalitatīvu pakalpojumu par vidējām cenām tirgū. Nodrošinot stabilu pozīciju vietējā tirgū, tas sniegs iespējas nākotnē paplašināties un pilnveidot uzņēmuma darbību. Darba pētīšanas metodes:...

  1. Suspended-sediment rating curve response to urbanization and wildfire, Santa Ana River, California

    Science.gov (United States)

    Warrick, J.A.; Rubin, D.M.

    2007-01-01

    River suspended-sediment concentrations provide insights to the erosion and transport of materials from a landscape, and changes in concentrations with time may result from landscape processes or human disturbance. Here we show that suspended-sediment concentrations in the Santa Ana River, California, decreased 20-fold with respect to discharge during a 34-year period (1968−2001). These decreases cannot be attributed to changes in sampling technique or timing, nor to event or seasonal hysteresis. Annual peak and total discharge, however, reveal sixfold increases over the 34-year record, which largely explain the decreases in sediment concentration by a nonlinear dilution process. The hydrological changes were related to the widespread urbanization of the watershed, which resulted in increases in storm water discharge without detectable alteration of sediment discharge, thus reducing suspended-sediment concentrations. Periodic upland wildfire significantly increased water discharge, sediment discharge, and suspended-sediment concentrations and thus further altered the rating curve with time. Our results suggest that previous inventories of southern California sediment flux, which assume time-constant rating curves and extend these curves beyond the sampling history, may have substantially overestimated loads during the most recent decades.

  2. III. Nesil (F3 Karadeniz Alabalığı (Salmo trutta labrax Pallas, 1814 Anaç Ağırlığı ve Kuluçka Verimi İlişkisi

    Directory of Open Access Journals (Sweden)

    Hakan Baki

    2015-07-01

    Full Text Available Bu çalışmada, farklı ağırlık gruplarındaki kuluçkahane kökenli (F3 Karadeniz alabalığı (Salmo trutta labrax Pallas, 1814 anaçlarının, üreme ve kuluçka verimi belirlenmiştir. Doğal anaçlardan üretilen (F3 balıklardan, araştırma için kullanılan dişi balıklarda ortalama ağırlık 1437±134,6 g (I grup, 2737±210,2 g (II grup ve 3785±162,3 g (III. grup’dır. Sağım işlemi sonrasında; mutlak yumurta verimliliği; gruplara göre sırasıyla (adet/anaç ortalama 2353±205, 5361±506, 6603±491; nispi yumurta verimliliği (adet/kg ortalama 1687±166, 1968±194, 1744±114 olarak belirlenmiştir. I., II. ve III. gruplarda yumurta çapı değerleri sırasıyla 4,89±0,16; 5,21±0,07; 5,31±0,06 (mm, yumurta ağırlıkları 77±6, 90±4, 96±3 mg olarak hesaplanmıştır. Döllenme oranı (% 95,49±1,23; 96,49±1,14; 98,39±0,52, gözlenme oranı (% 79,97±5,36; 84,20±5,23; 94,70±1,50 olarak tespit edilmiştir. Çıkış oranı (% 60,57±7,86; 67,66±6,42; 84,83±3,09; kuluçka randımanı (% ise 58,14±7,95; 69,77±6,25; 83,51±3,29 olarak bulunmuştur. Anaç ağırlığı ile mutlak yumurta verimi (0,0198; 0,0012; 0,3499 ve nispi yumurta verimi (0,3415; 0,0494; 0,00 arasındaki ilişkinin tespit edilmesi amacıyla regresyon analizi yapılmıştır ve sonuç olarak gruplar arasındaki fark önemlidir. Balık ağırlığı ile mutlak yumurta verimi arasında her grup için doğru orantılı zayıf ilişki, balık ağırlığı ile nispi yumurta verimi arasında I. ve II. grupta ters orantılı zayıf, III. grupta doğru orantılı zayıf ilişkilerin varlığı belirlenmiştir.

  3. ORF Alignment: NC_003076 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ana ... Length = 222 ... Query: 37 ... PFPHRENVEILKLPTRRGTEIVAMYVRHPMATSTLLYSHGNAADLGQMYELFIELSIHLK 96 ... ... ... PFPHRENVEILKLPTRRGTEIVAMYVRHPMATSTLLYSHGNAADLGQMYELFIELSIHLK Sbjct: 1 ... PFPHRENVEILKLPTRRGTEIVAMYVRHPMA

  4. Laysan Teal Anas laysanensis nesting phenology and site characteristics on Laysan Island

    Science.gov (United States)

    Reynolds, M.H.; Crampton, L.H.; Vekasy, M.S.

    2007-01-01

    Factors influencing breeding initiation of the endangered Laysan Teal Anas laysanensis were studied on Laysan Island in the Hawaiian Islands National Wildlife Refuge between 1998 and 2006. Sixty-two radio-tagged adult females were tracked for 30-180 days to locate and describe their nest sites. In addition, the Laysan Teal were surveyed daily during the breeding season, and 331 individually colour-ringed females were marked to identify new broods and timing of incubation initiation. Temperature, rainfall, and abundance of Brine Flies (Scatella sexnotata, an important prey) were measured in all years. Females nested on average 213 m (s.e. ?? 37 m) from the lake basin primarily in Eragrostis variablis, a native bunch grass with > 75% cover. The first observation of nesting in marine debris by Laysan Teal was reported. The initiation of incubation, at the start of the breeding season each year, varied from December to July, and differed significantly between years. Brine Fly abundance, temperature, and rainfall also varied significantly between years. The earlier the Brine Fly abundance peaked, the longer the duration of the breeding season. The length of the breeding season, measured as the number of days between the first and last clutches, varied from 83-192 days (mean 116 ?? 14 days). Annual brood production was positively correlated with spring peak abundance of Brine Flies. There was some evidence that it was negatively correlated with the number of adult females in the population. Rainfall, temperature, prey abundance, and the density of other birds on Laysan Island are likely to interact in influencing Laysan Teal's variable nesting phenology and productivity. ?? Wildfowl & Wetlands Trust.

  5. Arsenic, cadmium, copper, lead, and selenium in migrating blue-winged teal (Anas discors L.).

    Science.gov (United States)

    Fedynich, A M; Ballard, B M; McBride, T J; Estrella, J A; Garvon, J M; Hooper, M J

    2007-11-01

    The blue-winged teal (Anas discors L.), an abundant waterfowl species in North America, winters primarily in Mexico, Central America, and South America. Its transcontinental migratory behavior provides the opportunity to examine contaminant acquisition across a diverse biogeographic landscape that has varied environmental regulations and wildlife laws. We determined concentrations of arsenic (As), cadmium (Cd), copper (Cu), lead (Pb), and selenium (Se) in liver samples of blue-winged teal migrating through southern Texas during autumn 1998 (n = 47) and spring 1999 (n = 46). Concentrations for As (range 0.006 to 0.22 microg/g wet weight [ww]), Cd (range 0.007 to 8.14 microg/g ww), and Pb (range 0.012 to 1.79 microg/g ww) were at background levels for birds, whereas Cu (8.1 to 227.3 microg/g ww) and Se (0.36 to 5.07 microg/g ww) were increased in several individuals. All 24 hatch-year (HY) blue-winged teal had detectable levels of Cd, Cu, Pb, and Se, and eight had detectable levels of As. A seasonal effect was found for Cd, in which the mean Cd concentration in autumn was lower (p teal found the mean concentration of Cd was higher (p teal found that the mean concentration of Cu was higher (p 0.05) were found for the five elements examined. Results indicated that blue-winged teal were acquiring all five elements; that HY blue-winged teal were exposed to these elements in North America; and that increased Se concentrations in 15% of the 93-bird sample were at levels known to cause impairment in birds.

  6. Influence of groundwater development on the Doñana National Park ecosystems (Spain)

    Science.gov (United States)

    Suso, J.; Llamas, M. R.

    1993-01-01

    A great percentage of the wetlands in many countries has been destroyed over the last century, mainly because of drainage for agricultural reclamation. The role of groundwater in the behavior of wetlands has usually been recognized in a general way, but there are still few studies on the hydrogeology of wetlands. The Doñana National Park (DNP) is probably the most important National Park in the European Community. It is located on the estuary of the Guadalquivir River. The functioning of the DNP's ecosystems is closely related to the geohydrology of the area. The aquifer system consists essentially of unconsolidated Plio-Quaternary materials covering an area of 2400 km 2. Under the central marshy area (about 1800 km 2) the aquifer system is confined below low-permeability estuary deposits. Around most of the marshland the aquifer crops out and is recharged by rainfall. The DNP has an area of 730 km 2; part of it is in the marshland and part in the rechaarge area where the aquifer is phreatic. In the 1970s Spain's largest irrigation project using groundwater, covering a surface area of 240 km 2, was planned in an area bordering the national park. The initial project has been scaled down to 100 km 2, mainly as a result of protests by conservation groups. A review is presented of the various evaluations of the influence of groundwater extraction on the functioning of the wetlands. The authors consider that the water table decline as a result of pumpage for current irrigation could cause a large part of the ecotone—situated at the contact-line between the marshland and the phreatic aquifer—to deteriorate. This ecotone exists because it is a natural groundwater discharge area. The small streams feeding the marshland will also be depleted by groundwater extraction. Another significant problem will be surface and groundwater caused by agricultural activities.

  7. Insights from ANA-grade angiosperms into the early evolution of CUP-SHAPED COTYLEDON genes

    Science.gov (United States)

    Vialette-Guiraud, Aurélie C. M.; Adam, Hélène; Finet, Cédric; Jasinski, Sophie; Jouannic, Stefan; Scutt, Charles P.

    2011-01-01

    Background and Aims The closely related NAC family genes NO APICAL MERISTEM (NAM) and CUP-SHAPED COTYLEDON3 (CUC3) regulate the formation of boundaries within and between plant organs. NAM is post-transcriptionally regulated by miR164, whereas CUC3 is not. To gain insight into the evolution of NAM and CUC3 in the angiosperms, we analysed orthologous genes in early-diverging ANA-grade angiosperms and gymnosperms. Methods We obtained NAM- and CUC3-like sequences from diverse angiosperms and gymnosperms by a combination of reverse transcriptase PCR, cDNA library screening and database searching, and then investigated their phylogenetic relationships by performing maximum-likelihood reconstructions. We also studied the spatial expression patterns of NAM, CUC3 and MIR164 orthologues in female reproductive tissues of Amborella trichopoda, the probable sister to all other flowering plants. Key Results Separate NAM and CUC3 orthologues were found in early-diverging angiosperms, but not in gymnosperms, which contained putative orthologues of the entire NAM + CUC3 clade that possessed sites of regulation by miR164. Multiple paralogues of NAM or CUC3 genes were noted in certain taxa, including Brassicaceae. Expression of NAM, CUC3 and MIR164 orthologues from Am. trichopoda was found to co-localize in ovules at the developmental boundary between the chalaza and nucellus. Conclusions The NAM and CUC3 lineages were generated by duplication, and CUC3 was subsequently lost regulation by miR164, prior to the last common ancestor of the extant angiosperms. However, the paralogous NAM clade genes CUC1 and CUC2 were generated by a more recent duplication, near the base of Brassicaceae. The function of NAM and CUC3 in defining a developmental boundary in the ovule appears to have been conserved since the last common ancestor of the flowering plants, as does the post-transcriptional regulation in ovule tissues of NAM by miR164. PMID:21320879

  8. Mallard (Anas platyrhynchos) mortality and recovery rates vary by wing molt status at time of banding

    Science.gov (United States)

    Fleskes, Joseph P.; Halstead, Brian J.; Kohl, Jeffrey D.; Yarris, Gregory S.

    2017-01-01

    Recovery (i.e., shot, retrieved, and reported) rates and daily mortality risk of 52,330 adult Mallards (Anas platyrhynchos) leg-banded during pre-molt, in-molt, or post-molt during 1985–2011 were evaluated to better understand mortality during wing molt in dynamics of the Mallard population in California, USA. Recovery rates and non-hunting mortality risk varied by molt status at time of banding and California region where banded. Mallards banded during post-molt were 1.22 (95% credible interval = 1.10–1.32) times more likely to be recovered than Mallards banded pre-molt; recovery probability was similar for pre-molt and in-molt Mallards. Mallards banded post-molt had 0.43 (0.17–0.98) and in-molt 0.87 (0.51–1.49) times the daily risk of non-hunting mortality as Mallards banded pre-molt. Mallards were 0.92 (0.86–0.98) times as likely to be recovered, and daily risk of non-hunting mortality was 2.93 (1.79–4.94) times greater, if banded in Northeastern California than in California's Central Valley. Results indicate that high mortality during the molt period, especially in Northeastern California where most Mallards that breed in California molt, might be negatively affecting recovery (and potentially annual survival) of Mallards in California. Thus, conservation programs that reduce mortality during molt could help attain the desired population size for Mallards nesting in California.

  9. Insights from ANA-grade angiosperms into the early evolution of CUP-SHAPED COTYLEDON genes.

    Science.gov (United States)

    Vialette-Guiraud, Aurélie C M; Adam, Hélène; Finet, Cédric; Jasinski, Sophie; Jouannic, Stefan; Scutt, Charles P

    2011-06-01

    The closely related NAC family genes NO APICAL MERISTEM (NAM) and CUP-SHAPED COTYLEDON3 (CUC3) regulate the formation of boundaries within and between plant organs. NAM is post-transcriptionally regulated by miR164, whereas CUC3 is not. To gain insight into the evolution of NAM and CUC3 in the angiosperms, we analysed orthologous genes in early-diverging ANA-grade angiosperms and gymnosperms. We obtained NAM- and CUC3-like sequences from diverse angiosperms and gymnosperms by a combination of reverse transcriptase PCR, cDNA library screening and database searching, and then investigated their phylogenetic relationships by performing maximum-likelihood reconstructions. We also studied the spatial expression patterns of NAM, CUC3 and MIR164 orthologues in female reproductive tissues of Amborella trichopoda, the probable sister to all other flowering plants. Separate NAM and CUC3 orthologues were found in early-diverging angiosperms, but not in gymnosperms, which contained putative orthologues of the entire NAM + CUC3 clade that possessed sites of regulation by miR164. Multiple paralogues of NAM or CUC3 genes were noted in certain taxa, including Brassicaceae. Expression of NAM, CUC3 and MIR164 orthologues from Am. trichopoda was found to co-localize in ovules at the developmental boundary between the chalaza and nucellus. The NAM and CUC3 lineages were generated by duplication, and CUC3 was subsequently lost regulation by miR164, prior to the last common ancestor of the extant angiosperms. However, the paralogous NAM clade genes CUC1 and CUC2 were generated by a more recent duplication, near the base of Brassicaceae. The function of NAM and CUC3 in defining a developmental boundary in the ovule appears to have been conserved since the last common ancestor of the flowering plants, as does the post-transcriptional regulation in ovule tissues of NAM by miR164.

  10. Geothermal low-temperature reservoir assessment in northern Dona Ana County, New Mexico. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Lohse, R.L.; Schoenmackers, R.

    1985-07-01

    Fifty-four shallow temperature gradient holes were drilled along Interstate Highway 25 and the Rio Grande, from Las Cruces to Rincon, in northern Dona Ana County, New Mexico. This shallow temperature study (a joint exploration program performed with the cooperation and financial assistance of Trans-Pacific Geothermal, Inc. of Oakland, California) resulted in the discovery and confirmation of new and suspected major low-temperature geothermal resources. Elevated temperature and heat flow data suggest a thermal anomaly which can be generally described as being a nearly continuous linear feature which extends some 25 miles in length in a northwest-southeast direction with the only break being a 5-mile gap near the southern end of the study area. The width of the anomaly is only a few miles but tends to thicken around individual anomalies located within this larger anomaly. There are five main individual anomalies situated within the major anomaly and, listed from north to south, they are the: (1) Rincon Anomaly, (2) San Diego Mountain Anomaly, (3) Radium Springs KGRA, (4) Grande Dome Anomaly, and (5) Goat Mountain Anomaly. The main anomaly is well defined by a 4 HFU contour and the individual anomalies range from about 10 HFU to a high of near 30 HFU, estimated for the Rincon Anomaly. A bottom-hole temperature of 54/sup 0/C at 50 meters was also recorded at Rincon. Deeper drilling is certainly warranted and required in the Rincon Anomaly in order to discover and confirm the true commercially exploitable potential of this geothermal resource. 12 refs., 9 figs., 3 tabs.

  11. Rapid detection of K650E mutation in FGFR3 using uncultured amniocytes in a pregnancy affected with fetal cloverleaf skull, occipital pseudoencephalocele, ventriculomegaly, straight short femurs, and thanatophoric dysplasia type II

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2013-09-01

    Conclusion: A prenatal diagnosis of cloverleaf skull, short limbs, straight femurs, and occipital pseudoencephalocele should include a differential diagnosis of TD2. A molecular analysis of FGFR3 using uncultured amniocytes is useful for the rapid confirmation of TD2 at prenatal diagnosis.

  12. Santa Ana River Design Memorandum Number 1. Phase 2 GDM on the Santa Ana River Mainstem Including Santiago Creek. Volume 2. Prado Dam.

    Science.gov (United States)

    1988-08-01

    WV 4 j. "S~ S6 H L. L. T T T I 11916 o 6.0 C’-BV" 12* O-Or* f-0"r r-B" - -B itm 1 0 -Ii 0 W*V 1l-B" ’r im "ryPca IVTJIUIMi 6 Ill -WITO SAFTY AR LUE...F T PAYNS N IVAMNSIM ALFRI y~M N nn. iOAUI. VA LUE ENGINEEIIN4 140 SCALE;I IN,20 00F W.39. IG-?- SC SAFTY PA1 0V AYS ALUE ENQINEERINZ PAYS____________

  13. Strategic Environmental Assessment of the Effects of European Union's Regional Development Plans in Doñana National Park (Spain).

    Science.gov (United States)

    Oñate, Juan José; Pereira, David; Suárez, Francisco

    2003-05-01

    The European Union's Structural Funds are implemented by means of Regional Development Plans (RDP), whose regionally scoped environmental assessment is required. We highlight the deficiencies faced by this approach when subregional areas with high conservation natural values are involved and illustrate it with the case of the RDP of Andalusia region on Doñana National Park area (Spain). Commissioned by the World Wildlife Fund, a Strategic Environmental Assessment (SEA) of the Andalusian RDP was carried out focusing on Doñana and its area of influence. This is a complex space where some of the most environmentally valuable features in the continent coexist with a surrounding intense and multi-sector economic activity, threatening its conservation. In the absence of an established sustainability framework in the Region, a "trickle-down" SEA approach evidenced the need to produce a set of environmental, economic and social guidelines for sustainable management of land, against which the RDP objectives were tested for coherence. An "incremental" SEA approach was also tested, which involved the identification of 79 measures and actions stemming from the RDP provisions and other concurrent planning documents reviewed and the qualitative assessment of their individual and cumulative potential impacts on Doñana environments. In the light of the results, a set of complementary mitigating measures was proposed for inclusion in tiered stages of the planning process. Measures to avoid, reduce, remedy and monitor the major types of impact were proposed, including provisions for public participation. SEA emerges as an instrument for non-governmental organizations (NGOs) to carry out independent assessment of public development initiatives.

  14. [Early onset neonatal infections in the South of the Reunion Island: Incidence and use of 2002 ANAES risk criteria].

    Science.gov (United States)

    Gérardin, P; Fianu, A; Choker, G; Carbonnier, M; Jamal-Bey, K; Heisert, M; Picot, S; Favier, F; Robillard, P-Y; Barau, G

    2008-04-01

    The aim of this study was to describe the incidence of early onset neonatal infections (EONI) in the southern part of the Reunion Island, and to study the application of ANAES criteria. A cross-sectional study was made of data collected for all live births having occurred between 1st January 2001 and 31st December 2004. Four hundred and thirty-seven in 16,071 neonates (out of 21,231 live births) presented with a certain or probable EONI, accounting for a regional rate of 20 per thousand (CI95 % 18-23 per thousand). Among 437 EONIs, group B streptococcus (GBS) was reported in 70.5% of the cases (n=308), Gram negative bacteria in 19.9% (n=87), of which nearly two thirds of Escherichia coli (n=56). Applying ANAES criteria led to identify 380 EONIs among 437 proven infections (sensitivity: 87%, specificity: 26%). A logistic regression analysis identified eight EONI predictors for the 7015 neonates for whom the mother GBS screening was documented: GBS positive vaginal culture (OR 4.2; CI95% 3.3-5.4), unexplained preterm birth less than 35 weeks (OR 5.7; CI95% 3.7-8.7), prolonged rupture of membranes greater than or equal to 18 hours (OR 2.1; CI95% 1.4-3.0), maternal fever greater than or equal to 37.8 degrees C (OR 3.2; CI95% 2.3-4.5), fetal tachycardia greater than or equal to 160 ppm (OR 2.7; CI95% 1.8-4.0), and thin (OR 1.6; CI95% 1.2-2.1) or thick meconium-stained amniotic fluid (OR 3.0; CI95% 2.1-4.5) or fetid fluid (OR 14.8; CI95% 4.2-51.8). The incidence of EONIS far exceeded that observed in metropolitan France, and the ANAES criteria lack sensitivity and specificity.

  15. Medicīniska rakstura piespiedu līdzekļu noteikšanas procesuālā kārtība

    OpenAIRE

    Legzdiņa, Laura

    2017-01-01

    Maģistra darbā „Medicīniska rakstura piespiedu līdzekļu noteikšanas procesuālā kārtība” aplūkotas teorijā un praksē pastāvošās un aktuālās problēmas attiecībā uz medicīniska rakstura piespiedu līdzekļu noteikšanas procesuālo kārtību, lēmuma izpildi, izpildes kontroli un noteiktā medicīniska rakstura piespiedu līdzekļa grozīšanas un atcelšanas procesuālo kārtību. Medicīniska rakstura piespiedu līdzekļu noteikšanas procesuālās kārtības apskats ir iedalīts divās grupās – pirmstiesas kriminālproc...

  16. Iteratīvi izstrādājamās programmatūras testēšanas ekonomika

    OpenAIRE

    Vaisfelds, Leonīds

    2009-01-01

    Maģistra darbs „Iteratīvi izstrādājamās programmatūras testēšanas ekonomika” ir veltīts testēšanas procesam iteratīvās izstrādes metodes ietvaros. Galvenā problēma, kam tiek veltīts darbs, ir iteratīvās testēšanas stratēģijas izvēle un izmaksu optimizācija, kuras ietvaros primāri tiek analizēta manuālās un automatizētās testēšanas specifika. Darba teorētiskajā daļā ir analizēta iteratīvās izstrādes un iteratīvās testēšanas būtība un to aspekti. Rezultāti demonstrē iteratīvās izstrādes u...

  17. Germination of hyphal bodies of Pythium spiculum isolated from declining cork oaks at Doñana National Park (Spain

    Directory of Open Access Journals (Sweden)

    PAOLO DE VITA

    2012-01-01

    Full Text Available Pythium spiculum, a recently described new taxon, has been isolated from declining cork oaks (Quercus suber L. at Doñana National Park (south-western Spain. The microorganism can infect and cause root disease in Quercus, but currently it is unknown whether its hyphal bodies can germinate and infect host trees. These hyphal bodies, regardless of shape, have been shown to be able to germinate, producing long germ tubes, sometimes ramified. Zoospore production was not recorded, but hyphal bodies are potential host infective structures in dry soil conditions.

  18. Tendências da literatura juvenil contemporânea: os temas fraturantes na obra de Ana Saldanha

    OpenAIRE

    Ramos, Ana Margarida; Fonseca, Ana Daniela

    2015-01-01

    Pretende-se, neste estudo, proceder à análise das representa- ções das temáticas e universos fraturantes na obra narrativa juvenil de Ana Saldanha, autora portuguesa contemporânea de reconhecido mérito. Ao longo de quase duas décadas de atividade literária, os seus livros apresen- tam uma visão crítica da sociedade urbana atual, dando voz aos principais problemas e tensões dos destinatários preferenciais das suas obras, centra- dos no universo juvenil. O romance Para maiores de dezasseis (200...

  19. Caracterización de la Violencia Intrafamiliar en mujeres del municipio Santa Ana. Beni Bolivia Junio-Diciembre 2010.

    OpenAIRE

    Yacquelynes Corona-Hechavarria; Caridad Mastrapa-Reyes; Liliana Rogaciana Leyva-Ruiz; Zoila Caridad Reyes-Herrera

    2013-01-01

    Abordó una investigación descriptiva en municipio Santa Ana, Beni en Bolivia para determinar el comportamiento de las mujeres que sufren violencia intrafamiliar en el 2010. Los datos se obtuvieron mediante la revisión de las fichas familiares e individuales, se realizaron encuestas directas a las mujeres que sufrían violencia intrafamiliar. Se concluyo que el grupo de edad más afectado fue el de 25-34, con nivel de escolaridad secundaria, predominaron las amas de casa, se encontraron paciente...

  20. 'Pues tanto se esconde': Elusion at (inter)play in Ana Caro's El conde Partinuplés

    OpenAIRE

    Torres, Isabel

    2015-01-01

    El conde Partinuplés (first published 1653) is one of only two extant plays written by the Sevillan poet/dramatist Ana Caro Mallén de Soto (‘la décima musa sevillana’). Despite McKendrick's dismissal of the play as ‘extremely bad’, it has been the object of substantial critical scrutiny since the 1970s, impelled in great part by the production of modern editions (Luna and Delgado) and by Kaminsky's bio-biographical study (1973). Two responses have dominated: analysis of the play's imaginative...

  1. Biodiversidad de corales, gorgonias y esponjas en un sector del golfo de Ana María

    OpenAIRE

    González-Díaz, P.; Perera-Pérez, O.; Pérez-García, J. A.; Hernández-Fernández, L.

    2012-01-01

    La investigación se realizó en los meses de octubre de 2011 y marzo de 2012. A partir del análisis de imágenes satelitales se seleccionaron 41 sitios en el sector central del golfo de Ana María, región surcentral de Cuba. En dichos sitios se llevó a cabo el inventario de corales, gorgonias y esponjas. Para los corales, se analizó, además, el estado de salud. El inventario se realizó en los ecosistemas de manglar, pastizales y arrecifes de coral (biotopos de cabezos y fondos areno-...

  2. Female Dramatists and Censorship during the Last Period of the Franco Regime: Carmen Resino and Ana Diosdado

    Directory of Open Access Journals (Sweden)

    Diego Santos Sánchez

    2017-01-01

    Full Text Available Drawing on censorship files, this article studies how censorship tackled the theatre written by women and the role of the female playwright during the last years of the Franco regime. This will be illustrated through the two most representative and popular dramatists from the seventies: Carmen Resino and Ana Diosdado. The way their work was judged by the censors will be assessed and linked with the situation of earlier female authors from the Franco period as well as with the female theatre shaped during the post-Franco era.

  3. Hydrodynamic characteristics of the western Doñana Region (area of El Abalario), Huelva, Spain

    Science.gov (United States)

    Trick, Thomas; Custodio, Emilio

    The Doñana region, in southwestern Spain, comprises a large and important nature reserve, the wetlands of which are affected by human activity. Planting of an extensive eucalyptus forest in the 1950s and, more recently, the use of aquifers for irrigation and water supply for some coastal tourist resorts, have altered the natural groundwater-flow system. The area of the study is the western sector of the region, called El Abalario, which is a gentle topographic elevation between the Atlantic coast and La Rocina Creek (Arroyo de la Rocina). Underneath a variable layer of eolian sands with high dunes near the coast, thick Plio-Quaternary detritic strata, mostly fine silica sands, overlie marls. Near the base there is a variable, deltaic-origin layer of coarse sands and gravels. The dome-shaped water table, inside the sands, is close to the surface everywhere except beneath the dune belt, and small, temporary, shallow lagoons are numerous. The coarse sand and gravel layer conditions groundwater flow and behaves as a semiconfined layer between sands. A cross section through the area was simulated with a model to check the validity of the conceptual groundwater-flow pattern and its sensitivity to the hydraulic parameters. The model was calibrated using parameter values obtained by pumping tests and multilevel piezometric data, and checked against the estimated groundwater discharge into La Rocina Creek. Groundwater flows peripherally to the sea coast, to La Rocina Creek, or directly east and southeastward into the Doñana marshlands, in the Guadalquivir River delta. The average net aquifer recharge rate was calculated to be between 100 and 200 mm year-1 for the area covered by brush, but is remarkably lower in the areas of eucalyptus trees. The transient-state model shows that recharge varies spatially and is not clearly proportional to annual precipitation. Phreatic evapotranspiration plays an important role in decreasing the net value of aquifer recharge to

  4. Gênese do serviço de enfermagem do Hospital Federal de Bonsucesso: contribuição da escola Ana Néri Génesis del servicio de enfermería en el Hospital Federal de Bonsucesso: contribución de la Escuela Ana Neri Genesis of nursing service in Hospital Federal Bonsucesso: contribution of Ana Neri School

    Directory of Open Access Journals (Sweden)

    Camila Pureza Guimarães Silva

    2012-03-01

    Full Text Available O objeto deste estudo é a implantação do Serviço de Enfermagem no Hospital do Instituto de Aposentadoria e Pensões dos Empregados em Transportes e Cargas, atual Hospital Federal de Bonsucesso, no período 1946-1948. Seu objetivo é discutir a participação da Escola Ana Néri nesse processo. Fontes primárias: documentos escritos e depoimentos orais. Fontes secundárias: bibliografias acerca da temática. A abordagem teórico-metodológica apoiou-se em conceitos dos sociólogos Pierre Bourdieu e Maria Cecília Minayo. Evidenciou-se que a contribuição da Escola Ana Néri além de ter sido decisiva para o sucesso da implantação do Serviço de Enfermagem no Hospital do Instituto de Aposentadoria e Pensões dos Empregados em Transportes e Cargas também contribuiu para reforçar sua posição no espaço hospitalar da capital federal no governo Dutra.El objeto de este estudio es la implementación del Servicio de Enfermería en el Hospital del Instituto de Aposentadoria e Pensões dos Empregados em Transportes e Cargas, actual Hospital Federal de Bonsucesso, en el periodo 1946-1948. Su objetivo es discutir la participación de la Escuela Ana Neri en ese proceso. Fuentes primarias: documentos escritos y testimonios orales. Las fuentes secundarias: bibliografías sobre el tema. Los enfoques teóricos y metodológicos se basaron en los conceptos de los sociólogos Pierre Bourdieu y María Cecilia Minayo. Era evidente que la contribución de la Escuela Ana Neri, además de decisiva para la exitosa implementación del Servicio de Enfermería en el Hospital del Instituto de Aposentadoria e Pensões dos Empregados em Transportes e Cargas también contribuyó para fortalecer su posición en el espacio hospitalario de la Capital Federal en el Gobierno Dutra.The object of this study is the implementation of the Nursing Service at the Hospital of the Institute of Retirement and Pension Employee Transport and Cargo current Federal Bonsucesso Hospital

  5. Blood lead exposure concentrations in mottled ducks (Anas fulvigula) on the upper Texas coast

    Science.gov (United States)

    McDowell, Stephen K.; Conway, Warren C.; Haukos, David A.; Moon, Jena A.; Comer, Christopher E.; Hung, I-Kuai

    2015-01-01

    The mottled duck (Anas fulvigula) is a non-migratory waterfowl species dependent upon coastal marsh systems, including those on the Texas Chenier Plain National Wildlife Refuge (NWR) Complex, and considered a regional indicator species of marsh habitat quality. Research from the early 1970s, 1990s, and early-2000s indicated that mottled ducks continued to exhibit elevated wing-bone lead (Pb) concentrations, decades after implementation of non-toxic shot regulations. However, wing-bone concentrations reflect lifetime accumulation of Pb, whereas blood Pb concentrations reflect more recent exposure. To identify current potentially relevant temporal windows of Pb exposure, we collected 260 blood samples from mottled ducks during summer (n=124) and winter (n=136) from 2010–2012 on the Texas Chenier Plain NWR Complex. We quantified baseline blood Pb concentrations for all ages of mottled ducks, and hypothesized that blood lead concentrations would remain elevated above background levels (200 µg L–1) despite the 1983 and 1991 lead shot bans. Blood Pb concentrations ranged from below detection limits to >12,000 µg L–1, where >200 µg L–1 was associated with exposure levels above background concentrations. Male mottled ducks had the greatest blood Pb concentrations (30 times greater than females) with concentrations greater during winter than summer. Likewise, the proportion of exposed (>200 µg L–1) females increased from 14%–47% from summer to winter, respectively. Regardless of sex, adult mottled duck blood Pb concentrations were five times greater than juveniles, particularly during winter. We identified five plausible models that influenced blood Pb levels where year, site, and interactions among age*sex*season and between age*season were included in the top-ranked models. Frequency of exposure was greatest during winter, increasing from 12% in summer to 55% in winter, indicating that a temporal exposure window to environmental Pb exists between nesting

  6. How many Laysan Teal Anas laysanensis are on Midway Atoll? Methods for monitoring abundance after reintroduction

    Science.gov (United States)

    Reynolds, Michelle H.; Courtot, Karen; Hatfield, Jeffrey

    2017-01-01

    Wildlife managers often request a simple approach to monitor the status of species of concern. In response to that need, we used eight years of monitoring data to estimate population size and test the validity of an index for monitoring accurately the abundance of reintroduced, endangered Laysan Teal Anas laysanensis. The population was established at Midway Atoll in the Hawaiian archipelago after 42 wild birds were translocated from Laysan Island during 2004–2005. We fitted 587 birds with unique markers during 2004–2015, recorded 21,309 sightings until March 2016, and conducted standardised survey counts during 2007–2015. A modified Lincoln-Petersen mark-resight estimator and ANCOVA models were used to test the relationship between survey counts, seasonal detectability, and population abundance. Differences were found between the breeding and non-breeding seasons in detection and how maximum counts recorded related to population estimates. The results showed strong, positive correlations between the seasonal maximum counts and population estimates. The ANCOVA models supported the use of standardised bi-monthly counts of unmarked birds as a valid index to monitor trends among years within a season at Midway Atoll. The translocated population increased to 661 adult and juvenile birds (95% CI = 608–714) by 2010, then declined by 38% between 2010 and 2012 after the Toˉhoku Japan earthquake-generated tsunami inundated 41% of the atoll and triggered an Avian Botulism type C Clostridium botulinum outbreak. Following another severe botulism outbreak during 2015, the population experienced a 37% decline. Data indicated that the Midway Atoll population, like the founding Laysan Island population, is susceptible to catastrophic population declines. Consistent standardised monitoring using simple counts, in place of mark-recapture and resightings surveys, can be used to evaluate population status over the long-term. We estimate there were 314–435 Laysan Teal (95

  7. Demographic variation, reintroduction, and persistence of an island duck (Anas laysanensis)

    Science.gov (United States)

    Reynolds, Michelle H.; Weiser, Emily; Jamieson, Ian; Hatfield, Jeffrey S.

    2013-01-01

    Population variation in life history can be important for predicting successful establishment and persistence of reintroduced populations of endangered species. The Laysan duck (Anas laysanensis) is an endangered bird native to the Hawaiian Archipelago that was extirpated from most islands after the introduction of mammalian predators. Laysan ducks were restricted to a single remote island, Laysan Island (4.1 km2), for nearly 150 years. Since the species is not known to disperse between distant Hawaiian Islands today, 42 wild birds from Laysan Island were translocated to another mammalian predator-free low-lying atoll (Midway Atoll; 6.0 km2) to reduce extinction risk. We explored how variation in demography influences establishment and longer-term retention of genetic diversity (rare alleles) for reintroductions of this species. We observed dramatic differences in population growth between the source (λ = 1.18) and reintroduced (λ = 3.28) population. The number of eggs hatched at Midway Atoll was greater than at Laysan Island, however, we found no difference in hatching success (proportion of clutch hatched) between populations. Adult females produced 3 times as many fledglings per breeding year on Midway Atoll compared to Laysan Island. We estimated population abundance of both populations until 2010 and applied a Gompertz model with a Bayesian approach to infer density dependence, process variation, observation error, and carrying capacity for the Laysan Island and Midway Atoll populations. The carrying capacity from the Gompertz model for Midway Atoll (K = 883 ± 210 SD) was estimated to be greater than that of Laysan Island (K = 598 ± 76 SD). Translocations with small numbers of founders and no immigration can create population bottlenecks, leading to loss of genetic variation over time, and potentially reducing the reintroduced population's viability or its potential to serve as a source for future translocations. Therefore, we

  8. RNS izdalīšanas no žurku audiem ar TRI Reagent un RNAquenous-4PCR metožu salīdzināšana

    OpenAIRE

    Buka, Ieva

    2011-01-01

    Visu slimību un fizioloģisko stāvokļu attīstība un ārstēšana stingri saistīta ar to precīzu un ātru diagnostiku. Lai tas veiksmīgi notiktu, jāņem vērā modernās molekulāro tehnoloģiju metodes. Izdalot kvalitatīvu RNS materiālu un tālāk to analizējot ar dažādām metodēm, iespējams efektīvi un kompetenti strādāt gan ārstiem, gan biologiem, gan ģenētiķiem. Šī darba mērķis ir aplūkot un izanalizēt divas RNS izdalīšanas metodes – TRI Reagent metodi un RNAaqueos-4PCR metodi. Apskatīt šīs metodes, ...

  9. Bērnu ar dzirdes traucējumiem valodas attīstīšanas sekmēšana tēlotājdarbības nodarbībās pirmsskolā

    OpenAIRE

    Dargeļe, Gunita

    2013-01-01

    Darba nosaukums: Bērnu ar dzirdes traucējumiem valodas attīstīšanas sekmēšana tēlotājdarbības nodarbībās pirmsskolā. Darba autore: Gunita Dargeļe Darba vadītāja: Dr. paed., prof. Sarmīte Tūbele Pētījuma mērķis: Pētīt valodas attīstību ar tēlotājdarbību nodarbību palīdzību attīstīšanās procesu pirmsskolas vecuma bērnu ar dzirdes traucējumiem apmācībā. Pētījuma objekts: Valodas attīstības process pirmsskolas vecuma bērniem ar dzirdes traucējumiem. Pētījuma hipotēze: Valodas apguv...

  10. Pievienotās vērtības nodokļa piemērošanas pilnveidošanas iespējas Latvijā

    OpenAIRE

    Kulmanis, Andis

    2010-01-01

    Maģistra darbā ir pētīta pievienotās vērtības nodokļa piemērošana Latvijā. Lai uzlabotu nodokļu politikas kvalitāti Latvijā, darba mērķis ir, balstoties uz ekonomikas zinātnieku un speciālistu viedokļiem, kā arī dažādu valstu prakses analīzi kritiski novērtēt pievienotās vērtības nodokļa piemērošanu, konstatēt tās trūkumus un izteikt priekšlikumus PVN piemērošanas pilnveidošanai Latvijā. Darbs ir veidots no trijām nodaļām. Nodaļās tiek analizēti pievienotās vērtības nodokļa ...

  11. Comparison of APACHE II and three abbreviated APACHE II scores for predicting outcome among emergency trauma patients

    OpenAIRE

    Polita,Jorge Roberto; Gomez, Jussara; Friedman,Gilberto; Ribeiro, Sérgio Pinto

    2014-01-01

    Objective: to compare the ability of the APACHE II score and three different abbreviated APACHE II scores: simplified APACHE II (s-APACHE II), Rapid Acute Physiology score (RAPS) and Rapid Emergency Medicine score to evaluate in-hospital mortality of trauma patients at the emergency department (ED). Methods: retrospective analysis of a prospective cohort study. All patients' victims of trauma admitted to the ED, during a 5 months period. For all entries to the ED, APACHE II score was calcu...

  12. (II) complexes

    African Journals Online (AJOL)

    activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.

  13. ANALYSIS OF THE MALLARD DUCK POPULATION SIZE Anas platyrhynchos Linnaeus, 1758 (Aves: Anseriformes: Anatidae, Anathinae IN THE URBAN PART OF THE MILJACKA RIVER WATERCOURSE

    Directory of Open Access Journals (Sweden)

    Šefkija Muzaferović

    2013-09-01

    Full Text Available Species of the genus Anas Linnaeus, 1758 settle the entire area of Bosnia and Herzegovina. Seven species of this genus have so far been recorded, mostly on the natural lakes and artificial hydro-accumulations on the territory of Bosnia and Herzegovina. A few years ago, species from the Anas Linnaeus, 1758 genus began to settle intensively on the watercourses in the Sarajevo Valley. A significantly large number of birds from this genus were recorded on the river Miljacka, which represents the main watercourse of the Sarajevo Valley. Mallard ducks Anas platyrhynchos Linnaeus, 1758 were highest in recorded numbers. This species inhabits all three parts of the watercourse of the Miljacka River: higher, middle, and lower one. All three parts of the watercourse are specific in terms of water flow speed and anthropological influences. During the research, we collected data on the local population size of Anas platyrhynchos Linnaeus, 1758 on the Miljacka River workflow section from the locality "Babin Zub“ (Dariva to the confluence into the Bosnia River in the Sarajevsko Polje. Data collected by counting are the first and only available data from this region. In addition to counting, during the research we also collected data on a ratio between the sexes (sex ratio of local population of species Anas platyrhynchos Linnaeus, 1758. The presented data might be helpful in protecting the population of species Anas platyrhynchos Linnaeus, 1758, and its long-term survival on the Miljacka River, given the fact these birds (especially the males represent true ornament to the only river (polluted by organic waste in Sarajevo.Key words: wild duck, population, Miljacka River watercourse

  14. Akcīzes nodoklis un tā administrēšana Latvijas Republikā

    OpenAIRE

    Gertnere, Inga

    2014-01-01

    Akcīzes nodokļa ieņēmumi veido nozīmīgu valsts budžeta ieņēmumu daļu. Ar akcīzes nodokli apliekamās preces ir paaugstināta riska preces, kas ir īpaši pakļautas krāpnieciskiem darījumiem, kontrabandai. Diplomdarbā „Akcīzes nodoklis un tā administrēšana Latvijas Republikā” darba autores mērķis ir izpētīt akcīzes nodokļa lomu un administrēšanu Latvijas Republikā, izdarot secinājumus, izstrādāt priekšlikumus akcīzes nodokļa administrēšanas uzlabošanai. Diplomdarbs sastāv no 3 nodaļām. Dar...

  15. Five years of designing wireless sensor networks in the Doñana Biological Reserve (Spain): an applications approach.

    Science.gov (United States)

    Larios, Diego F; Barbancho, Julio; Sevillano, José L; Rodríguez, Gustavo; Molina, Francisco J; Gasull, Virginia G; Mora-Merchan, Javier M; León, Carlos

    2013-09-10

    Wireless Sensor Networks (WSNs) are a technology that is becoming very popular for many applications, and environmental monitoring is one of its most important application areas. This technology solves the lack of flexibility of wired sensor installations and, at the same time, reduces the deployment costs. To demonstrate the advantages of WSN technology, for the last five years we have been deploying some prototypes in the Doñana Biological Reserve, which is an important protected area in Southern Spain. These prototypes not only evaluate the technology, but also solve some of the monitoring problems that have been raised by biologists working in Doñana. This paper presents a review of the work that has been developed during these five years. Here, we demonstrate the enormous potential of using machine learning in wireless sensor networks for environmental and animal monitoring because this approach increases the amount of useful information and reduces the effort that is required by biologists in an environmental monitoring task.

  16. Efectos del AG3 Ethrel y Ana en la expresión sexual de Luffa Cylindrica l

    Directory of Open Access Journals (Sweden)

    Espejo Nohora

    1986-06-01

    Full Text Available In order to know the sex expression modification of Luffa cyllndrica L. cropped at San Antonio del Tequendama (Colombia the plants were treated with different dosis of GA 3 ' Ethrel and NAA. AII dosis of GA3 and Ethrel caused over two or three flowers of staminate inflorescence, the development of pistillate flower and latter were fertilized and they transformed to fruits. Whereas the NAA 10 ppm change the flowering pattern, namely of the pistillate flower which were inhibed and in their place an staminate inflorescence were developed. The sex expression modification took place at two, three or four nodes of the
    plants.Con el propósito de estudiar la modificación de la expresión sexual, plantas de estropajo (Luffa cyllndrica L. cultivadas en San Antonio del Tequendama (Colombia, se trataron con soluciones de diferentes concentraciones de AG 3, ETHREL Y ANA. Todos los tratamientos de AG3 y ETHREL indujeron sobre dos o tres flores de la inflorescencia masculina el desarrollo de flores pistiladas que fueron fertilizadas y transformadas en frutos, mientras que, con ANA 10 ppm se inhibió el desarrollo de la flor femenina y en su lugar se desarrolló una inflorescencia de flores masculinas.

  17. Satelīttelevīzijas signāla atšifrēšana

    OpenAIRE

    Mirošņičenko, Vladislavs

    2009-01-01

    Bakalaura darbs ir veltīts satelīta signāla televīzijas sfērā izpētīšanai. Tiek apskatītas televīzijas signāla, kurš iegūts caur satelīta sakariem, šifrēšanas metodes. Mūsdienu tehnoloģijas ir pārsātinātas ar daudzām metodēm signālu atšifrēšanā veidojot tādu servisu kā kardšārings.Darba mērķis ir izskatīt iespējamās atšifrēšanas legālās un nelegālās metodes praksē, pielietot tās, kā arī izskatīt to legalitātes jautājumu Latvijas Republikas teritorijā....

  18. Human parvovirus infection: rheumatic manifestations, angioedema, C1 esterase inhibitor deficiency, ANA positivity, and possible onset of systemic lupus erythematosus.

    Science.gov (United States)

    Fawaz-Estrup, F

    1996-07-01

    To investigate the clinical and serological characteristics of parvovirus infection. during 1993-4, 9 adult patients presented with polyarthralgias/polyarthritis. Clinical evaluation and serological studies of antinuclear antibodies, rheumatoid factor (RF), IgM and IgG antibodies to human parvovirus were done in all patients. Other serologies including anti-DNA, serum complement, and C1 esterase inhibitor levels were obtained in some patients. All 9 patients had polyarthralgias/polyarthritis, serological evidence of parvovirus B19 IgM and IgG antibodies, and normal sedimentation rate. All patients were seronegative for RF. Four women had positive ANA titers. In 2 of them the ANA positivity was transient. One developed systemic lupus erythematosus (SLE). Three women had angioedema of the face and tongue; one had transient C1 esterase inhibitor deficiency and another a transient decrease in C4 levels. Parvovirus may be implicated in the development of SLE as well as other chronic arthropathies. This is the first reported case of angioedema and decreased C1 esterase inhibitor levels associated with parvovirus infection.

  19. Personāla vadīšana uzņēmumā SIA „X”

    OpenAIRE

    Kličovs, Andrejs

    2007-01-01

    Dotā bakalaura tēma ir „Personāla vadīšana uzņēmumā SIA „X””. Uzņēmuma darbības veids ir izklaides centrs ar boulingu, bāru un biljardu. Darba mērķis ir izanalizēt uzņēmuma personāla vadību un izpetīt personāla vadības pamatprocesus. Bakalaura darbs sastav no trijām nodaļām Pirmā darba daļa sniedz darba teorētisko pamatojumu, dod skaidrojumu darbā pētītiem faktoriem, kā arī sniedz nelielu ieskatu personāla vadīšanas tendencēs Latvijā, Eiropā un pasaulē. Otrā daļa sastāv no uzņēmuma ...

  20. Sabiedriskās ēdināšanas pakalpojumu pieprasījumu analīze

    OpenAIRE

    Žuža, Evita

    2011-01-01

    Darba mērķis ir veikt sabiedriskās ēdināšanas pakalpojumu analīzi plānotajam uzņēmumam „Saldums”. Analīzē ir iekļauti posmi, kas ļauj izvērtēt un analizēt biznesa uzsākšanu. Ir noskaidrots, ka Jaunjelgavā nav pietiekams sabiedriskās ēdināšanas un konditorejas izstrādājumu piedāvājumu klāsts. Tamdēļ tiek veikta tirgus un attīstības iespēju analīze plānotajam uzņēmumam „Saldums”. Darba ietvaros tiek iegūti rezultāti par konkurentiem, kuri ir ne tikai Jaunjelgavas vietējie uzņēmumi, bet arī ...

  1. Banat-Crişana as Micro-destination – Elements of Tourism Image and Tourism Identity

    Directory of Open Access Journals (Sweden)

    Marilena STOIAN

    2011-09-01

    Full Text Available Geographical regions, according to some authors, are defined and delimited by criteria that vary from one geographical school to another. These criteria may be: scenic, functional, political-administrative, mental etc. (processed after Cocean cited in Neguţ, 2011, p. 157. They also can be combined according to the objectives/strategies that are elaborated for each branch of the economy: industry, agriculture, tourism, etc. In this regard, from tourism point of view, the region of Banat-Crişana was taken into consideration, that includes the following counties: Caraş-Severin, Timiş, Arad and Bihor. Due to the many land and air border points, it represents the first contact with the tourists coming from the West, with other words “its visiting card… crucial in formulating the first impressions regarding Romania” (Cocean, 2010, p. 201. The presented research aims to highlight the role of the image of the region of Banat-Crişana in building its own brand, by identifying its main tourist attractions and forms of tourism.

  2. Five Years of Designing Wireless Sensor Networks in the Doñana Biological Reserve (Spain): An Applications Approach

    Science.gov (United States)

    Larios, Diego F.; Barbancho, Julio; Sevillano, José L.; Rodríguez, Gustavo; Molina, Francisco J.; Gasull, Virginia G.; Mora-Merchan, Javier M.; León, Carlos

    2013-01-01

    Wireless Sensor Networks (WSNs) are a technology that is becoming very popular for many applications, and environmental monitoring is one of its most important application areas. This technology solves the lack of flexibility of wired sensor installations and, at the same time, reduces the deployment costs. To demonstrate the advantages of WSN technology, for the last five years we have been deploying some prototypes in the Doñana Biological Reserve, which is an important protected area in Southern Spain. These prototypes not only evaluate the technology, but also solve some of the monitoring problems that have been raised by biologists working in Doñana. This paper presents a review of the work that has been developed during these five years. Here, we demonstrate the enormous potential of using machine learning in wireless sensor networks for environmental and animal monitoring because this approach increases the amount of useful information and reduces the effort that is required by biologists in an environmental monitoring task. PMID:24025554

  3. Effects of Wastewater Discharges on Endocrine and Reproductive Function of Western Mosquitofish (Gambusia spp.) and Implications for the Threatened Santa Ana Sucker (Catostomus santaanae)

    Science.gov (United States)

    Jenkins, Jill A.; Goodbred, Steven L.; Olivier, Heather M.; Draugelis-Dale, Rassa O.; Alvarez, David A.

    2009-01-01

    The Santa Ana River (SAR) in southern California is impacted by effluents from wastewater treatment plants (WWTP), which are sources of organic wastewater compounds (OWCs) and urban runoff. The Santa Ana River is one of only three river basins supporting native populations of the federally listed Santa Ana sucker (Catostomus santaanae) at the time the fish was included on the list 2000. In 2004 and 2005, a U.S. Geological Survey and U.S. Fish and Wildlife Service study was undertaken to determine if the threatened Santa Ana sucker was potentially exposed to OWCs and endocrine disrupting compounds (EDCs) in the SAR by using the western mosquitofish (Gambusia affinis) as a surrogate fish model. Four Santa Ana River sites were chosen along a gradient of proximity to WWTP effluents: (1) a point source of tertiary treated wastewater effluent (TTWE), (2) Rialto Drain (just below a WWTP), (3) Prado Dam (11 kilometers [km] below WWTPs), and (4) Sunnyslope Creek (no WWTP but having urban runoff influence). A reference site having no WWTPs or urban runoff, Thousand Palms, was also sampled. Chemical analyses of passive sampler extracts results showed that 15 OWCs and EDCs were detected in water from the Santa Ana River sites. Many of these compounds contributed to activity from an estrogenic in-vitro assay that showed a significant potential for impacting endocrine and reproductive systems compared to the 25 organochlorine compounds detected in aquatic biota. The site showing compounds having highest influence on sex steroid hormone activities was the point source for TTWE. Sex steroid hormone levels, secondary sex characteristics, organosomatic indices, and sperm quality parameters indicated impairment of endocrine and reproductive function of male western mosquitofish in the Santa Ana River. Exposure to EDCs and consequent impairment in mosquitofish followed the gradient of proximity to WWTP effluents, where the most significant effects were found at TTWE point source and

  4. Repercusión de la demencia en los cuidadores primordiales del policlínico "Ana Betancourt" Repercussion of dementia in the fundamental carers of "Ana Betancourt" Polyclinic

    Directory of Open Access Journals (Sweden)

    Víctor T. Pérez Martínez

    2010-06-01

    Full Text Available Introducción: la demencia senil es reconocida actualmente como una entidad mayor en el orden socioeconómico, geriátrico, psiquiátrico y epidemiológico. Su atención representa un elevado costo emocional y económico para el paciente, la familia y el cuidador primordial. Objetivos: describir la repercusión psicosocial del síndrome demencial en los cuidadores primordiales del policlínico "Ana Betancourt". Métodos: se realizó un estudio descriptivo de corte transversal, durante el primer cuatrimestre del año 2009, en el policlínico "Ana Betancourt" del municipio Playa. Incluyó a 36 cuidadores de igual número de pacientes diagnosticados con demencia y enfermedad de Alzheimer, escogidos mediante muestreo por criterios. Resultados: los cuidadores primordiales eran en su mayoría féminas, hijas del paciente, en la quinta década de la vida, amas de casa, divorciadas y con un nivel de escolaridad de preuniversitario. El principal motivo de consulta de los cuidadores fue solicitar ayuda profesional para controlar los síntomas no cognitivos de la enfermedad. El cuidador dedica alrededor de 13 h diarias al cuidado del paciente que sufre de demencia, la mayor parte en la supervisión y vigilancia. Se encontró marcada afectación psicológica en el 64 % de los cuidadores. El nivel de sobrecarga o estrés en la población de cuidadores estudiada resultó elevado. Conclusiones: el cuidado del paciente que sufre de demencia se asocia a una sobrecarga y estrés relevantes que se expresa en la elevada morbilidad psicológica constatada en los cuidadores primordiales. Se recomienda diseñar un plan de intervención educativa dirigido a estos cuidadores para reducir la sobrecarga o estrés crónico que sufren.Introduction: senile dementia is nowadays recognized as a major entity in socioeconomic, geriatric, psychiatric and epidemiologic order. Its care represents a high emotional and economic cost for patient, family and fundamental carer

  5. Initial Analysis of Inner Crater Eruptive Deposits and Modeling of the 2005 Eruption of Ilamatepec (Santa Ana) Volcano, El Salvador

    Science.gov (United States)

    Martinez-Hackert, B.; Bajo, J. V.; Escobar, D.; Gutierrez, E.

    2011-12-01

    The October 1st, 2005 eruption of Ilamatepec Volcano, also known as Santa Ana Volcano in El Salvador, Central America, was a relatively small phreatic possibly phreatomagmatic eruption that generated an approximately 10km high ash column, with a volume of 1.5 million cubic meters. It generated small pyroclastic density currents, and shortly after the eruption a hot lahar. All of these volcanic products present grat danger to the surrounding population and the surrounding fertile lands growing coffe and sugar cane, the major export products. To better understand the eruptive behavior of this active composite volcano, older deposits need to be studied. An initial analysis of the inner crater eruptive deposits was undertaken in 2011. The many layers that can be seen within the crater suggest that Santa Ana volcano alternates its eruptions from phreatic to phreatomagmatic to magmatic, back to phreatomagmatic to phreatic with a period of rest in between. The last magmatic eruption of the Santa Ana Volcano took place in 1904. There are some historical records of it, and the scoracious materials and lava flows can still be well traced on the flanks and the crater of Ilamatepec, while the 2005 eruption has been eroded away in most areas of the flanks. Observations and data collected in 2005 and 2011 indicate that pyroclastic density currents went not only to the Southeastern flanks of the volcano, but also towards the Northwestern flanks, an area behind the highest rim of the volcano. Deposits up to 0.5 m were found in 2011, after significant erosion already had taken place. We present here the partial stratigraphic column taken within the inner crater walls that indicate alternating eruption styles from eruptions well pre-1904, with radiocarbon dating pending. Additionally, we show the results of the modeling of pyroclastic deposits, and lahars using Titan2D on DEMs extracted from the only topographic map (pre-1980) which has a 10 m resolution of the volcano, and a DEM

  6. Efecto de los vientos Santa Ana en las propiedades bio-ópticas frente a Baja California

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available A partir de las propiedades bio-ópticas, los coeficientes de absorción por partículas, detritos y fitoplancton (ap, adT, aφ se evaluó el efecto de los vientos Santa Ana en el océano frente a Baja California ocurridos durante octubre de 1999. Los vientos medidos en la estación meteorológica frente a la Bahía de Todos Santos y los determinados a partir de información de satélite indicaron tres eventos Santa Ana, caracterizados por baja humedad relativa, alta temperatura del aire y vientos con dirección predominante del este-noreste. Los valores del coeficiente de absorción de detritos (adT fueron hasta diez veces mayores en las muestras superficiales de octubre, con relación a las de enero, abril y agosto de 1999. Los altos valores de adT se debieron al material inorgánico aero-transportado por los vientos tierra-mar ocurridos del 9 al 11 y del 17 al 20 de octubre. Los coeficientes de absorción de las particulas (ap y el fitoplancton (aφ en la zona eufótica fueron mayores en abril, como resultado de la abundancia del fitoplancton. Los valores de ap, aφ y Kd para la zona eufótica fueron ajustados a una función de potencia con la clorofila como variable independiente, con una variancia explicada de 37%, 72% y 16%, respectivamente. Cuando se excluyeron del ajuste los valores de adT medidos en la superficie durante octubre, la clorofila explicó 82% de la variabilidad en los coeficientes de absorción (ap y aφ y 87% en Kd. A partir de la ecuación que relaciona la reflectancia de la radiancia espectral ascendente (Rrs con la clorofila, se determinó que ~80% de la variabilidad en la clorofila superficial es explicada por la razón de reflectancia Rrs(443/Rrs(555 medida en la zona de estudio. Las estimaciones regionales de clorofila a partir de información bioóptica obtenida en la columna de agua no fueron afectadas fuertemente por el polvo aero-transportado durante los vientos Santa Ana ocurridos en octubre de 1999.

  7. La Calle y Mañana: Las trayectorias divergentes de dos revistas políticas ecuatorianas

    Directory of Open Access Journals (Sweden)

    Hernán Ibarra

    2012-04-01

    Full Text Available English abstract: La Calle and Mañana: The divergent trajectories of two Ecuadorian political magazinesThe defunct magazines La Calle y Mañana played a major role in defining the political space from the mid-fifties to the early seventies of the twentieth century in Ecuador. The position taken and their integration into the political arena was such that these magazines had a clear identification within the limits of what wa considered left and right; and furthermore they had an impact on defining these political orientations. This article discusses the political contexts in which these publications came and went, their orientations and conflicts. Attention is given to the role played by Alejandro Carrión and Pedro Jorge Vera, intellectuals who promoted these magazines. The trajectories of the two publicaions demonstrate the conditions that they imposed on the cycles of Ecuadorian politics.Resumen:Las desaparecidas revistas La Calle y Mañana cumplieron un papel destacado en la definición del espacio político entre mediados de la década del cincuenta y comienzos de la década del setenta del siglo XX en el Ecuador. La toma de posición y su inserción en el espacio político, hacía que estas revistas tuvieran una clara identificación en los límites de lo que era considerado izquierda y derecha; y, además incidieron en definir esas orientaciones políticas. En este artículo se analizan los contextos políticos en los que estas publicaciones surgieron y desaparecieron, sus orientaciones y conflictos. Se presta atención a la función desempeñada por Ale-jandro Carrión y Pedro Jorge Vera, los intelectuales que animaron estas revistas. Las trayectorias de las dos publicaciones evidencian los condicionamientos que impusieron los ciclos de la política ecuatoriana.

  8. PENERAPAN PULSED ELECTRIC FIELD PADA PASTEURISASI SARI BUAH APEL VARIETAS ANA: KAJIAN KARAKTERISTIK NILAI GIZI, SIFAT FISIK, SIFAT KIMIAWI DAN MIKROBIA TOTAL Application of Pulsed Electric Field in Pasteurization of Apple Juice of Ana Cultivar : Study on

    Directory of Open Access Journals (Sweden)

    La Choviya Hawa

    2012-05-01

    Full Text Available Apple juice, extracted from apple of ana cultivar , was pasteurized using a pulsed electric field (PEF method. The aimof this research was to analyze the changes on nutritional, physical and chemical properties and total microbes from apple juice after pasteurization. The research was conducted from July until Oktober 2009 located in Malang. The PEF treatment was carried out using treatment time variation for 10, 20, 30, 40, 50 and 60 seconds. Several parameters of vitamin A and C, water content, density, pH, total soluable solid and total microbes were observed. The results showed that PEF treatment did not significantly change nutritional, physical and chemical properties and total microbes after pasteurization with PEF in compared with no treatment pasteurization. The highest degradation was found in treatment time for 60 seconds, i.e. 93.53 %. ABSTRAK Sari buah apel, yang diekstrak dari apel varietas ana, dipasteurisasi dengan metode pulsed electric field (PEF. Tujuanpenelitian ini adalah untuk mengetahui perubahan karakteristik nilai gizi, sifat fisik, kimiawi dan total mikrobia sari buah apel sesudah dipasteurisasi. Penelitian dilaksanakan bulan Juli sampai dengan Oktober 2009 di Malang. Penelitian ini menggunakan variasi waktu pengolahan 10, 20, 30, 40, 50 dan 60 detik. Parameter pengamatan yaitu vitamin A dan C, kadar air, berat jenis, pH, total padatan terlarut dan total mikrobia. Hasil penelitian menunjukkan bahwa nilai gizi, sifat fisik dan kimiawi dari sari apel  tidak mengalami perubahan signifikan dibandingkan sari apel tanpa perlakuan PEF. Penurunan total mikrobia terbesar pada waktu perlakuan 60 detik dengan efektivitas pembunuhan sebesar 93,53%.

  9. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  10. Videospēļu spēlēšanas ilguma saistība ar akadēmiskajiem sasniegumiem.

    OpenAIRE

    Karņickis, Edgars

    2013-01-01

    Bakalaura darba ”Videospēļu spēlēšanas ilguma saistība ar akadēmiskajiem sasniegumiem un agresiju” mērķis ir noskaidrot videospēļu spēlēšanas paradumu korelāciju ar skolēnu mācību sasniegumiem. Galvenie darbā izvirzītie pētījuma jautājumi: Vai ir novērojama statistiski nozīmīga saistība starp video spēļu spēlēšanas biežumu un agresijas izpausmēm? Vai ir novērojama statistiski nozīmīga saistība starp video spēļu spēlēšanas ilgumu un akadēmiskiem sasniegumiem (vidējo atzīmi dažādos māc...

  11. Personāla vadīšana kā uzņēmuma „Evolution Latvia” konkurētspējas faktors.

    OpenAIRE

    Kabrina, Elīna

    2013-01-01

    Elīna Kabrina. Bakalaura darbs ,, Personāla vadīšana kā uzņēmuma „Evolution Latvia” konkurētspējas faktors”. Bakalaura darba mērķis ir, pamatojoties uz teorijas atziņām par personāla vadīšanu un uzņēmuma „Evolution Latvia” personāla aptauju, izanalizēt uzņēmuma „Evolution Latvia” personāla vadīšanas funkcijas, kā arī izstrādāt priekšlikumus uzņēmuma personāla vadīšanas sistēmas pilnveidošanai. Darbs sastāv no trim nodaļām. Darba pirmajā nodaļā ir izskatīti personāla vadīšanas teorētis...

  12. Wingbeat frequency and the body drag anomaly: Wind-tunnel observations on a thrush nightingale (Luscinia luscinia) and a teal (Anas crecca)

    NARCIS (Netherlands)

    Pennycuick, C.J.; Klaassen, M.R.J.; Kvist, A.; Lindstrom, A.

    1996-01-01

    A teal (Anas crecca) and a thrush nightingale (Luscinia luscinia) were trained to fly in the Lund wind tunnel for periods of up to 3 and 16 h respectively. Both birds flew in steady flapping flight, with such regularity that their wingbeat frequencies could be determined by viewing them through a

  13. Genome Sequence of a Novel H14N7 Subtype Influenza A Virus Isolated from a Blue-Winged Teal (Anas discors) Harvested in Texas, USA.

    Science.gov (United States)

    Ramey, Andrew M; Reeves, Andrew B; Poulson, Rebecca L; Carter, Deborah L; Davis-Fields, Nicholas; Stallknecht, David E

    2016-06-09

    We report here the complete genome sequence of a novel H14N7 subtype influenza A virus (IAV) isolated from a blue-winged teal (Anas discors) harvested in Texas, USA. The genomic characteristics of this IAV strain with a previously undetected subtype combination suggest recent viral evolution within the New World wild-bird IAV reservoir. Copyright © 2016 Ramey et al.

  14. Disease dynamics and bird migration-linking mallards Anas platyrhynchos and subtype diversity of the influenza a virus in time and space

    NARCIS (Netherlands)

    G. Gunnarsson (Gunnar); N. Latorre-Margalef (Neus); K.A. Hobson (Keith); S.L. van Wilgenburg (Steven); J. Elmberg (Johan); B. Olsen (Björn); R.A.M. Fouchier (Ron); J. Waldenström (Jonas)

    2012-01-01

    textabstractThe mallard Anas platyrhynchos is a reservoir species for influenza A virus in the northern hemisphere, with particularly high prevalence rates prior to as well as during its prolonged autumn migration. It has been proposed that the virus is brought from the breeding grounds and

  15. Selindžera daiļdarbu tulkošanas leksiskās problēmas: vārdkopas un slengs

    OpenAIRE

    Zviedre-Pitkeviča, Lāsma

    2008-01-01

    Šajā darbā tiek aplūkotas vārdkopas, slengs un to tulkojums daiļliteratūrā. Teorētiskajā daļā tiek aplūkots tulkošanas process, tulkošanas metodes, tulkošanas problēmas, vārdkopas un slengs. Pētījums pierāda, ka tulkotājs ir atbildīgs par mērķa teksta saturu. Teorija tiek pielietota praksē analizējot vārdkopas, slengu un to tulkojumu daiļliteratūrā. Izdarītie secinājumi ir balstīti uz tulkošanas metožu, kas ir izmantotas tulkojot vārdkopas un slengu Selindžera daiļdarbos, analīzes. Rezultāti ...

  16. Vārdu ievietošanas testu teorētiskais pamatojums valodas snieguma novērtēšanā

    OpenAIRE

    Kunda, Tatjana

    2008-01-01

    Maģistra darbā iztirzāts vārdu ievietošanas testu pielietojums valodas snieguma novērtēšanā. Pētījuma merķis ir izanalizēt iespējas izmantot vārdu ievietošanas testus valodas snieguma novērtēšanā un noteikt to teorētisko pamatojumu. Tēmas aktualitāti nosaka pašreizējās tendences svešvalodu apmācībā un vērtēšanā, kuru uzmanības centrā ir komunikatīvā valodas vērtēšana. Maģistra darbā aprakstīti vārdu ievietošanas testu pielietojuma teorētiskie ietvari, kā arī izpētīti to teorētiska pamatoju...

  17. Kritiskās domāšanas stratēģijas latviešu valodas pamatprasmju attīstīšanai.

    OpenAIRE

    Stepanova, Ināra

    2006-01-01

    Pētījuma „Kritiskās domāšanas stratēģijas latviešu valodas pamatprasmju attīstīšanai 1.- 4. klasē” mērķis ir pētīt un analizēt kritiskās domāšanas stratēģiju ietekmi uz 1.- 4. klašu skolēnu latviešu valodas pamatprasmju attīstīšanu. Diplomdarbā autore analizē teorētisko literatūru par kritisko domāšanu pedagoģiskajā procesā, pēta un analizē jaunākā skolas vecuma bērnu valodas pamatprasmju attīstīšanas pedagoģiski psiholoģiskos līdzekļus, veic pedagoģisko eksperimentu par kritiskās domāšanas s...

  18. Konkurētspējas paaugstināšanas iespējas uzņēmumā SIA "Food Leaders"

    OpenAIRE

    Masterova, Olga

    2012-01-01

    Bakalaura darbs "Konkurētspējas paaugstināšanas iespējas uzņēmumā SIA "Food Leaders". Darba mērķis ir izpētīt uzņēmuma konkurētspēju un izstrādāt priekšlikumus tās attīstīšanai. Darbs sastāv no 3 daļām. Pirmā daļa ir veltīta konkurences un konkurētspējas teorētiskiem aspektiem: konkurences un konkurētspējas definīcijas, konkurētspējīgās priekšrocības radīšanas un attīstīšanas priekšnosacījumi un vērtēšanas metodes. Darba otrajā ir dots detalizēts uzņēmuma apraksts, pētīta nozares ...

  19. Risku vadības principu piemērošana valsts pārvaldē: Latvijas gadījuma izpēte

    OpenAIRE

    Vēvere, Marta

    2016-01-01

    Maģistra darbā „Risku vadības principu piemērošana valsts pārvaldē: Latvijas gadījuma izpēte” tika izvērtēta risku vadības izmantošana politikas plānošanas dokumentos un normatīvajos aktos, veikts riska inteliģences tests valsts pārvaldē strādājošajiem, kā arī notika intervija ar valsts pārvaldes ekspertu. Darbam tika izvirzīti izpētes jautājumi: “Kādos gadījumos risku vadība kā rīcībpolitikas uzlabošanas instruments tiek izmantots Latvijas valsts pārvaldē?” un „Kāds ir valsts pārvaldes iestā...

  20. MediANA - interaktiivne tööriist kommunikatsioonijuhtidele / Akvilė Katilienė ; intervjueerinud Kaidi Balder, Vahur Orrin

    Index Scriptorium Estoniae

    Katilienė, Akvilė

    2013-01-01

    BNS-i grupi peaanalüütik Balti riikides Akvilė Katilienė selgitab intervjuus, kuidas aitab ETA Monitooringu interaktiivne kommunikatsioonijuhtimise ja analüüsi keskkond mediANA tõhustada kommunikatsioonijuhi tööd

  1. Analysis of the effects of combustion emissions and Santa Ana winds on ambient ozone during the October 2007 southern California wildfires

    Science.gov (United States)

    A. Bytnerowicz; D. Cayan; P. Riggan; S. Schilling; P. Dawson; M. Tyree; L. Wolden; R. Tissell; H. Preisler

    2010-01-01

    Combustion emissions and strong Santa Ana winds had pronounced effects on patterns and levels of ambient ozone (O3) in southern California during the extensive wildland fires of October 2007. These changes are described in detail for a rural receptor site, the Santa Margarita Ecological Reserve, located among large fires in San Diego and Orange counties. In addition,...

  2. Vārdu krājuma apguve ar ekstensīvās lasīšanas palīdzību

    OpenAIRE

    Kezika, Jeļena

    2012-01-01

    Šī darba mērķis ir izpētīt un analizēt ekstensīvās lasīšanas ietekmes līmeni uz studentu vārdu krājumu, kā arī noteikt stratēģijas, kas var uzlabot lasīšanas izpratni untādējādi paplašināt studentu vārdu krājumu. Šī pētījuma teorētiskā daļa veltīta ekstensīvās un intensīvās lasīšanas teoriju, stratēģiju, vārdu krājuma jēdzienu un skolotāja lomas analīzei; aplūkotas arī problēmas, ar kurām studenti un skolotāji sastopas lasīšanas procesā. Empīriskajā daļā apkopoti nepieciešamie dati un izklāst...

  3. Comprehensive planning for the development of geothermal energy in Las Cruces and Dona Ana County, New Mexico. Final report, January 1-December 3, 1980

    Energy Technology Data Exchange (ETDEWEB)

    Starkey, A.H.; Gebhard, T.G.

    1981-03-01

    The key commercialization projects components are described: creation of a charter, a policy committee, use of technical expertise, the staff role and the formed adoption of policy recommendations, and their interrelationships. A technical state-of-the-art report for geothermal resources in Dona Ana County is presented including a geothermal evaluation and an environmental impact assessment. (MHR)

  4. Antibodies to H5 subtype avian influenza virus and Japanese encephalitis virus in northern pintails (Anas acuta) sampled in Japan

    Science.gov (United States)

    Ramey, Andy M.; Spackman, Erica; Yeh, Jung-Yong; Fujita, Go; Konishi, Kan; Reed, John A.; Wilcox, Benjamin R.; Brown, Justin D.; Stallknecht, David E.

    2013-01-01

    Blood samples from 105 northern pintails (Anas acuta) captured on Hokkaido, Japan were tested for antibodies to avian influenza virus (AIV), Japanese encephalitis virus (JEV), and West Nile virus (WNV) to assess possible involvement of this species in the spread of economically important and potentially zoonotic pathogens. Antibodies to AIV were detected in 64 of 105 samples (61%). Of the 64 positives, 95% and 81% inhibited agglutination of two different H5 AIV antigens (H5N1 and H5N9), respectively. Antibodies to JEV and WNV were detected in five (5%) and none of the samples, respectively. Results provide evidence for prior exposure of migrating northern pintails to H5 AIV which couldhave implications for viral shedding and disease occurrence. Results also provide evidence for limited involvement of this species in the transmission and spread of flaviviruses during spring migration.

  5. Bilateral testicular germ cell-sex cord-stromal tumor in a pekin duck (Anas platyrhynchos domesticus).

    Science.gov (United States)

    Leach, Stacey; Heatley, J Jill; Pool, Roy Ransom; Spaulding, Kathy

    2008-12-01

    An intact male white pekin duck (Anas platyrhynchos domesticus) was presented for examination because of respiratory distress and 2- to 3-month history of lameness and lethargy. Results of radiography, ultrasonography, and cytologic examination revealed a large neoplastic mass in the coelom. The duck was euthanatized, and results of necropsy revealed 2 large, lobulated masses in the coelom and a small nodule on the liver. Histopathologic examination of the large masses revealed a collision pattern testicular tumor consisting of Sertoli, seminoma, and interstitial cell components. The hepatic nodule was a metastatic lesion consistent with a Sertoli cell testicular tumor. This is the first reported case of a mixed germ cell-sex cord-stromal tumor in a duck.

  6. Os Filmes (Descritos de Ana Teresa Pereira: Nightmare, de Alfred Hitchcock, e The Double, de David Cronenberg

    Directory of Open Access Journals (Sweden)

    Amândio Pereira Reis

    2014-03-01

    Full Text Available Starting with a comparative reading of an ekphrastic text by Callistratus (3rd century AD and taking support from various studies on ekphrasis as a literary practice, from antiquity to present times until its acceptance as an intermedial literary genre, it is our goal to analyze two short stories by Ana Teresa Pereira which invent non-existent films by Hitchcock and Cronenberg. Therefore, we will have to confront a range of problems associated with ekphrastic description – the dialectic between reality and fiction; truth and falsity; imagination and reading – and with the (impossibilities of representation through image and/or words, including a set of questions posed by the specific transmedial relation that A. T. Pereira’s texts establish between Literature and Cinema. We will also take into account the concept of Pavle Levi’s “written film” as one possibility, among others, of genre identification for these narratives.

  7. Psychiatric nursing teaching at the Ana Nery School in the first half of the 20th century

    Directory of Open Access Journals (Sweden)

    Monique da Silva Carvalho

    2015-03-01

    Full Text Available The aim of this study was to describe the teaching of psychiatric nursing at Ana Néri Nursing School (EAN, between 1925 and 1954. Methodology: Socio-historical research whose sources were written documents and the oral statement of an ex-professor. The documentary analysis technique was used for data treatment. Results: For 27 years, the EAN did not introduce students into the psychiatric field due to the mental illness stigma, offering only theoretical disciplines, which were taught by physicians. Later there were theoretical disciplines with practical training in the classroom, and then theoretical disciplines with practice in psychiatric hospitals, taught by nurses. In conclusion, the law 775/49 lead the EAN to qualify a professor and initiate the reformulation of the nursing care provided at the Institute of Psychiatry of the University of Brazil, so as to adjust it to serve as a practical field and a model for teaching psychiatric nursing in Brazil.

  8. Helminth Community Dynamics in Populations of Blue-Winged Teal (Anas discors) Using Two Distinct Migratory Corridors.

    Science.gov (United States)

    Garvon, Jason M; Fedynich, Alan M; Peterson, Markus J; Pence, Danny B

    2011-01-01

    The influence of spatially distinct host subpopulations on helminth community structure and pattern was examined in a migratory avian host species. Forty helminth species represented by 24,082 individuals were collected from 184 blue-winged teal (Anas discors; BWT) from 2 primary migratory corridors in Florida (eastern migratory corridor; EMC) and Louisiana and Texas (western migratory corridor; WMC). Mean species richness was greater in BWT from the WMC (x̅±SE = 10.2 ± 0.3 species) than the EMC (8.6 ± 0.2). The helminth community from the WMC had higher abundances of 6 common/intermediate species. Corridor helminth communities were similar in species composition but less similar when incorporating abundances of those species. Overlapping distributions of phylogenetically related host species that share generalist helminth species across ecologically similar habitats seem to mitigate the isolating mechanisms that are necessary for the distinct coevolutionary pathways to develop between adjacent corridors.

  9. Music and Metaphor: Anaïs Nin’s Soundtrack in The Cities of the Interior

    OpenAIRE

    Wells, Amy D.

    2016-01-01

    The Cities of the Interior, roman-fleuve d’Anaïs Nin, offre un cas d’étude de l’intertextualité entre musique et littérature, et de la « traversée » entre ces deux arts. La présence de personnages musiciens, le champ lexical de la musique, et les références à des œuvres musicales contribuent à créer une bande-son audible lors de la lecture. Les évocations de la Symphonie en ré mineur de César Frank et de l’Isle Joyeuse de Claude Debussy poussent également les lecteurs à s’interroger sur le se...

  10. Komunikācijas prasmju pilnveidošana saskarsmes procesā autiskiem bērniem

    OpenAIRE

    Tomsone, Inese

    2007-01-01

    Diplomdarbā „Komunikācijas prasmju pilnveidošana saskarsmes procesā autiskiem bērniem” – teorētiski un praktiski tiek apskatītas un analizētas metodes un paņēmieni kā skolēniem ar autismu efektīvāk attīstīt komunikācijas prasmes. Teorētiski un praktiski izzināt alternatīvo komunikācijas līdzekļu izmantošanu komunikācijas prasmju pilnveidošanai saskarsmē, lai sekmētu autisko bērnu sociālo adaptāciju. Pētījuma mērķis: teorētiski un praktiski izzināt komunikācijas veidus un metodes saska...

  11. Desigualdades, diferencias y experiencias de (no pertenencia en educación, de Ana Bravo-Moreno (Ed.

    Directory of Open Access Journals (Sweden)

    Ivy Jacaranda Jasso Martínez

    2016-01-01

    Full Text Available El texto que nos presenta Ana Bravo-Moreno es una colección de capítulos que tienen como eje transversal el tema de la desigualdad generada a partir de la/s diferencia/s, analizando cómo se producen, negocian y cambian estas en contextos específicos. Se trata de un tema en boga, que se ha venido discutiendo en la última década, especialmente respecto a las diferentes posturas que han evidenciado y discutido la manera y estrategias en que se vive y experimenta la diversidad cultural en el aula y en la escuela. El libro consta de ocho capítulos, más la introducción, donde se pasa revista de diferentes casos (España, Argentina, Estados Unidos, Grecia, y cada capítulo aborda con diferente profundidad la temática.

  12. De mujeres deseadas a mujeres deseantes: entrevista con Ana María Fernández

    OpenAIRE

    Fernández, Ana María

    1997-01-01

    Esta entrevista se realizó a su paso por Bogotá, cuando participó como docente invitada en los cursos de postgrado del Programa de Estudios de Género, Mujer y Desarrollo de la Facultad de Ciencias Humanas de la Universidad Nacional de Colombia. Ana María Fernández, psicóloga clínica y psicoanalista, profesora de Estudios de la Mujer y Técnica de Grupos de la Facultad de Psicología de la Universidad de Buenos Aires, autora del libro "La Mujer de la Ilusión" (Paidós, 1993) y de numerosos artícu...

  13. Intrinsic vulnerability assessment of the aquifer in the Rižana spring chatcment by method SINTACS

    Directory of Open Access Journals (Sweden)

    2002-12-01

    Full Text Available In this paper is presented intrinsic vulnerability assessment of the aquifer in the Rižana spring chatcment by the method SINTACS. It is parametric method that takes into consideration seven parameters (depth to ground water, effective infiltration action, unsaturatedzone attenuation capacity, soil/overburden attenuation capacity, hydrogeological characteristics of the aquifer, hydraulic conductivity range of aquifer, hydrologic role of the topographic slope. Parameters are presented in grid information layers that wereelaborated on the basis of interpretation and GIS processing of geological, hydrogeological,speleological, topographical, meteorological and pedological data. According to the parametersimportance for vulnerability assessment, a multiplier (importance weight was assigned to each parameter. Final map of vulnerability is a result of overlaying (summing of weighted information layers (parameters and shows the catchment area of the Rižanaspring subdivided into six vulnerability classes.

  14. Copper (II)

    African Journals Online (AJOL)

    CLEMENT O BEWAJI

    ABSTRACT: A Schiff base was prepared from the reaction of 2 - amino - 3 – methylbutanoic acid and 2, 4 - pentanedione. The reaction of the prepared Schiff base with ethanolic solution of copper (II) chloride formed diaquo bis( N – 2 – amino – 3 - methylbutyl - 2, 4 - pentanedionato) copper (II) complex. The Schiff base is ...

  15. A parapatric propensity for breeding precludes the completion of speciation in common teal (Anas crecca, sensu lato).

    Science.gov (United States)

    Peters, Jeffrey L; McCracken, Kevin G; Pruett, Christin L; Rohwer, Sievert; Drovetski, Sergei V; Zhuravlev, Yuriy N; Kulikova, Irina; Gibson, Daniel D; Winker, Kevin

    2012-09-01

    Speciation is a process in which genetic drift and selection cause divergence over time. However, there is no rule dictating the time required for speciation, and even low levels of gene flow hinder divergence, so that taxa may be poised at the threshold of speciation for long periods of evolutionary time. We sequenced mitochondrial DNA (mtDNA) and eight nuclear introns (nuDNA) to estimate genomic levels of differentiation and gene flow between the Eurasian common teal (Anas crecca crecca) and the North American green-winged teal (Anas crecca carolinensis). These ducks come into contact in Beringia (north-eastern Asia and north-western North America) and have probably done so, perhaps cyclically, since the Pliocene-Pleistocene transition, ~2.6 Ma, when they apparently began diverging. They have diagnosable differences in male plumage and are 6.9% divergent in the mtDNA control region, with only 1 of 58 crecca and 2 of 86 carolinensis having haplotypes grouping with the other. Two nuclear loci were likewise strongly structured between these teal (Φ(st) ≥ 0.35), but six loci were undifferentiated or only weakly structured (Φ(st) = 0.0-0.06). Gene flow between crecca and carolinensis was ~1 individual per generation in both directions in mtDNA, but was asymmetrical in nuDNA, with ~1 and ~20 individuals per generation immigrating into crecca and carolinensis, respectively. This study illustrates that species delimitation using a single marker oversimplifies the complexity of the speciation process, and it suggests that even with divergent selection, moderate levels of gene flow may stall the speciation process short of completion. © 2012 Blackwell Publishing Ltd.

  16. Cell-cycle protein modifications in the kidney of Mus spretus from Doñana National Park.

    Science.gov (United States)

    Leoni, Silvia; Torrice, Alessia; Chiuchiarelli, Giorgia; Bruscalupi, Giovannella; Cristaldi, Mauro

    2008-02-01

    On April 1998 a tailing dam of the Aznalcollar pyrite mine partially collapsed and released to the Guadiamar river acidic water and mud containing toxic metals threatening the Doñana National Park, a Spanish wildlife reserve located near the estuary of Guadalquivir river. To assess the possible biological effects on terrestrial ecosystems, biochemical markers were assayed in the kidneys of Algerian mice (Mus spretus) collected in several areas of Doñana and Guadiamar river. Biomarkers assayed are proteins involved in cell cycle regulation, in particular cyclins and their associated kinases, and some cell cycle inhibitors. Moreover Mitogen Activated Protein Kinases (MAPK), a signal transduction system involved in cell division, p53, a protein involved in growth arrest after DNA damage, and HSP70, an early stress-induced protein, were assayed. The kidneys of animals collected one year after the ecological disaster had increased levels of PCNA (proliferating cell nuclear antigen), indicating an increased number of cells in the S phase of cell cycle. This shift of cells from G0 to S phase is due to increased levels of cyclins D1, E, and A, to decreased levels of p21 and p27 cdk inhibitors, and to activation of MAPK cascade. On the other hand, p53 and HSP70 levels are not changed. These data demonstrate that the presence of toxic metals after ecological disaster provoked the induction of kidney cell proliferation interpretable as a compensatory cell growth after tissue damage and apoptosis, and that could lead to the genomic instability characteristic of cancer cell.

  17. POR UMA EPISTEME DIALÓGICA, SENSÍVEL E CRIATIVA: UMA HOMENAGEM À ANA CLARA TORRES RIBEIRO

    Directory of Open Access Journals (Sweden)

    Anita Loureiro de Oliveira

    2012-09-01

    Full Text Available 1024x768 Normal 0 21 false false false PT-BR X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Este artigo pretende ser uma homenagem à Professora Ana Clara Torres Ribeiro e ao mesmo tempo uma reunião de algumas das contribuições de seu pensamento para a consolidação de uma episteme dialógica, sensível e criativa, experimentada na pesquisa para a Tese Música e Vida Urbana (OLIVEIRA, 2008 e que em projetos acadêmicos e práticas pedagógicas e de pesquisa. Ana Clara tinha um olhar sensível para o outro. Este gesto não só era experimentado no cotidiano, como constituía parte significativa de sua proposta de teórico-metodológica.

  18. Rapid scenarios and observed intensities

    Directory of Open Access Journals (Sweden)

    Franco Pettenati

    2012-10-01

    Full Text Available After a destructive earthquake, national Governments need to know the approximate amount of damage, the number of casualties, and the financial losses as soon as possible. Rapid scenarios are also used to inform the general public; see the widely used Shakemap package [Wald et al. 1999, 2006] of the US Geological Survey (USGS and the one modified by the Istituto Nazionale di Geofisica e Vulcanologia (INGV; National Institute of Geophysics and Volcanology, which is reproduced for Figure 1. The general matter of the use of intensities in damage scenarios was discussed in a special session at the 2008 Annual Meeting of the Seismological Society of America (http://www.seismosoc.org/meetings/2008/specialsessions.html, and was also discussed in the NIS-1 session of the European Congress in Moscow, in August 2012 (http://www.esc2012-moscow.org/esc_thematicareas.html. The purposes of the present report are to: (i compare different types of intensities; (ii check two rapid scenarios of intensity; and (iii understand whether the KF formula [Sirovich 1996, Sirovich et al. 2009] can be used as a new 'attenuation' relationship to improve rapid scenarios. […

  19. Adiabatic Betatron deceleration of ionospheric charged particles: a new explanation for (i) the rapid outflow of ionospheric O ions, and for (ii) the increase of plasma mass density observed in magnetospheric flux tubes during main phases of geomagnetic s

    Science.gov (United States)

    Lemaire, Joseph; Pierrard, Viviane; Darrouzet, Fabien

    2013-04-01

    Using European arrays of magnetometers and the cross-phase analysis to determine magnetic field line resonance frequencies, it has been found by Kale et al. (2009) that the plasma mass density within plasmaspheric flux tubes increased rapidly after the SSC of the Hallowe'en 2003 geomagnetic storms. These observations tend to confirm other independent experimental results, suggesting that heavy ion up-flow from the ionosphere is responsible for the observed plasma density increases during main phases of geomagnetic storms. The aim of our contribution is to point out that, during main phases, reversible Betatron effect induced by the increase of the southward Dst-magnetic field component (|Δ Bz|), diminishes slightly the perpendicular kinetic energy (W?) of charged particles spiraling along field lines. Furthermore, due to the conservation of the first adiabatic invariant (μ = Wm/ Bm) the mirror points of all ionospheric ions and electrons are lifted up to higher altitudes i.e. where the mirror point magnetic field (Bm) is slightly smaller. Note that the change of the mirror point altitude is given by: Δ hm = -1/3 (RE + hm) Δ Bm / Bm. It is independent of the ion species and it does not depend of their kinetic energy. The change of kinetic energy is determined by: Δ Wm = Wm Δ Bm / Bm. Both of these equations have been verified numerically by Lemaire et al. (2005; doi: 10.1016/S0273-1177(03)00099-1) using trajectory calculations in a simple time-dependant B-field model: i.e. the Earth's magnetic dipole, plus an increasing southward B-field component: i.e. the Dst magnetic field whose intensity becomes more and more negative during the main phase of magnetic storms. They showed that a variation of Bz (or Dst) by more than - 50 nT significantly increases the mirror point altitudes by more than 100 km which is about equal to scale height of the plasma density in the topside ionosphere where particles are almost collisionless (see Fig. 2 in Lemaire et al., 2005

  20. Rapid Prototyping Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The ARDEC Rapid Prototyping (RP) Laboratory was established in December 1992 to provide low cost RP capabilities to the ARDEC engineering community. The Stratasys,...

  1. Periodismo especializado en medio ambiente: el caso Doñana como paradigma de manipulación informativa

    Directory of Open Access Journals (Sweden)

    Dr. Carlos Elías

    2002-01-01

    Full Text Available Este artículo es parte de una tesis doctoral titulada “Flujos de información entre científicos y prensa” en la que, entre otros asuntos, se aborda la manipulación política de la información científica. En esta tesis se utilizó la metodología de investigación participativa, que implicó, entre otras circunstancias, que quien suscribe este artículo estuviera seis meses en el gabinete de prensa del CSIC como becario para investigar a fondo cómo se gestiona la información desde un gabinete de prensa gubernamental. En el artículo se demuestra la gran influencia de los gabinetes de comunicación en la prensa española. También se analiza cómo se manipula el mensaje y cómo se seleccionan las fuentes para someter los criterios científicos a los políticos. Para demostrar esta hipótesis se han estudiado todas las informaciones que aparecieron sobre el desastre ecológico de Doñana en la prensa de tirada nacional desde abril hasta julio de 1998. Se han relacionado las diferentes actuaciones del gabinete con la teoría general de la gestión de crisis informativas.ABSTRACTThis research are included in a doctoral thesis about information flows between scientists and press. We use participative research methods. For that, the author got a fellowship of CSIC, the biggest spanish research center, and worked as a member of its press office during a six months periods. This article shows how scientific press offices have a very big influence in spanish press. Also the research proves how messages is manipulated and how the scientific sources are selected in order to indentify scientific and politics criteria. For demostrate how this manipulation is done, I analyse press information about Doñana ecological catastrophe published in 1998 in spanish national newspapers from april to july. Also these dates proves the relationship with general theories about informative crisis.

  2. instU_3d_ana_Np: MERRA 3D Analyzed State, Meteorology Diurnal 0.667 x 0.5 degree V5.2.0 (MAIUNPANA) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The MAIUNPANA or instU_3d_ana_Np data product is the MERRA Data Assimilation System 3-Dimensional instantaneous, on pressure levels, at native resolution. MERRA, or...

  3. Can Administration of Potentized Homeopathic Remedy, Arsenicum Album, Alter Antinuclear Antibody (ANA Titer in People Living in High-Risk Arsenic Contaminated Areas? I. A Correlation with Certain Hematological Parameters

    Directory of Open Access Journals (Sweden)

    Philippe Belon

    2006-01-01

    Full Text Available To examine whether elevated antinuclear antibody (ANA titers reported in random human population of arsenic contaminated villages can be reverted to the normal range by administration of a potentized homeopathic drug, Arsenicum album, randomly selected volunteers in two arsenic contaminated villages and one arsenic-free village in West Bengal (India were periodically tested for their ANA titer as well as various blood parameters in two types of experiments: ‘placebo-controlled double blind’ experiment for shorter duration and ‘uncontrolled verum fed experiment’ for longer duration. Positive modulation of ANA titer was observed along with changes in certain relevant hematological parameters, namely total count of red blood cells and white blood cells, packed cell volume, hemoglobin content, erythrocyte sedimentation rate and blood sugar level, mostly within 2 months of drug administration. Thus, Arsenicum album appears to have great potential for ameliorating arsenic induced elevated ANA titer and other hematological toxicities.

  4. NeoPalAna: Neoadjuvant Palbociclib, a Cyclin-Dependent Kinase 4/6 Inhibitor, and Anastrozole for Clinical Stage 2 or 3 Estrogen Receptor-Positive Breast Cancer.

    Science.gov (United States)

    Ma, Cynthia X; Gao, Feng; Luo, Jingqin; Northfelt, Donald W; Goetz, Matthew; Forero, Andres; Hoog, Jeremy; Naughton, Michael; Ademuyiwa, Foluso; Suresh, Rama; Anderson, Karen S; Margenthaler, Julie; Aft, Rebecca; Hobday, Timothy; Moynihan, Timothy; Gillanders, William; Cyr, Amy; Eberlein, Timothy J; Hieken, Tina; Krontiras, Helen; Guo, Zhanfang; Lee, Michelle V; Spies, Nicholas C; Skidmore, Zachary L; Griffith, Obi L; Griffith, Malachi; Thomas, Shana; Bumb, Caroline; Vij, Kiran; Bartlett, Cynthia Huang; Koehler, Maria; Al-Kateb, Hussam; Sanati, Souzan; Ellis, Matthew J

    2017-08-01

    Purpose: Cyclin-dependent kinase (CDK) 4/6 drives cell proliferation in estrogen receptor-positive (ER(+)) breast cancer. This single-arm phase II neoadjuvant trial (NeoPalAna) assessed the antiproliferative activity of the CDK4/6 inhibitor palbociclib in primary breast cancer as a prelude to adjuvant studies.Experimental Design: Eligible patients with clinical stage II/III ER(+)/HER2(-) breast cancer received anastrozole 1 mg daily for 4 weeks (cycle 0; with goserelin if premenopausal), followed by adding palbociclib (125 mg daily on days 1-21) on cycle 1 day 1 (C1D1) for four 28-day cycles unless C1D15 Ki67 > 10%, in which case patients went off study due to inadequate response. Anastrozole was continued until surgery, which occurred 3 to 5 weeks after palbociclib exposure. Later patients received additional 10 to 12 days of palbociclib (Cycle 5) immediately before surgery. Serial biopsies at baseline, C1D1, C1D15, and surgery were analyzed for Ki67, gene expression, and mutation profiles. The primary endpoint was complete cell cycle arrest (CCCA: central Ki67 ≤ 2.7%).Results: Fifty patients enrolled. The CCCA rate was significantly higher after adding palbociclib to anastrozole (C1D15 87% vs. C1D1 26%, P Palbociclib enhanced cell-cycle control over anastrozole monotherapy regardless of luminal subtype (A vs. B) and PIK3CA status with activity observed across a broad range of clinicopathologic and mutation profiles. Ki67 recovery at surgery following palbociclib washout was suppressed by cycle 5 palbociclib. Resistance was associated with nonluminal subtypes and persistent E2F-target gene expression.Conclusions: Palbociclib is an active antiproliferative agent for early-stage breast cancer resistant to anastrozole; however, prolonged administration may be necessary to maintain its effect. Clin Cancer Res; 23(15); 4055-65. ©2017 AACR. ©2017 American Association for Cancer Research.

  5. Latviešu valodas prasmju attīstīšanas veicināšana mazākumtautības pirmsskolas izglītības iestādē

    OpenAIRE

    Radionova, Alla

    2017-01-01

    Darba autore : Alla Radionova Darba veids: Diplomdarbs Studiju programma: Pirmsskolas izglītības skolotājs Darba zinātniskā vadītāja: Ieva Margeviča-Grinberga, Latvijas Universitātes docente Mērķis: Izpētīt latviešu valodas prasmju attīstības veicināšanas iespējas mazākumtautības pirmsskolas izglītības iestādē. Pētījuma hipotēze: pirmsskolas vecuma bērnam otrās valodas apguve būs sekmīga, ja: •bērni nodarbību laikā izjutīs pozitīvu noskaņojumu un interesi par otrās valodas mācīšanos; •p...

  6. Kumarīnu šķelšanas reakcijas ar skābekļa un slāpekļa nukleofiliem

    OpenAIRE

    Parkova, Anete

    2011-01-01

    Kumarīnu šķelšanas reakcijas ar skābekļa un slāpekļa nuklofiliem. Parkova A., zinātniskie vadītāji Dr.chem. Trapencieris P., Mg.sc.ing. Vendiņa I. Bakalaura darbs, 42 lappuses, 18 attēli, 7 tabulas, 32 literatūras avoti. Latviešu valodā. KUMARĪNI, KANĒĻSKĀBES ATVASINĀJUMI, SULFAMĀTI, SULFAMĪDI Darbā tika veiktas kumarīnu cikla šķelšanas reakcijas ar skābekļa un slāpekļa nukleofiliem, lai iegūtu o-hidroksikanēļskābes esterus un amīdus. Izmantojot von Pehmana reakciju tika sintezēti kumar...

  7. Darbinieku motivācijas pilnveidošanas iespējas būvmateriālu lielveikalā SIA "Būve".

    OpenAIRE

    Ulmane, Inga

    2007-01-01

    Bakalaura darba tēma ir „Darbinieku motivācijas pilnveidošanas iespējas būvmateriālu lielveikalā SIA „BŪVE” ”. Bakalaura darbs sastāv no 4 daļām: 1.daļā ir apskatītas dažādas motivācijas teorijas. Satura motivācijas teorijās, piemēram, A. Maslova vajadzību hierarhijā, K. Alderfera ERG teorijā, F. Hercberga divfaktoru teorijā un Makklelanda „ pieredzes – vajadzību ” teorijā ir aprakstītas cilvēku vajadzības un mērķi, kas attiecīgi ir arī darba motivators. Norises motivēšanas teorijās, p...

  8. Sociālo tīklošanas vietņu lietošanas paradumi jauniešu auditorijā: "Facebook.com", "Twitter.com", "Draugiem.lv" piemēru analīze

    OpenAIRE

    Serkova, Sandra

    2012-01-01

    Bakalaura darba tēma ir „Sociālo tīklošanas vietņu lietošanas paradumi jauniešu auditorijā: „Facebook.com”, „Twitter.com”, „Draugiem.lv” piemēru analīze”. Darba mērķis ir izpētīt pēc kādiem sociālo tīklošanas vietņu paradumiem jaunieši izvēlas atrasties kādā konkrētā sociālo tīklošanas vietnē. Darba teorētiskā daļa balstās uz Denisa Makveila (Deniss McQuail) lietojuma un apmierinājuma teoriju, kas palīdz saprast, pēc kā tiecās mediju lietotājs, izmantojot masu medijus. Teorija par sociāli...

  9. A queda das ações no mercado dos afetos: medo, amor e solidão em Ana Luiza Escorel, Mariana Portella e Elvira Vigna

    Directory of Open Access Journals (Sweden)

    Lucia Helena

    2016-01-01

    Full Text Available Estudio de la situación de los personajes en tres novelas escritas por Ana Luisa Escorel, Mariana Portella y Elvira Vigna, que se examinan bajo el impacto de la crisis contemporánea de los afectos en la sociedad globalizada. El artículo analiza las novelas: Anel de vidro (Escorel, O outro lado da sombra (Portella; O que deu para fazer em matéria de história de amor (Vigna.

  10. Estudio cefalométrico en una población adulta colombiana contemporánea usando el análisis de Legan y Burstone*

    Directory of Open Access Journals (Sweden)

    Timizay Fanory Mahecha Ruiz

    2017-07-01

    Full Text Available Objetivos: Establecer valores promedio en tejidos duros del análisis cefalométrico de Legan y Burstone, en una base de datos radiográ ca de una población ósea adulta colombiana contemporánea y comparar las medidas antropométricas cráneo faciales obtenidas en la población. Material y Método: Es un estudio descriptivo transversal, realizado sobre una base de datos de 600 cuerpos esqueléticos totalmente identicados de una colección ósea colombiana contemporánea, que se encuentra en el Laboratorio de Antropología Física del Instituto Nacional de Medicina Legal y Ciencias Forenses, a los que se les tomó radiografías cefalométricas laterales. De éstas sirvieron 200, según los criterios de inclusión, y clasi caron 58, que equivale a 45 hombres y 13 mujeres entre los 18 y 81 años de edad, fueron evaluadas mediante el análisis de Legan y Burstone tejidos duros, el cual consta de 19 medidas, 16 lineales y 3 angulares. Resultados: El análisis, con respecto a la cefalometría de Legan y Burstone, mostró que existen diferencias estadísticamente signi cativas entre la muestra de estudio y la muestra original, en 12 variables de las 19 del análisis para la muestra masculina y en tres variables de las 19 para la muestra femenina. Conclusiones: El estudio reveló que algunos de los parámetros en la población Colombiana son signi cativamente diferentes a la población caucásica del estudio de Legan y Burstone, especialmente en los hombres.

  11. Genome sequence of a novel H14N7 subtype influenza A virus isolated from a blue-winged teal (Anas discors) harvested in Texas, USA

    Science.gov (United States)

    Ramey, Andy M.; Reeves, Andrew; Poulson, Rebecca L.; Carter, Deborah L.; Davis-Fields, Nicholas; Stallknecht, David E.

    2016-01-01

    We report here the complete genome sequence of a novel H14N7 subtype influenza A virus (IAV) isolated from a blue-winged teal (Anas discors) harvested in Texas, USA. The genomic characteristics of this IAV strain with a previously undetected subtype combination suggest recent viral evolution within the New World wild-bird IAV reservoir.                   

  12. Effect of hydroperiod on CO2 fluxes at the air-water interface in the Mediterranean coastal wetlands of Doñana

    Science.gov (United States)

    Huertas, I. Emma; Flecha, Susana; Figuerola, Jordi; Costas, Eduardo; Morris, Edward P.

    2017-07-01

    Wetlands are productive ecosystems that play an important role in the Earth's carbon cycle and thus global carbon budgets. Climate variability affects amount of material entering and the metabolic balance of wetlands, thereby modifying carbon dynamics. This study presents spatiotemporal changes in air-water CO2 exchange in the vast wetlands of Doñana (Spain) in relation to different hydrological cycles. Water sources feeding Doñana, including groundwater and streams, ultimately depend on the fluctuating balance between annual precipitation and evapotranspiration. Hence, in order to examine the contribution of the rainfall pattern to the emission/capture of CO2 by a range of aquatic habitats in Doñana, we took monthly measurements during severely wet, dry, and normal hydrological years (2010-2013). During wet hydrological cycles, CO2 outgassing from flooded marshes markedly decreased in comparison to that observed during subsequent dry-normal cycles, with mean values of 25.84 ± 19 and 5.2 ± 8 mmol m-2 d-1, respectively. Under drier meteorological conditions, air-water CO2 fluxes also diminished in permanent floodplains and ponds, which even behaved as mild sinks for atmospheric CO2 during certain periods. Increased inputs of dissolved CO2 from the underground aquifer and the stream following periods of high rainfall are believed to be behind this pattern. Large lagoons with a managed water supply from an adjacent estuary took up atmospheric CO2 nearly permanently. Regional air-water carbon transport was 15.2 GgC yr-1 under wet and 1.24 GgC yr-1 under dry meteorological conditions, well below the estimated net primary production for Doñana wetlands, indicating that the ecosystem acts as a large CO2 sink.

  13. Entrevista a Ana Casaravilla Gil, Adjunta de Innovación Educativa y Profesora de la Universidad Politécnica de Madrid

    Directory of Open Access Journals (Sweden)

    Equipo Editorial

    2011-04-01

    Full Text Available Ana Casaravilla Gil es profesora en la Escuela Universitaria de Arquitectura Técnica de la Universidad Politécnica de Madrid y Adjunta de Innovación Educativa. Es una persona comprometida con la docencia como puede comprobarse por los numerosos proyectos y trabajos que en esta línea ha venido desarrollando a lo largo de los años. Hemos charlado con ella sobre la Innovación Educativa en la Universidad.

  14. Temporal Controls on Uplift and Slip Rates for the Puente Hills and Santa Ana Mountains, Southern Los Angeles Basin, Orange County, California

    Science.gov (United States)

    Gath, E. M.; Grant, L. B.; Owen, L. A.

    2006-12-01

    The Puente Hills (PH) are seismically active and tectonically uplifted by the Puente Hills Blind Thrust fault (PHBTF). The rate of uplift, and consequently, the late Quaternary slip rate of the eastern part of the PHBTF, herein named the Santa Ana segment, can be constrained by mapping and dating Quaternary stream terraces and strath surfaces in the Santa Ana River Canyon. The PH are cut by the 2-3 mm/yr right-lateral Whittier fault, itself capable of M6.7-7.2 earthquakes. The 7 mapped terraces and strath surfaces of the PH are cut by the Whittier fault with minimal vertical separation. OSL dating, soil age estimates, and correlation with sea level highstands constrains the PH uplift rate to 0.6-1.4 mm/yr based on OSL dates, and 0.2-0.8 mm/yr from other methods. The rates overlap in the range 0.6-0.8 mm/yr, and we propose that this is the most reliable estimate of uplift rate because it is based on several methods. An uplift rate of 0.6-0.8 mm/yr for the PH is also consistent with a 500 700 ka emergent age based on our geomorphic analysis of PH drainage basin development. Using a 30° dip angle produces a slip rate on the Santa Ana segment of the PHBTF of 1.2-1.6 mm/yr. Preliminary tectonic geomorphic analysis of the Santa Ana Mountains (SAM) suggests that they too are being uplifted and are probably seismically active. Shorelines preserved on the lower foothills of Peralta and Loma Ridges were correlated to eustatic sea levels for age estimations. Mapping and dating of terraces in the Santiago Creek drainage, and the older marine terraces indicates that the SAM are uplifting at 0.2-0.7 mm/yr, probably due to a blind thrust associated with partial termination of the Elsinore fault.

  15. Un puente entre España y Portugal: Carmen de Burgos y su amistad con Ana de Castro Osório

    Directory of Open Access Journals (Sweden)

    Núñez Rey, Concepción

    2014-04-01

    Full Text Available Spain and Portugal experienced a time of intense cultural exchange from 1915 onwards through two major female figures in the two countries who were bound by strong intellectual and personal links. Ana de Castro was a writer prominent in politics, journalism and Portuguese literature from the late 19th century, and Carmen de Burgos was the first professional Spanish woman journalist and one of the most important writers of the first third of the 20th century. They shared the ideals of equality for women and social justice for all, in conjunction with their incessant work in the press and in literary creation: Ana de Castro, more as a political figure, Carmen de Burgos, more as writer. We remember here the intense activity that they shared and the wide echo that it found in the press of both countries.España y Portugal vivieron un tiempo de intenso intercambio cultural a partir de 1915 a través de dos grandes figuras femeninas de ambos países, unidas por fuertes vínculos intelectuales y personales. Ana de Castro fue una escritora muy destacada en la política, en el periodismo y en la literatura lusas desde finales del siglo XIX, y Carmen de Burgos fue la primera periodista profesional española y una de las escritoras más importantes del primer tercio del siglo XX. Ambas compartieron grandes ideales de igualdad para la mujer y de justicia social para todos, unidos a una incesante labor periodística y literaria: Ana de Castro, más como política, Carmen de Burgos, más como escritora. Recordamos aquí la intensa actividad compartida y el amplio eco que encontró en la prensa de los dos países.

  16. Design of a Computer-Assisted System to Automatically Detect Cell Types Using ANA IIF Images for the Diagnosis of Autoimmune Diseases.

    Science.gov (United States)

    Cheng, Chung-Chuan; Lu, Chun-Feng; Hsieh, Tsu-Yi; Lin, Yaw-Jen; Taur, Jin-Shiuh; Chen, Yung-Fu

    2015-10-01

    Indirect immunofluorescence technique applied on HEp-2 cell substrates provides the major screening method to detect ANA patterns in the diagnosis of autoimmune diseases. Currently, the ANA patterns are mostly inspected by experienced physicians to identify abnormal cell patterns. The objective of this study is to design a computer-assisted system to automatically detect cell patterns of IIF images for the diagnosis of autoimmune diseases in the clinical setting. The system simulates the functions of modern flow cytometer and provides the diagnostic reports generated by the system to the technicians and physicians through the radar graphs, box-plots, and tables. The experimental results show that, among the IIF images collected from 17 patients, 6 were classified as coarse-speckled, 3 as diffused, 2 as discrete-speckled, 1 as fine-speckled, 2 as nucleolar, and 3 as peripheral patterns, which were consistent with the patterns determined by the physicians. In addition to recognition of cell patterns, the system also provides the function to automatically generate the report for each patient. The time needed for the whole procedure is less than 30 min, which is more efficient than the manual operation of the physician after inspecting the ANA IIF images. Besides, the system can be easily deployed on many desktop and laptop computers. In conclusion, the designed system, containing functions for automatic detection of ANA cell pattern and generation of diagnostic report, is effective and efficient to assist physicians to diagnose patients with autoimmune diseases. The limitations of the current developed system include (1) only a unique cell pattern was considered for the IIF images collected from a patient, and (2) the cells during the process of mitosis were not adopted for cell classification.

  17. Rapid Airplane Parametric Input Design (RAPID)

    Science.gov (United States)

    Smith, Robert E.

    1995-01-01

    RAPID is a methodology and software system to define a class of airplane configurations and directly evaluate surface grids, volume grids, and grid sensitivity on and about the configurations. A distinguishing characteristic which separates RAPID from other airplane surface modellers is that the output grids and grid sensitivity are directly applicable in CFD analysis. A small set of design parameters and grid control parameters govern the process which is incorporated into interactive software for 'real time' visual analysis and into batch software for the application of optimization technology. The computed surface grids and volume grids are suitable for a wide range of Computational Fluid Dynamics (CFD) simulation. The general airplane configuration has wing, fuselage, horizontal tail, and vertical tail components. The double-delta wing and tail components are manifested by solving a fourth order partial differential equation (PDE) subject to Dirichlet and Neumann boundary conditions. The design parameters are incorporated into the boundary conditions and therefore govern the shapes of the surfaces. The PDE solution yields a smooth transition between boundaries. Surface grids suitable for CFD calculation are created by establishing an H-type topology about the configuration and incorporating grid spacing functions in the PDE equation for the lifting components and the fuselage definition equations. User specified grid parameters govern the location and degree of grid concentration. A two-block volume grid about a configuration is calculated using the Control Point Form (CPF) technique. The interactive software, which runs on Silicon Graphics IRIS workstations, allows design parameters to be continuously varied and the resulting surface grid to be observed in real time. The batch software computes both the surface and volume grids and also computes the sensitivity of the output grid with respect to the input design parameters by applying the precompiler tool

  18. Ni(II), Mn(II), Zn(II)

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Neutral tetradentate N2O2 type complexes of Cu(II), Ni(II), Mn(II),. Zn(II) and VO(II) have been synthesised using a Schiff base formed by the condensation of o-phenylenediamine with acetoacetanilide in alcohol medium. All the complexes were characterised on the basis of their microanalytical data, molar.

  19. Application of multi-criteria decision analysis in prediction of groundwater resources potential: A case of Oke-Ana, Ilesa Area Southwestern, Nigeria

    Science.gov (United States)

    Akinlalu, A. A.; Adegbuyiro, A.; Adiat, K. A. N.; Akeredolu, B. E.; Lateef, W. Y.

    2017-06-01

    Groundwater Potential of Oke-Ana area southwestern Nigeria have been evaluated using the integration of electrical resistivity method, remote sensing and geographic information systems. The effect of five hydrogeological indices, namely lineament density, drainage density, lithology, overburden thickness and aquifer layer resistivity on groundwater occurrence was established. Multi-criteria decision analysis technique was employed to assign weight to each of the index using the concept of analytical hierarchy process. The assigned weight was normalized and consistency ratio was established. In order to evaluate the groundwater potential of Oke-Ana, sixty-seven (67) vertical electrical sounding points were occupied. Ten curve types were delineated in the study area. The curve types vary from simple three layer A and H-type curves to the more complex four, five and six layer AA, HA, KH, QH, AKH, HKH, KHA and KHKH curves. Four subsurface geo-electric sequences of top soil, weathered layer, partially weathered/fractured basement and the fresh basement were delineated in the area. The analytical process assisted in classifying Oke-Ana into, low, medium and high groundwater potential zones. Validation of the model from well information and two aborted boreholes suggest 70% agreement.

  20. Application of multi-criteria decision analysis in prediction of groundwater resources potential: A case of Oke-Ana, Ilesa Area Southwestern, Nigeria

    Directory of Open Access Journals (Sweden)

    A.A. Akinlalu

    2017-06-01

    Full Text Available Groundwater Potential of Oke-Ana area southwestern Nigeria have been evaluated using the integration of electrical resistivity method, remote sensing and geographic information systems. The effect of five hydrogeological indices, namely lineament density, drainage density, lithology, overburden thickness and aquifer layer resistivity on groundwater occurrence was established. Multi-criteria decision analysis technique was employed to assign weight to each of the index using the concept of analytical hierarchy process. The assigned weight was normalized and consistency ratio was established. In order to evaluate the groundwater potential of Oke-Ana, sixty-seven (67 vertical electrical sounding points were occupied. Ten curve types were delineated in the study area. The curve types vary from simple three layer A and H-type curves to the more complex four, five and six layer AA, HA, KH, QH, AKH, HKH, KHA and KHKH curves. Four subsurface geo-electric sequences of top soil, weathered layer, partially weathered/fractured basement and the fresh basement were delineated in the area. The analytical process assisted in classifying Oke-Ana into, low, medium and high groundwater potential zones. Validation of the model from well information and two aborted boreholes suggest 70% agreement.

  1. Digitālo imigrantu (50-62) sevis prezentēšanas prakses sociālajos tīklos

    OpenAIRE

    Bartulsone, Madara

    2016-01-01

    Bakalaura darba “Digitālo imigrantu (50-62) sevis prezentēšanas prakses sociālajos tīklos” mērķis ir izpētīt, kā 50 līdz 62 gadus veci cilvēki izprot un veic sevis prezentēšanu sociālajos tīklos, kā arī apzināt prezentācijas atšķirības sociālajos tīklos Facebook un Draugiem. Darba teorētiskajā daļā aplūkoti digitālās identitātes un sevis prezentēšanas jēdzieni digitālās lietotprasmes un paaudžu kontekstā. Metodoloģijas daļu veido anketēšanas, kontentanalīzes un intervijas apraksts, bet empīri...

  2. Pusaudžu melošana vecāku-pusaudžu mijiedarbības kontekstā

    OpenAIRE

    Lučkina, Jeļena

    2014-01-01

    Maģistra darba pētījuma mērķis bija apskatīt pusaudžu melošanu (dzimumatšķirības melošanas biežumā un tēmās), un noskaidrot kādas pastāv saistības starp pusaudžu melošanu un vecāku-pusaudžu attiecību aspektiem. Balstoties uz analizēto literatūru, tika izvirzīti četri pētījuma jautājumi: Vai pastāv dzimumatšķirības pusaudžu pašnovērtētajā melošanas biežumā un tēmās?; Kādas tēmas prevalē pusaudžu melošanā vecākiem?; Kādas sakarības pastāv starp pusaudžu melošanas biežumu un attiecību aspektiem ...

  3. Microsoft Azure Services platformas izmantošana tīmekļa lietotņu izstrādē

    OpenAIRE

    Vinogradovs, Dmitrijs

    2010-01-01

    Attīstoties tīmekļa tehnoloģijām, globālais tīmeklis kļūst ar vien pieejamāks patērētājiem, - uzņēmēji dod priekšroku tīmekļa lietotnēm nevis, bezsaistes sistēmām. Aug nepieciešamība pēc dažādu sistēmu integrācijas un pieejamības nodrošināšanas dažādu pasaules reģionu iedzīvotājiem. Lai to realizētu, ir vajadzīgas jaunas tehnoloģijas un pieejas izstrādē un sistēmu uzturēšanā kā, piemēram, mākoņa skaitļošana. Šajā darbā ir aprakstīti mākoņa skaitļošanas pamatjēdzieni un detalizē...

  4. Peldēšanas prasmju apguves problēmas un to risinājumu iespējas

    OpenAIRE

    Gultniece, Lelde

    2009-01-01

    Diplomdarbs ir par peldēšanas prasmju apguves problēmām un to risinājumu iespējām. Teorētiskajā daļā ir analizēta literatūra par peldēšanas vēsturi, stilu tehnisko izpildījumu un vietu skolu mācību programmās. Praktiskajā daļā tiek apzināta obligātās peldētapmācības 2. klasēm situācija Rīgas skolās, kā arī skolēnu attieksme pret peldēšanu. Kā risinājumi ir izstrādāts vingrinājumu komplekss sporta stundās peldēšanas prasmju apguvei skolēniem, kuriem nav pieejams peldbaseins, kā arī informat...

  5. Concentrações de ANA e BAP na micropropagação de abacaxizeiro L. Merrill (Ananas comosus e no cultivo hidropônico das plântulas obtidas in vitro The effect of ANA and BAP concentrations on the micropropagation and hydroponic cultures of pineapple

    Directory of Open Access Journals (Sweden)

    Cristiane Elizabeth Costa de Macêdo

    2003-12-01

    Full Text Available O efeito de diferentes concentrações de ANA e BAP na micropropagação do abacaxizeiro, bem como no cultivo em hidroponia das plântulas obtidas in vitro, foram estudados em brotos de abacaxizeiro da variedade Pérola, inoculados em meio de cultura básico MS, suplementado com os fitorreguladores BAP e ANA em diferentes concentrações. Caracteres morfológicos quantitativos relacionados ao crescimento dos brotos e das plântulas de abacaxizeiro foram avaliados respectivamente durante os cultivos in vitro e em hidroponia e mostraram que, o tratamento T1 (BAP = 1,0 mg L-1e ANA = 0,5 mg L-1 proporcionou a maior taxa média de regeneração de brotos e conseqüentemente uma maior produção de matéria fresca. Entretanto, a altura dos brotos e a formação de suas raízes foram maiores nos tratamentos T2 (BAP = 0,5 mg L-1 e ANA = 0,25 mg L-1 e T3 (BAP = 0,25 mg L-1 e ANA = 0,12 mg L-1 . Após sessenta dias de cultivo em hidroponia, todas as plântulas oriundas do tratamento T1 apresentaram um bom desenvolvimento, expresso pela maioria dos caracteres morfológicos avaliados. O sistema de micropropagação utilizado neste trabalho possibilitou a obtenção de brotos de abacaxizeiro Pérola, em quantidade suficiente e ao mesmo tempo de fácil individualização, seguida da regeneração de plântulas que foram cultivadas em hidroponia.The effect of different ANA and BAP concentrations on in vitro and hydroponic cultures were studied. Pineapple shoots derived from Pérola explants variety were inoculated in MS media containing BAP and ANA in different concentrations. Growth parameters of shoots and plantlets were measured for in vitro and hydroponic cultures. Showed a highest multiplication rates of shoots and consequently highest fresh matter production were obtained with BAP and ANA at the concentrations of 1,0 and 0,5 mg L-1 respectively. However, the shoot length as well as the root number formed were higher in the T2 (0,5 de BAP + 0,25 de ANA

  6. Obtaining a Well-Aligned ZnO Nanotube Array Using the Hydrothermal Growth Method / Labi Sakārtotu Zno Nanocauruļu Kopu Iegūšana, Izmantojot Hidrotermālo Metodi

    Directory of Open Access Journals (Sweden)

    Krasovska M.

    2015-10-01

    Full Text Available Dotajā darbā tika noteikti optimāli parametri labi sakārtotu ZnO nanocaurulīšu kopu iegūšanai, izmantojot hidrotermālo metodi ar temperatūras pazemināšanu, jeb t.s. selektīvu paškodināšanas metodi (self-selective etching, ir uzsvērtas šās metodes priekšrocības salīdzinājumā ar ķīmiskās kodināšanas metodi, kā arī tika aprakstīta dažādu augšanas faktora (tādu, ka darba šķīduma koncentrācija, augšanas temperatūra un laiks, iedīgļu slāņa iegūšanas veids un iegūšanas parametri ietekme uz iegūtu nanostraktūra morfoloģiju.

  7. Eksperimenta izmantošana dabaszinību satura apguvē 4. klasē

    OpenAIRE

    Smirnova, Angelina

    2017-01-01

    Angelinas Smirnovas diplomdarba “Eksperimenta izmantošana dabaszinību satura apguvē 4. klasē” teorētiskajā daļā raksturotas dabaszinības kā mācību priekšmets sākumskolā, analizētas mācību metodes, akcentējot tiešās uztveres mācību metožu nozīmību. Raksturots konkrētā vecuma posma attīstības īpatnības pētāmās problēmas aspektā. Diplomdarba empīriskajā daļā analizēts eksperimentu piedāvājums mācību līdzekļos un izstrādāts piedāvājums eksperimentiem dabaszinībās 4. klasei. Autore veikusi piedāv...

  8. POSTMORTEM DIAGNOSIS OF ONE POPULATION OF BLUE-WINGED TEAL (Anas discors IN THE STATE OF VERACRUZ

    Directory of Open Access Journals (Sweden)

    Lorena López-De-Buen

    2011-11-01

    Full Text Available The health status of 30 Blue-winged Teal (Anas discors hunted in Amatitlán, in the central region of the state of Veracruz, Mexico, was assessed. The ducks were weighed, the wings were morphometrically measured, and of each organ the appearance, weight and length were evaluated, making comparisons between males and females, and between adults and immatures. The males weighed more than the females (n = 30, F(1,28 = 9.525, P = 0.004 and the adults more than the immatures (n = 19, F(1,17 = 6.526, P = 0.020. In all the groups the length of the wings was similar, as well as the internal organs had normal color, texture and location. The weight and size of lungs (5.4 g, 441 mm, liver (8.8 g, 608 mm, pancreas (1.5 g, 572 mm, gizzard (20.03 g, 448 mm and intestines (21 g were also similar among groups; however, the heart (3.8 g, 290 mm was larger in the males (n = 30, F(1,28 = 13.513, P = 0.0009, and the kidneys (3 g, 505 mm were heavier in the immature males (n = 19, F(1,17 = 7.417, P = 0.014. It was concluded that the Blue-winged Teal were in good health when hunted.

  9. Defining adaptation measures collaboratively: A participatory approach in the Doñana socio-ecological system, Spain.

    Science.gov (United States)

    De Stefano, Lucia; Hernández-Mora, Nuria; Iglesias, Ana; Sánchez, Berta

    2017-06-15

    The uncertainty associated with the definition of strategies for climate change adaptation poses a challenge that cannot be faced by science alone. We present a participatory experience where, instead of having science defining solutions and eliciting stakeholders' feedback, local actors actually drove the process. While principles and methods of the approach are easily adaptable to different local contexts, this paper shows the contribution of participatory dynamics to the design of adaptation measures in the biodiversity-rich socio-ecological region surrounding the Doñana wetlands (Southern Spain). During the process, stakeholders and scientists collaboratively designed a common scenario for the future in which to define and assess a portfolio of potential adaptation measures, and found a safe, informal space for open dialogue and information exchange. Through this dialogue, points of connection among local actors emerged around the need for more integrated, transparent design of adaptation measures; for strengthening local capacity; and for strategies to diversify economic activities in order to increase the resilience of the region. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Līgumsods kā saistību pastiprināšanas līdzeklis.

    OpenAIRE

    Feldmane, Madara

    2017-01-01

    Bakalaura darba tēma ir “Līgumsods kā saistību pastiprināšanas līdzeklis”. Šajā darbā tiek pētīti 2013.gada līgumsoda grozījumi un to mērķis. Iepriekšējā un pašreizējā līgumsoda regulējuma salīdzinājums, analīze. Grozījumu apjoms, tiesību zinātnieku viedokļi attiecībā uz līgumsoda grozījumiem un regulējuma nepieciešamību Latvijas tiesību sistēmā.Darba mērķis: noskaidrot kā pašreizējais līgumsoda regulējums tiek ievērots praksē, vai tas pilda savas funkcijas. Līgumsoda ierobežojuma izpēte noz...

  11. Spain, Reincarnated: Julio Medem’s Caótica Ana and New Spanish Media(tion in the World

    Directory of Open Access Journals (Sweden)

    Susan Martin-Márquez

    2009-06-01

    Full Text Available Spanish director Julio Medem’s visually stunning yet controversial 2007 film Chaotic Ana was panned for its ostensibly Manichaean treatment of gender relations and its crudely scatological ending, both of which have distracted attention from the work’s fascinating incursions into global politics. While the film’s complex layering of hawk and dove imagery figures centuries of male violence against women, it is also imbricated with an extended meditation on the divergent roles of the United States and Spain on the contemporary world stage. Through the male protagonist Said, a Saharawi painter, the film artfully shifts postcolonial guilt for the fate of the Western Sahara from the former colonizer Spain to the United States. Even as the film obfuscates Spain’s multifaceted imperial past, it engages in a withering indictment of U.S. foreign policy in the post-9/11 era, indicating through a web of symbolic references to the Statue of Liberty that Americans have turned away from their once-vaunted mission. That mission, the film (problematically suggests, must now be taken up by Spain, which, together with other enlightened European nations, serves as a beacon for global justice, drawing upon the Spanish National Court’s declaration of universal jurisdiction to prosecute the U.S. government’s neocolonial crimes against humanity.

  12. Development of skeletal muscle and expression of myogenic regulatory factors during embryonic development in Jinding ducks (Anas platyrhynchos domestica).

    Science.gov (United States)

    Zhu, Chunhong; Gi, Gaige; Tao, Zhiyun; Song, Chi; Zhu, Wenqi; Song, Weitao; Li, Huifang

    2014-05-01

    The important roles of myogenic regulatory factors (MRF) in mammalian skeletal myogenesis have been well studied, but few equivalent studies have been performed in poultry. The expression pattern of MRF during the embryonic development of skeletal muscle in ducks remains unknown. In this study, we identified Myf5, Myf6, MyoD, and myogenin genes in Jinding ducks (Anas platyrhynchos domestica) and quantified their expression levels in breast muscle (BM) and leg muscle (LM) at embryonic d 13, 17, 21, 25, and 27 by real-time reverse-transcription PCR. Body weight and muscle weight show different developmental patterns. The MRF genes were expressed in both BM and LM, but with different expression patterns. The MyoD gene showed lower expression levels in BM before embryonic d 21 compared with LM, whereas the opposite pattern was found later. The higher expression level of MyoD, as well its lagged expression pattern in BM, suggest that the MyoD gene may be involved in maintaining the development of different muscles. Correlation analysis showed that myogenin gene expression levels were significantly negatively correlated with BW and muscle weight in both BM and LM (P skeletal muscle-dependent manners, and provide a foundation for understanding the molecular control of skeletal muscle growth in duck breeds.

  13. Vispārizglītojošo skolu direktoru novērtēšana

    OpenAIRE

    Bīlande, Megija

    2016-01-01

    Aktualitāte: Latvijā šobrīd spēkā esošais normatīvais regulējums neparedz vispārizglītojošo skolu direktoru profesionālās darbības novērtēšanu, pašlaik Ministru kabinets ir izstrādājis projektu, kurā paredzēts ar 2017. gada janvāri uzsākt vērtēt direktoru profesionālo darbību. Šāds projekts Latvijā būs jaunums. Direktoru novērtēšana ir nepieciešama, lai uzlabot izglītības kvalitāti skolā un, lai direktora amatā strādātu kompetentas, profesionālas personas. Maģistra darba mērķis – izanalizēt v...

  14. Mallards (Anas platyrhynchos) and wastewater ponds, Part I: Mallard ducks overwintering at a northern wastewater treatment pond.

    Science.gov (United States)

    Welsh, Patrick O; Paszkowski, Cynthia A; Tierney, Keith B

    2017-09-01

    In northern urban areas, wastewater treatment ponds (WWTPs) may provide a thermal refuge during winter (~10°C) that is used by normally migratory mallards (Anas platyrhynchos). On the ponds, mallards may experience stress due to crowding, or through the ingestion of WWTP water, be exposed to a diverse array of synthetic chemicals, which may have adverse health effects. Photographic sampling was used to assess mallard sex ratios and behavioural patterns throughout the late winter on wastewater ponds in Edmonton, Canada. The WWTP mallard population was large (>1000 birds), but temporally variable and consistently male-dominated. Locomotion and dabbling were the primary behaviors observed; aggression was rarely observed, which suggests crowding stress was low or absent. Mallard abundance tended to be higher at lower air temperatures, suggesting that WWTP ponds acted as a thermal refuge. Stable isotope analysis of carbon and nitrogen from duck feces and potential food sources indicated that mallards were not feeding at the site, or on invertebrates or select waste grain from offsite. Rather, ducks either consumed an undetermined food source or were feeding very little. Taken together, the data suggest that winter use of northern WWTP ponds may serve as an alternative to migration, whether this strategy benefits or harms mallards likely depends on winter severity, and not on WWTP pond characteristics or water quality. Copyright © 2016. Published by Elsevier Inc.

  15. Blood Parasites of Blue-winged Teal ( Anas discors ) from Two Migratory Corridors, in the Southern USA.

    Science.gov (United States)

    Garvon, Jason M; Mott, Joanna B; Jacobs, Sandy Serio; Fedynich, Alan M

    2016-07-01

    We collected 180 Blue-winged Teal ( Anas discors ) in September and October 2002 from Florida, US (n=100, representing the eastern migratory corridor) and the Louisiana-Texas, US, border (n=80, representing the western migratory corridor) and examined for blood parasites using thin heart-blood smears. Leucocytozoon simondi, Haemoproteus nettionis, and microfilariae were found in 16, 23, and 27 birds, respectively. Prevalence of L. simondi and H. nettionis did not vary by migratory corridor, but the prevalence of microfilariae was higher in the western corridor (23%) than the eastern corridor (9%). No differences in prevalence of L. simondi, H. nettionis, and microfilariae were observed by host age or sex. The mean density of L. simondi and H. nettionis averaged 1.5±0.3 and 2.3±0.4 (±SE per 3,000 erythrocytes), respectively. Ranked abundance models for main and interactive effects of corridor, age, and sex were not statistically significant for L. simondi or H. nettionis. Low prevalence and abundance of hematozoa in early autumn migrants reflects the likelihood of low exposure probabilities of Blue-winged Teal on the breeding grounds, compared to their congeners.

  16. Helminth Community Dynamics in Populations of Blue-Winged Teal (Anas discors Using Two Distinct Migratory Corridors

    Directory of Open Access Journals (Sweden)

    Jason M. Garvon

    2011-01-01

    Full Text Available The influence of spatially distinct host subpopulations on helminth community structure and pattern was examined in a migratory avian host species. Forty helminth species represented by 24,082 individuals were collected from 184 blue-winged teal (Anas discors; BWT from 2 primary migratory corridors in Florida (eastern migratory corridor; EMC and Louisiana and Texas (western migratory corridor; WMC. Mean species richness was greater in BWT from the WMC (x¯±S.E=10.2 ± 0.3 species than the EMC (8.6 ± 0.2. The helminth community from the WMC had higher abundances of 6 common/intermediate species. Corridor helminth communities were similar in species composition but less similar when incorporating abundances of those species. Overlapping distributions of phylogenetically related host species that share generalist helminth species across ecologically similar habitats seem to mitigate the isolating mechanisms that are necessary for the distinct coevolutionary pathways to develop between adjacent corridors.

  17. ELIĒR UNIQUE zīmola ieviešana SPA tirgus sektorā.

    OpenAIRE

    Sticenko, Anita

    2012-01-01

    Maģistra darba tēma ir ELIĒR UNIQUE zīmola ieviešana SPA tirgus sektorā, kura mērķis ir izvērtēt un rast priekšlikumus ELIĒR UNIQUE zīmola ieviešanai SPA tirgus sektorā. SPA tirgus segments ir piesātināts ar dažādu veidu kosmētikas zīmoliem, kas piedāvā visplašāko procedūru, pakalpojumu un produktu klāstu. Konkurence ir spēcīga, tāpēc zīmoliem ir jāspēj novērtēt ne tikai konkurentu stiprās un vājās puses, bet arī sava zīmola stiprās un vājās puses, lai spētu novērst trūkumus un pastirpināt...

  18. Population estimates and monitoring guidelines for endangered Laysan Teal, Anas Laysanensis, at Midway Atoll: Pilot study results 2008-2010.

    Science.gov (United States)

    Reynolds, Michelle H.; Brinck, Kevin W.; Laniawe, Leona

    2011-01-01

    Accurate estimates of population size are often crucial to determining status and planning recovery of endangered species. The ability to detect trends in survival and population size over time enables conservation managers to make effective decisions for species and refuge management. During 2004–2007, the translocated population of endangered Laysan Teal (Anas laysanensis; also Laysan Duck) was fitted with radio transmitters providing known (―gold standard‖) measures of survival and reproduction. However, as the population grew, statistically rigorous monitoring protocols were needed that were less labor intensive than radio telemetry. A population die-off and alarmingly high number of carcasses (181) were recorded during a botulism epizootic in August–October 2008, which further reinforced the need for effective monitoring protocols since this endangered species is vulnerable to catastrophic population declines. In fall 2008, we initiated a pilot study using standardized surveys with uniquely marked birds to monitor abundance and estimate the population growth rate of the reintroduced Laysan Teal. Since few birds carried marks (leg bands) after the 2008 botulism die-off (only about 15% of the population), and standardized surveys were not yet implemented, the magnitude of the die-off on the population size was unknown.

  19. Retratos da avó na literatura infantil contemporânea de Ana Maria Machado e Ruth Rocha

    Directory of Open Access Journals (Sweden)

    Tâmara Azevedo

    2012-03-01

    Full Text Available A literatura, além de entretenimento, é um meio de transmitir mensagens, de reflexão e discussão das questões humanas, portanto, um importante objeto de investigação psicossocial. Visando apreender a personagem avó, analisaram-se duas histórias para crianças de duas consagradas autoras contemporâneas brasileiras, Bisa Bia Bisa Bel, de Ana Maria Machado, e Atrás da Porta, de Ruth Rocha. A metodologia qualitativa de análise de conteúdo possibilitou aventar as seguintes categorias: descrição dos personagens e de suas relações; análise dos símbolos à luz da Psicologia Analítica; contexto sócio-histórico; visão sobre educação; conceito de infância; e literatura como mensagem. As avós aparecem como representantes de geração(s anterior(es, transmissoras da cultura e da tradição social, fontes de heranças simbólicas (cultural, familiar, intelectual, contribuindo para o desenvolvimento intelectual de seus netos e para a formação de sua identidade.

  20. Impact of mercury mine and smelter St. Ana – Podljubelj on spatial distribution of chemical elements in soil

    Directory of Open Access Journals (Sweden)

    Tamara Teršič

    2005-06-01

    Full Text Available The objective of the research project was to establish the extension of Hg pollution as a consequence of mining and smelting activities in a narrow Alpine valley. The St. Ana mine was first exploited as early as in 1557 and was finally abandoned in 1902. The entire operating period yielded about 110.000 tons of ore, from which 360 tons of Hg was produced. By soil sampling it was established that on about 9 ha the Hg contents in soil exceed the Slovenian critical values for soil (10 mg/kg. The estimated mercury mean for the studied area is 1.3 mg/kg (0.17 – 718 mg/kg. The highest contents of mercury in soilswere found in the area of the mercury smelter.That is a consequence of former atmospheric emissions and technological losses. High values of Hg were found also in soil on the mine and smelter waste dump. The highest determined contents of Hg (108 mg/kg in this area are almost 7-times lower than thecontents of Hg in the area of the smelter. Mercury in soils generally decrease with depth and distance from the mine and smelter. Apart from the area around the former mine and smelter, mercury appear in higher concentrations also along the road that runs along thevalley, which is due to the use of Hg bearing mine tailings in road construction.

  1. Pb II

    African Journals Online (AJOL)

    Windows User

    used was oven-dried till constant weight and were ground to fine powder in a pestle and mortar. RESULTS AND DISCUSSION. Screening for lead sorption. 15 fungal isolates were screened for Pb(II) biosorption potential at initial pH value of 4.5 and temperature 30°C by incubating freshly harvested wet biomass corres-.

  2. Rapid shallow breathing

    Science.gov (United States)

    ... the smallest air passages of the lungs in children ( bronchiolitis ) Pneumonia or other lung infection Transient tachypnea of the newborn Anxiety and panic Other serious lung disease Home Care Rapid, shallow breathing should not be treated at home. It is ...

  3. Rapid Strep Test

    Science.gov (United States)

    ... worse than normal. Your first thoughts turn to strep throat. A rapid strep test in your doctor’s office ... your suspicions.Viruses cause most sore throats. However, strep throat is an infection caused by the Group A ...

  4. Rapid Mercury(II Removal by Electrospun Sulfur Copolymers

    Directory of Open Access Journals (Sweden)

    Michael W. Thielke

    2016-07-01

    Full Text Available Electrospinning was performed with a blend of commercially available poly(methyl methacrylate (PMMA and a sulfur-rich copolymer based on poly(sulfur-statistical-diisopropenylbenzene, which was synthesized via inverse vulcanization. The polysulfide backbone of sulfur-containing polymers is known to bind mercury from aqueous solutions and can be utilized for recycling water. Increasing the surface area by electrospinning can maximize the effect of binding mercury regarding the rate and maximum uptake. These fibers showed a mercury decrease of more than 98% after a few seconds and a maximum uptake of 440 mg of mercury per gram of electrospun fibers. These polymeric fibers represent a new class of efficient water filtering systems that show one of the highest and fastest mercury uptakes for electrospun fibers reported.

  5. RAPID3? Aptly named!

    Science.gov (United States)

    Berthelot, J-M

    2014-01-01

    The RAPID3 score is the sum of three 0-10 patient self-report scores: pain, functional impairment on MDHAQ, and patient global estimate. It requires 5 seconds for scoring and can be used in all rheumatologic conditions, although it has mostly been used in rheumatoid arthritis where cutoffs for low disease activity (12/30) have been set. A RAPID3 score of ≤ 3/30 with 1 or 0 swollen joints (RAPID3 ≤ 3 + ≤ SJ1) provides remission criteria comparable to Boolean, SDAI, CDAI, and DAS28 remission criteria, in far less time than a formal joint count. RAPID3 performs as well as the DAS28 in separating active drugs from placebos in clinical trials. RAPID3 also predicts subsequent structural disease progression. RAPID3 can be determined at short intervals at home, allowing the determination of the area under the curve of disease activity between two visits and flare detection. However, RAPID3 should not be seen as a substitute for DAS28 and face to face visits in routine care. Monitoring patient status with only self-report information without a rheumatologist's advice (including joints and physical examination, and consideration of imaging and laboratory tests) may indeed be as undesirable for most patients than joint examination without a patient questionnaire. Conversely, combining the RAPID3 and the DAS28 may consist in faster or more sensitive confirmation that a medication is effective. Similarly, better enquiring of most important concerns of patients (pain, functional status and overall opinion on their disorder) should reinforces patients' confidence in their rheumatologist and treatments.

  6. Cloning and expression profiling of the VLDLR gene associated with egg performance in duck (Anas platyrhynchos

    Directory of Open Access Journals (Sweden)

    Peng Xiu-li

    2011-08-01

    Full Text Available Abstract Background The very low density lipoprotein receptor gene (VLDLR, a member of the low density lipoprotein receptor (LDLR gene family, plays a crucial role in the synthesis of yolk protein precursors in oviparous species. Differential splicing of this gene has been reported in human, rabbit and rat. In chicken, studies showed that the VLDLR protein on the oocyte surface mediates the uptake of yolk protein precursors into growing oocytes. However, information on the VLDLR gene in duck is still scarce. Methods Full-length duck VLDLR cDNA was obtained by comparative cloning and rapid amplification of cDNA ends (RACE. Tissue expression patterns were analysed by semi-quantitative reverse-transcription polymerase chain reaction (RT-PCR. Association between the different genotypes and egg performance traits was investigated with the general linear model (GLM procedure of the SAS® software package. Results In duck, two VLDLR transcripts were identified, one transcript (variant-a containing an O-linked sugar domain and the other (variant-b not containing this sugar domain. These transcripts share ~70 to 90% identity with their counterparts in other species. A phylogenetic tree based on amino acid sequences showed that duck VLDLR proteins were closely related with those of chicken and zebra finch. The two duck VLDLR transcripts are differentially expressed i.e. VLDLR-a is mainly expressed in muscle tissue and VLDLR-b in reproductive organs. We have localized the duck VLDLR gene on chromosome Z. An association analysis using two completely linked SNP sites (T/C at position 2025 bp of the ORF and G/A in intron 13 and records from two generations demonstrated that the duck VLDLR gene was significantly associated with egg production (P Conclusions Duck and chicken VLDLR genes probably perform similar function in the development of growing oocytes and deposition of yolk lipoprotein. Therefore, VLDLR could be a candidate gene for duck egg performance

  7. Riesgo cardiovascular en pacientes de un consultorio médico del policlínico "Ana Betancourt" Cardiovascular risk found in patients from a doctor's office in "Ana Betancourt" polyclinics

    Directory of Open Access Journals (Sweden)

    Luis Manuel Hernández Vázquez

    2012-12-01

    Full Text Available Introducción: la capacidad predictiva del riesgo coronario es superior a la que se establece por la consideración aislada de los factores de riesgo cardiovasculares. Objetivo: determinar la magnitud del riesgo coronario y las prioridades de prevención cardiovascular en pacientes pertenecientes al consultorio médico de la familia No.5, del policlínico "Ana Betancourt", en el municipio Playa. Métodos: investigación descriptiva, de corte transversal realizada entre 2009-2010. El universo de estudio estuvo constituido por las 856 personas mayores de 20 años perteneciente a dicho consultorio. Después de aplicados los criterios de selección, la muestra quedó conformada por 242 pacientes. Se utilizaron los criterios de las Tablas de Predicción del Riesgo Coronario de Framingham, que permiten estimar dicho riesgo a diez años, en las personas con factores de riesgo cardiovascular que aún no han tenido enfermedad coronaria establecida y que requieren intervenciones de cambio de su estilo de vida. Resultados: predominaron los pacientes en la categoría de riesgo coronario moderado, 97 (40,1 %, seguido por los de alto riesgo, 82 (33, 8 % y finalmente, los de bajo riesgo, 63 (26 %. Ninguno de los pacientes estudiados estaba exento de riesgo coronario. Conclusiones: es muy probable, que más de la mitad de la muestra sufra un episodio coronario, mortal o no, durante los próximos diez años. Es urgente aplicar una estrategia de intervención comunitaria, basada en la modificación de los factores de riesgo asociados al estilo de vida, que permita disminuir la actual expresión del riesgo coronario en la población estudiada.Introduction: the predictive capacity of the coronary risk is greater than the prediction set by the individual consideration of the cardiovascular risk factors. Objective: to determine the coronary risk and the cardiovascular prevention priorities in patients from the family doctor's office no.5 in "Ana Betancourt

  8. Mallards (Anas platyrhynchos) and wastewater ponds, Part II: Developmental, physiological, morphological and behavioural effects of ingestion of secondary clarified effluent water.

    Science.gov (United States)

    Tierney, K B; Welsh, P O; Mills, M; Nason, S; Barreda, D R; Paszkowski, C A

    2017-09-01

    Rather than migrating, mallard ducks may choose to overwinter in northern cities on open-water thermal refuges, such as municipal wastewater treatment ponds, which in Edmonton, Canada, stay ≥10°C during frigid winter months. Refuging mallards spend appreciable time daily on these ponds and hydrate using secondary clarified municipal wastewater (SCEW). We aimed to determine if SCEW ingestion affected mallard health. To this end, we gavaged newly hatched mallards (domesticated Pekin strain) over their first month with SCEW, as well as water representing negative and positive controls (municipal tap water, and the primary active ingredient from birth control pills, 17α-ethinyl estradiol (EE2), respectively). The gavage of SCEW did not affect mass of the body, liver, spleen or heart, but was associated with small increases in beak and wing chord length. In the positive control, EE2 gavage caused similar responses, but also increased tarsus and phallus length. The increases likely owed to the stimulatory effects of estrogenic substances on bone and phallus development. For the biotransformation enzyme CYP2H1, gene expression was numerically increased by both SCEW and EE2. In terms of behavior, SCEW and EE2 gavage reduced two infrequently detected behaviours, pecking and resting alone. Our results suggest that SCEW ingestion would be unlikely to cause any overt health effects in adults, but may evoke subtle, covert effects nevertheless. Copyright © 2017. Published by Elsevier Inc.

  9. Ion Flotation of Copper(II) and Lead(II) from Environmental Water ...

    African Journals Online (AJOL)

    The present study aims to develop a simple, rapid and economic procedure for copper(II) and lead(II) removal under the optimum conditions investigated. It is based on the complex formation between Cu2+ and Pb2+ ions and diphenylcarbazone (HDPC) followed by flotation with oleic acid (HOL) surfactant. The different ...

  10. Rapid small lot manufacturing

    Energy Technology Data Exchange (ETDEWEB)

    Harrigan, R.W.

    1998-05-09

    The direct connection of information, captured in forms such as CAD databases, to the factory floor is enabling a revolution in manufacturing. Rapid response to very dynamic market conditions is becoming the norm rather than the exception. In order to provide economical rapid fabrication of small numbers of variable products, one must design with manufacturing constraints in mind. In addition, flexible manufacturing systems must be programmed automatically to reduce the time for product change over in the factory and eliminate human errors. Sensor based machine control is needed to adapt idealized, model based machine programs to uncontrolled variables such as the condition of raw materials and fabrication tolerances.

  11. DUCK (Anas platyrhincos Borneo CULTIVATIONIN HULU SUNGAI UTARA SOUTH KALIMANTAN (OVERVIEW OF MARKET, HUMAN RESOURCES AND FINANCING

    Directory of Open Access Journals (Sweden)

    Muhammad Riza Firdaus

    2016-04-01

    Full Text Available Given Alabio ducks ( Anas platyrinchos Borneo is a commodity that can be developed on wetlands , the study aims to illustrate the potential and development of duck farms that can be relied upon by the provincial government in making policies for the advancement of this duck commodities , especially in the aspect of  markets  ,  human  resources  ,  and  fi nancial  aspects  .  These  three  aspects have been given the results of several previous studies that the three aspects mentioned  this  is  still  an  issue  in  the  development  of  duck  and  production results  .  Hulu  Sungai  Utara  as  duck  production  centers  serve  as  a  test  site  . Qualitative  analysis  of  the  domain  and  toksonomi  method  used  as  a  tool  in analyzing the data of this study . The results show : First , aspects of fi nancing shows that the business is viable and profi table , especially on a large scale . Second , the market requires a lot of innovation in creating related products. Third , explain aspects of human resource regeneration is still a problem and also the managerial constraints such as planning , standardization and quality in all phases . Keywords: Ducks  Alabio,  Financial  Aspects,  Aspects  of  Market  and  Marketing,  Human Resource Aspects

  12. Evidence for the exchange of blood parasites between North America and the Neotropics in blue-winged teal (Anas discors).

    Science.gov (United States)

    Ramey, Andrew M; Reed, John A; Walther, Patrick; Link, Paul; Schmutz, Joel A; Douglas, David C; Stallknecht, David E; Soos, Catherine

    2016-10-01

    Blue-winged teal (Anas discors) are abundant, small-bodied dabbling ducks that breed throughout the prairies of the northcentral USA and central Canada and that winter in the southern USA and northern Neotropics. Given the migratory tendencies of this species, it is plausible that blue-winged teal may disperse avian pathogens, such as parasites causing avian malaria, between spatially distant areas. To test the hypothesis that blue-winged teal play a role in the exchange of blood parasites between North America and areas further south, we collected information on migratory tendencies of this species and sampled birds at spatially distant areas during breeding and non-breeding periods to diagnose and genetically characterize parasitic infections. Using a combination of band recovery data, satellite telemetry, molecular diagnostics, and genetic analyses, we found evidence for (1) migratory connectivity of blue-winged teal between our sampling locations in the Canadian prairies and along the US Gulf Coast with areas throughout the northern Neotropics, (2) parasite acquisition at both breeding and non-breeding areas, (3) infection of blue-winged teal sampled in Canada and the USA with Plasmodium parasite lineages associated with the Neotropics, and (4) infection of blue-winged teal with parasites that were genetically related to those previously reported in waterfowl in both North America and South America. Collectively, our results suggest that blue-winged teal likely play a role in the dispersal of blood parasites between the Neotropics and North America, and therefore, the targeting of this species in surveillance programs for the early detection of Neotropical-origin avian pathogens in the USA may be informative.

  13. Antimicrobial susceptibility of Brachyspira spp. isolated from commercial laying hens and free-living wild mallards (Anas platyrhynchos).

    Science.gov (United States)

    Jansson, Désirée S; Pringle, Märit

    2011-08-01

    In vitro antimicrobial susceptibility to tylosin, valnemulin, tiamulin, doxycycline, lincomycin and ampicillin was investigated by broth dilution in 48 Brachyspira spp. isolates from commercial laying hens (n=30) and free-living wild mallards (Anas platyrhynchos) (n=18). Presumed pathogens (Brachyspira alvinipulli, Brachyspira intermedia, Brachyspira pilosicoli), commensals (Brachyspira murdochii, Brachyspira innocens, "Brachyspira pulli"), and isolates of undetermined species affiliation were included. The laying hens had not been exposed to therapeutic levels of antimicrobials for at least 50 weeks before sampling, and low levels of environmental antimicrobial exposure were presumed in mallards. No isolates with decreased susceptibility to tylosin, valnemulin, tiamulin or doxycycline were found. Decreased susceptibility to lincomycin (minimum inhibitory concentration 16 µg/ml) was detected in two isolates (Brachyspira sp.) from laying hens. Five isolates showed decreased susceptibility to ampicillin (minimum inhibitory concentration 16 to >32 µg/ml), including two "B. pulli" and one B. alvinipulli from laying hens, and isolates of B. pilosicoli and "B. pulli" from mallards. Decreased susceptibility to ampicillin was associated with β-lactamase activity in four isolates. A new variant of a class D β-lactamase gene designated bla (oxa-192) was identified in a B. pilosicoli isolate of mallard origin. This is the first time the genetic basis for antimicrobial resistance is described in Brachyspira spp. from a free-living wild bird. Isolates displaying decreased susceptibility to ampicillin were accompanied by fully susceptible isolates of the same species or other genotypes within three laying hen flocks. This underlines the need for performing antimicrobial susceptibility tests on single clones/genotypes, and to analyse multiple isolates from the same flock.

  14. The impact of using lead pellets on lead contamination of mallards (Anas platyrhynchos in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Zdeňka Hutařová

    2013-01-01

    Full Text Available The aim of the study was to assess the degree of lead contamination in mallards in the Czech Republic as a result of using lead shots for wildfowling. Two sites used for mallard hunting were chosen, namely a flood-control reservoir in Moravia and a small fishpond in Bohemia. Lead concentrations were determined in the tissues of 20 mallards (Anas platyrhynchos raised at those standing open water sites (n = 10 at each site and killed there during the autumn hunting season with a steel shot. Control groups were made up of 20 mallards from the same breeding facility as experimental groups but raised in an enclosure without access to water (n = 10 at each site. Lead concentrations were determined in selected tissues (breast muscle, heart, liver, gizzard, kidney, feathers - quill base, lung, brain and humerus by high resolution continuum source atomic absorption spectrometry. The results showed elevated lead concentrations in all tissues of mallards compared with control in the reservoir in Southern Moravia. The highest lead concentrations (mg/kg were found in the humerus (14.254 ± 4.525 and 5.083 ± 0.748 for experimental and control mallards, respectively. In contrast, lead concentrations in mallards from small fishpond in Southern Bohemia were lower compared to control. Similarly, the highest lead concentrations were found in the humerus (2.219 ± 0.349 and 8.930 ± 1.012 for experimental and control mallards, respectively. This study extends very limited information about lead contamination of wild ducks in the Czech Republic in connection with hunting activities.

  15. Evidence for the exchange of blood parasites between North America and the Neotropics in blue-winged teal (Anas discors)

    Science.gov (United States)

    Ramey, Andy M.; Reed, John; Walther, Patrick; Link, Paul; Schmutz, Joel A.; Douglas, David; Stallknecht, David E.; Soos, Catherine

    2016-01-01

    Blue-winged teal (Anas discors) are abundant, small-bodied dabbling ducks that breed throughout the prairies of the northcentral USA and central Canada and that winter in the southern USA and northern Neotropics. Given the migratory tendencies of this species, it is plausible that blue-winged teal may disperse avian pathogens, such as parasites causing avian malaria, between spatially distant areas. To test the hypothesis that blue-winged teal play a role in the exchange of blood parasites between North America and areas further south, we collected information on migratory tendencies of this species and sampled birds at spatially distant areas during breeding and non-breeding periods to diagnose and genetically characterize parasitic infections. Using a combination of band recovery data, satellite telemetry, molecular diagnostics, and genetic analyses, we found evidence for (1) migratory connectivity of blue-winged teal between our sampling locations in the Canadian prairies and along the US Gulf Coast with areas throughout the northern Neotropics, (2) parasite acquisition at both breeding and non-breeding areas, (3) infection of blue-winged teal sampled in Canada and the USA withPlasmodium parasite lineages associated with the Neotropics, and (4) infection of blue-winged teal with parasites that were genetically related to those previously reported in waterfowl in both North America and South America. Collectively, our results suggest that blue-winged teal likely play a role in the dispersal of blood parasites between the Neotropics and North America, and therefore, the targeting of this species in surveillance programs for the early detection of Neotropical-origin avian pathogens in the USA may be informative.

  16. Sediment phosphate composition in relation to emergent macrophytes in the Doñana Marshes (SW Spain).

    Science.gov (United States)

    Reina, M; Espinar, J L; Serrano, L

    2006-03-01

    We have studied the effect of the presence of emergent macrophytes on the sediment phosphate composition of a eutrophic shallow marsh on the NE margin of Doñana (SW Spain). Top sediment and water samples were collected from both the open-water and the vegetated sites at three areas covered by different plant species: Scirpus maritimus, Juncus subulatus and Phragmites australis. The concentration of organic matter was significantly higher in the top sediment of sites covered by vegetation than in their adjacent open-water sites at the three vegetation areas. The P-fractional composition showed that the sediment was dominated by the inorganic P-fractions in all cases, reaching the highest concentration in the Ca-bound P-fraction (281-372 microg g(-1) d.w.). The sum of all P-fractions was significantly higher in the top sediment of the sites covered by J. subulatus and S. maritimus than in their adjacent open-water sites, and so were the org-P fraction extracted by hot NaOH and the concentration of phytate within this fraction. Deposition of plant material on the top sediment of areas vegetated by J. subulatus and S. maritimus explains these differences. The P-fractional composition of the seeds from J. subulatus showed that they contained a large proportion of organic P-fractions, particularly of the fraction extracted by hot NaOH (1868 microg g(-1) d.w., 85% of which was phytate). The presence of emergent macrophytes, therefore, influenced the distribution of P-fractions in the sediment depending on plant species. The P-bioavailability of shallow aquatic systems must be fully understood if wetlands are to be protected from further eutrophication.

  17. Ni(II), Cu(II) and Zn(II)

    African Journals Online (AJOL)

    Chemical speciation of citric acid complexes of Co(II), Ni(II), Cu(II) and Zn(II) was investigated pH-metrically in 0.0-2.5% anionic, cationic and neutral micellar media. The primary alkalimetric data were pruned with SCPHD program. The existence of different binary species was established from modeling studies using the ...

  18. Ni(II), Cu(II) and Zn(II)

    African Journals Online (AJOL)

    NICO

    2010-06-15

    Jun 15, 2010 ... physico-chemical techniques. A square planar geometry was suggested for Cu(II) and octahedral geometry proposed for Co(II),. Ni(II) and Zn(II). TG curves indicated that the complexes decompose in three to four steps. The presence of coordinated water in metal complexes was confirmed by thermal and ...

  19. Rapid Cycling and Its Treatment

    Science.gov (United States)

    ... Announcements Public Service Announcements Partnering with DBSA Rapid Cycling and its Treatment What is bipolar disorder? Bipolar ... to Depression and Manic Depression . What is rapid cycling? Rapid cycling is defined as four or more ...

  20. Rapid manufacturing for microfluidics

    CSIR Research Space (South Africa)

    Land, K

    2012-10-01

    Full Text Available . Microfluidics is at the forefront of developing solutions for drug discovery, diagnostics (from glucose tests to malaria and TB testing) and environmental diagnostics (E-coli monitoring of drinking water). In order to quickly implement new designs, a rapid...

  1. Rapid Prototyping in PVS

    Science.gov (United States)

    Munoz, Cesar A.; Butler, Ricky (Technical Monitor)

    2003-01-01

    PVSio is a conservative extension to the PVS prelude library that provides basic input/output capabilities to the PVS ground evaluator. It supports rapid prototyping in PVS by enhancing the specification language with built-in constructs for string manipulation, floating point arithmetic, and input/output operations.

  2. Rapid Prototyping Reconsidered

    Science.gov (United States)

    Desrosier, James

    2011-01-01

    Continuing educators need additional strategies for developing new programming that can both reduce the time to market and lower the cost of development. Rapid prototyping, a time-compression technique adapted from the high technology industry, represents one such strategy that merits renewed evaluation. Although in higher education rapid…

  3. Analītiskās metodes izstrādāšana Vildagliptīna daļiņu izmēru sadalījuma noteikšanai ar lāzera difrakciju

    OpenAIRE

    Stankeviča, Jeļena

    2016-01-01

    Maģistra darbā aprakstīta daļiņu izmēru sadalījuma noteikšanas lāzera difrakcijas metode. Tika veikta metodes izstrāde, pamatojoties uz izvirzītājiem kritērijiem. Tika veikta optimālo parametru (lāzera aptumsuma, maisīšanas ātruma, optimāla mērīšanas ilguma) piemeklēšana.

  4. Fuentes neoplatónicas y hermetismo en la heterodoxia de la seglar Ana de Zayas (Puebla de los Ángeles, 1690-1696

    Directory of Open Access Journals (Sweden)

    Zayas, Concepción

    2014-12-01

    Full Text Available We will analyze the influence of hermetic philosophy in New Spain secular Ana de Zayas’ religious heterodoxy. The neoplatonic sources from she fed her thought pervaded the documents she addressed to some priest in seventeenth-century Puebla de los Angeles. Such texts caused that in 1694 she was charged of alumbradismo. Her trial occurred within a milieu in which hermeticism was cultivate for some intellectuals such as Carlos de Sigüenza and Sor Juana Ines de la Cruz. Behind her literary style, Ana de Zayas is a good example of how those philosophical currents had a direct effect in the heterodox ways to conceive and life the religion.Se analizará la influencia de fuentes neoplatónicas y herméticas en la heterodoxia de la seglar novohispana Ana de Zayas a través de los escritos que ella dirigió, a finales del siglo XVII, a los sacerdotes de su ciudad, la Puebla de los Ángeles. Dichos textos fueron la causa de que en 1694 se iniciara contra ella un proceso inquisitorial por alumbradismo. Su caso se desarrolla en un contexto cultural empapado de hermetismo, como se aprecia en las obras de sus contemporáneos Carlos de Sigüenza y sor Juana Inés de la Cruz. Más allá del mero estilo literario, Zayas es un ejemplo de cómo estas líneas filosóficas tenían una repercusión en formas heterodoxas de concebir y vivir la religión.

  5. Latviešu sadzīves dziedāšana kā populārās kultūras daļa

    OpenAIRE

    Svikle, Evija

    2011-01-01

    Maģistra darba nosaukums ir „Latviešu sadzīves dziedāšana kā populārās kultūras daļa”. Darbā aplūkotas sadzīves dziedāšanas ietekmes sfēras, sadzīves dziedāšanas repertuāra avoti – ziņģes, tautasdziesmas, populārā mūzika, salīdzināts latviešu un emigrācijā dzīvojošo latviešu sadzīves dziedāšanas repertuārs, attieksme pret dziedāšanu. Autore izmantojusi Nacionālās mutvārdu krātuves materiālus, lai pētītu sadzīves dziedāšanas kontekstu, repertuāru, tā ietekmes avotus Latvijā un emigrācijā dzīvo...

  6. Physical and Technical Energy Problems: Testing of the Prototype for State Estimation of Large-Scale Power Systems / Lielo Energosistēmu Stāvokļa Novērtēšanas Prototipa Testēšana

    Science.gov (United States)

    Kochukov, O.; Briņķis, K.; Mutule, A.

    2013-08-01

    The paper describes the algorithm for distributed state estimation (SE) and is focused on its testing and validation. For this purpose, different events in the modeled power system of the 330-750 kV electrical ring Latvia - Lithuania - Belarus - Smolensk - Moscow - St. Petersburg - Estonia - Latvia were considered. The methods for testing the Inter-TSO SE prototype and dynamic network monitoring & modeling are based on comparison of the available SCADA data about real events with those of SE calculation. In total, four operational states were studied, including initial, accident and two post-accident operational states Rakstā tiek aprakstīti, testēti un novērtēti izkliedēta stāvokļa novērtēšanas algoritmi. Testēšanas nolūkos tika izmantoti dažādi 330-750 kV elektriskā loka Latvija - Lietuva - Baltkrievija - Smoļenska - Maskava - Pēterburga - Igaunija - Latvija modelēti scenāriji. Prototipa testēšanas metodoloģija balstīta uz pieejamo SCADA datu salīdzināšanu ar stāvokļa novērtēšanas prototipa aprēķina rezultātiem. Kopumā apskatīti sākotnējais, avārijas un divi pēcavārijas režīmi

  7. Long-Term Monitoring of the Flooding Regime and Hydroperiod of Doñana Marshes with Landsat Time Series (1974–2014

    Directory of Open Access Journals (Sweden)

    Ricardo Díaz-Delgado

    2016-09-01

    Full Text Available This paper presents a semi-automatic procedure to discriminate seasonally flooded areas in the shallow temporary marshes of Doñana National Park (SW Spain by using a radiommetrically normalized long time series of Landsat MSS, TM, and ETM+ images (1974–2014. Extensive field campaigns for ground truth data retrieval were carried out simultaneous to Landsat overpasses. Ground truth was used as training and testing areas to check the performance of the method. Simple thresholds on TM and ETM band 5 (1.55–1.75 μm worked significantly better than other empirical modeling techniques and supervised classification methods to delineate flooded areas at Doñana marshes. A classification tree was applied to band 5 reflectance values to classify flooded versus non-flooded pixels for every scene. Inter-scene cross-validation identified the most accurate threshold on band 5 reflectance (ρ < 0.186 to classify flooded areas (Kappa = 0.65. A joint TM-MSS acquisition was used to find the MSS band 4 (0.8 a 1.1 μm threshold. The TM flooded area was identical to the results from MSS 4 band threshold ρ < 0.10 despite spectral and spatial resolution differences. Band slicing was retrospectively applied to the complete time series of MSS and TM images. About 391 flood masks were used to reconstruct historical spatial and temporal patterns of Doñana marshes flooding, including hydroperiod. Hydroperiod historical trends were used as a baseline to understand Doñana’s flooding regime, test hydrodynamic models, and give an assessment of relevant management and restoration decisions. The historical trends in the hydroperiod of Doñana marshes show two opposite spatial patterns. While the north-western part of the marsh is increasing its hydroperiod, the southwestern part shows a steady decline. Anomalies in each flooding cycle allowed us to assess recent management decisions and monitor their hydrological effects.

  8. Rede de monitorização da contaminação por nitratos em aquíferos no Parque de Doñana

    OpenAIRE

    Oliveira, Mauro Jorge Pereira de

    2008-01-01

    O Parque Nacional de Doñana representa um espaço natural único em toda a Europa, devido às suas dimensões e localização geográfica, perto dos ambientes bioclimáticos africanos, albergando uma biodiversidade única. Porém, alguns dos seus valores naturais encontram-se em risco como consequência de certas actividades, nomeadamente a agricultura. Com a implementação da normativa europeia Quadro da Água (Directiva 2000/60/CE de 12 de Outubro de 2000), foram establecidas metas e normas com o ...

  9. A representação feminina em D. Narcisa de Villar, de Ana Luísa de Azevedo Castro

    Directory of Open Access Journals (Sweden)

    Bárbara Loureiro Andreta

    2014-07-01

    Full Text Available D. Narcisa de Villar is the only novel written by Ana Luísa de Azevedo Castro, published in 1859. In this novel, the women and the native people represent the resistance to the patriarchal, colonialist and enslaver society. As in other nineteenth century female authorship’s novels, D. Narcisa de Villar denounces the institutional and symbolical violence, which interlines the construction of the Brazilian nation, disestablishing, in this way, the configuration of the national identity, since she gave voice to the subaltern voices.

  10. J. Swift, H. Melville y un cuento de Ana Lidia Vega: prostitución y metáforas de la migración.

    OpenAIRE

    Mercedes Rico García.; Gemma Delicado Puerto.

    2008-01-01

    En diálogo con Gulliver’s Travels de Jonathan Swift y Moby Dick de Herman Melville, y teniendo en mente la imagen degradada de la Estatua de la Libertad, a la que se compara con una ramera, Ana Lydia Vega en “Encancaranublado,” nos ofrece una personal perspectiva sobre las migraciones económicas que se desplazan de Latinoamérica a Estados Unidos. La autora construye su cuento sobre dos niveles: el real y el alegórico. Ambos planos ilustran la manera en que los ricos prostituyen a los pobres y...

  11. Grieta en la pared, carcoma interior. Realidad frente a deseo en Emma Bovary y Ana Ozores. Perspectiva temática

    Directory of Open Access Journals (Sweden)

    Concepción Pérez - Pérez

    2015-04-01

    Full Text Available This article carries out a comparative analysis of the characters of Emma Bovary and Ana Ozores considering the assumptions of thematic criticism. The way that certain cosmological and material elements are regarded as real, brings about a set of recurrent images that acquire symbolical dimension. These images, which are the visible representation of the psycho-sensory level of the text, may relate, therefore, to the specific individual dimension of the way of perceiving and constructing a daydream vision of the real world in the act of writing. However, certain parallelisms can be established in the writings of both, Flaubert and Clarín.

  12. La hidrofobia en los suelos arenosos del parque natural de Doñana: caracterización y distribución

    OpenAIRE

    Moral, Francisco Jesús; Giráldez Cervera, Juan Vicente; Laguna, Ana Mª

    2002-01-01

    La hidrofobia, o repelencia al agua que se manifiesta en algunos suelos, dificulta la infiltración del agua, y, consecuentemente, el establecimiento de vegetación. Como la repelencia aparece en zonas aisladas se favorecen los flujos preferenciales en su contorno. En este trabajo se muestran algunas características hidrofóbicas detectadas en los suelos arenosos del cordón dunar del litoral atlántico próximo al Parque Nacional de Doñana, analizando su origen y extensión en las áreas analizad...

  13. The burden of the variability introduced by the HEp-2 assay kit and the CAD system in ANA indirect immunofluorescence test.

    Science.gov (United States)

    Infantino, M; Meacci, F; Grossi, V; Manfredi, M; Benucci, M; Merone, M; Soda, P

    2017-02-01

    According to the recent recommendations of the American College of Rheumatology, ANA Task Force, IIF technique should be considered the gold standard in antinuclear antibodies (ANAs) testing. To overcome the lack of standardization, biomedical industries have developed several computer-aided diagnosis (CAD) systems. Two hundred and sixty-one consecutive samples with suspected autoimmune diseases were tested for ANA by means of IIF on routinely HEp-2 assay kit (Euroimmun AG). Assignment of result was made if consensus for positive/negative was reached by at least 2 out of 3 expert physicians. ANA-IIF was also carried out using 3 CAD systems: Zenit G-Sight (n = 84), Helios (n = 85) and NOVA View (n = 92); human evaluation was repeated on the same substrate of each CAD system (Immco, Aesku and Inova HEp-2 cells, respectively). To anonymize the results, we randomly named these three systems as A, B and C. We ran a statistical analysis computing several measures of agreement between the ratings, and we also improved the evaluation by using the Wilcoxon's test for nonparametric data. Agreement between the human readings on routinely HEp-2 assay kit and human readings on CAD HEp-2 assay was substantial for A (k = 0.82) and B (k = 0.72), and almost perfect for C (k = 0.89). Such readings were statistically different only in case A. Comparing experts' readings with the readings of CAD systems, when the samples were prepared using CAD HEp-2 assay kits, we found almost perfect agreement for B and C (k = 0.86; k = 0.82) and substantial agreement for A (k = 0.73). Again, human and CAD readings were statistically different only in A. When we compared the readings of medical experts on routinely HEp-2 assay kit with the output of the CAD systems that worked using their own slides, we found substantial agreement for all the systems (A: k = 0.62; B: k = 0.65; C: k = 0.71). Such readings were not statistically different. The change of the assay kit and/or the

  14. Rapid manufacturing facilitated customisation

    OpenAIRE

    Tuck, Christopher John; Hague, Richard; Ruffo, Massimiliano; Ransley, Michelle; Adams, Paul Russell

    2008-01-01

    Abstract This paper describes the production of body-fitting customised seat profiles utilising the following digital methods: three dimensional laser scanning, reverse engineering and Rapid Manufacturing (RM). The seat profiles have been manufactured in order to influence the comfort characteristics of an existing ejector seat manufactured by Martin Baker Aircraft Ltd. The seat, known as Navy Aircrew Common Ejection Seat (NACES), was originally designed with a generic profile. ...

  15. Rapid Detection of Pathogens

    Energy Technology Data Exchange (ETDEWEB)

    David Perlin

    2005-08-14

    Pathogen identification is a crucial first defense against bioterrorism. A major emphasis of our national biodefense strategy is to establish fast, accurate and sensitive assays for diagnosis of infectious diseases agents. Such assays will ensure early and appropriate treatment of infected patients. Rapid diagnostics can also support infection control measures, which monitor and limit the spread of infectious diseases agents. Many select agents are highly transmissible in the early stages of disease, and it is critical to identify infected patients and limit the risk to the remainder of the population and to stem potential panic in the general population. Nucleic acid-based molecular approaches for identification overcome many of the deficiencies associated with conventional culture methods by exploiting both large- and small-scale genomic differences between organisms. PCR-based amplification of highly conserved ribosomal RNA (rRNA) genes, intergenic sequences, and specific toxin genes is currently the most reliable approach for bacterial, fungal and many viral pathogenic agents. When combined with fluorescence-based oligonucleotide detection systems, this approach provides real-time, quantitative, high fidelity analysis capable of single nucleotide allelic discrimination (4). These probe systems offer rapid turn around time (<2 h) and are suitable for high throughput, automated multiplex operations that are critical for clinical diagnostic laboratories. In this pilot program, we have used molecular beacon technology invented at the Public health Research Institute to develop a new generation of molecular probes to rapidly detect important agents of infectious diseases. We have also developed protocols to rapidly extract nucleic acids from a variety of clinical specimen including and blood and tissue to for detection in the molecular assays. This work represented a cooperative research development program between the Kramer-Tyagi/Perlin labs on probe development

  16. Tiber Personal Rapid Transit

    Directory of Open Access Journals (Sweden)

    Diego Carlo D'agostino

    2011-02-01

    Full Text Available The project “Tiber Personal Rapid Transit” have been presented by the author at the Rome City Vision Competition1 2010, an ideas competition, which challenges architects, engineers, designers, students and creatives individuals to develop visionary urban proposals with the intention of stimulating and supporting the contemporary city, in this case Rome. The Tiber PRT proposal tries to answer the competition questions with the definition of a provocative idea: a Personal Rapid transit System on the Tiber river banks. The project is located in the central section of the Tiber river and aims at the renewal of the river banks with the insertion of a Personal Rapid Transit infrastructure. The project area include the riverbank of Tiber from Rome Transtevere RFI station to Piazza del Popolo, an area where main touristic and leisure attractions are located. The intervention area is actually no used by the city users and residents and constitute itself a strong barrier in the heart of the historic city.

  17. Reklāmas kampaņas izstrādāšana, īstenošana un komunikācijas problēmas: kinoteātra "Cinamon" gadījums (2008. gada oktobris - 2009. gada februāris)

    OpenAIRE

    Zvejniece, Zane

    2009-01-01

    Bakalaura darba tēma ir „Reklāmas kampaņas izstrādāšana, īstenošana un komunikācijas problēmas: kinoteātra „Cinamon” gadījums (2008. gada oktobris – 2009. gada februāris)” Kinoteātris „Cinamon” atvērts 2008. gada novembrī. Otrā daudzzāļu kinoteātra ienākšana Latvijā bija nozīmīgs notikums. Ienākot tirgū, liela nozīme ir rūpīgi izplānotai reklāmas kampaņai. Darbā izvirzīta hipotēze: ienākot tirgū un veidojot reklāmas kampaņu, kinoteātris „Cinamon” saskārās ar komunikācijas problēmām, ka...

  18. Genomic characterization of H14 subtype Influenza A viruses in new world waterfowl and experimental infectivity in mallards (Anas platyrhynchos.

    Directory of Open Access Journals (Sweden)

    Andrew M Ramey

    Full Text Available Recent repeated isolation of H14 hemagglutinin subtype influenza A viruses (IAVs in the New World waterfowl provides evidence to suggest that host and/or geographic ranges for viruses of this subtype may be expanding. In this study, we used genomic analyses to gain inference on the origin and evolution of H14 viruses in New World waterfowl and conducted an experimental challenge study in mallards (Anas platyrhynchos to evaluate pathogenicity, viral replication, and transmissibility of a representative viral strain in a natural host species. Genomic characterization of H14 subtype IAVs isolated from New World waterfowl, including three isolates sequenced specifically for this study, revealed high nucleotide identity among individual gene segments (e.g. ≥95% shared identity among H14 HA gene segments. In contrast, lower shared identity was observed among internal gene segments. Furthermore, multiple neuraminidase subtypes were observed for H14 IAVs isolated in the New World. Gene segments of H14 viruses isolated after 2010 shared ancestral genetic lineages with IAVs isolated from wild birds throughout North America. Thus, genomic characterization provided evidence for viral evolution in New World waterfowl through genetic drift and genetic shift since purported introduction from Eurasia. In the challenge study, no clinical disease or lesions were observed among mallards experimentally inoculated with A/blue-winged teal/Texas/AI13-1028/2013(H14N5 or exposed via contact with infected birds. Titers of viral shedding for mallards challenged with the H14N5 IAV were highest at two days post-inoculation (DPI; however shedding was detected up to nine DPI using cloacal swabs. The distribution of viral antigen among mallards infected with H14N5 IAV was largely restricted to enterocytes lining the villi in the lower intestinal tract and in the epithelium of the bursa of Fabricius. Characterization of the infectivity of A/blue-winged teal/Texas/AI13

  19. Evidence of low genetic variation and rare alleles in a bottlenecked endangered island endemic, the Lasan Teal (Anas laysanensis)

    Science.gov (United States)

    Reynolds, Michelle H.; Pearce, John M.; Lavretsky, Philip; Peters Jeffrey L,; Courtot, Karen; Seixas, Pedro P.

    2015-01-01

    Genetic diversity is assumed to reflect the evolutionary potential and adaptability of populations, and thus quantifying the genetic diversity of endangered species is useful for recovery programs. In particular, if conservation strategies include reintroductions, periodic genetic assessments are useful to evaluate whether management efforts have resulted in the maximization or loss of genetic variation within populations over generations. In this study, we collected blood, feather, and tissue samples during 1999–2009 and quantified genetic diversity for a critically endangered waterfowl species endemic to the Hawaiian archipelago, the Laysan teal or duck (Anas laysanensis; n = 239 individual birds sampled). The last extant population of this species at Laysan Island was sourced in 2004–2005 for a ‘wild to wild’ translocation of 42 individuals for an experimental reintroduction to Midway Atoll. To inform future management strategies, we compared genetic diversity sampled from the source population (n = 133 Laysan birds) including 23 of Midway’s founders and offspring of the translocated population 2–5 years post release (n = 96 Midway birds). We attempted to identify polymorphic markers by screening nuclear microsatellite (N = 83) and intronic loci (N = 19), as well as the mitochondrial control region (mtDNA) for a subset of samples. Among 83 microsatellite loci screened, six were variable. We found low nuclear variation consistent with the species’ historical population bottlenecks and sequence variation was observed at a single intron locus. We detected no variation within the mtDNA. We found limited but similar estimates of allelic richness (2.58 alleles per locus) and heterozygosity within islands. Two rare alleles found in the Laysan Island source population were not present in the Midway translocated group, and a rare allele was discovered in an individual on Midway in 2008. We found similar genetic diversity and low, but statistically

  20. Antinuclear Antibodies (ANA)

    Science.gov (United States)

    ... Jaw (ONJ) Osteoporosis Paget's Disease of Bone Periodic Fever, Aphthous Stomatitis, Pharyngitis, Adenitis Syndrome (Juvenile) Polymyalgia Rheumatica Psoriatic Arthritis Raynaud's Phenomenon Reactive Arthritis Rheumatoid Arthritis ...

  1. ANA (Antinuclear Antibody Test)

    Science.gov (United States)

    ... polymyositis Centromere pattern (peripheral)—associated with scleroderma and CREST (Calcinosis, Raynaud syndrome, Esophogeal dysmotility, Sclerodactyly, Telangiectasia) A positive result from ...

  2. Northern Pintail (Anas acuta)

    Science.gov (United States)

    Austin, J.E.; Miller, M.R.; Poole, A.; Gill, F.

    1995-01-01

    The Northern Pintail is a medium-sized dabbling duck of slender, elegant lines and conservative plumage coloration. It is circumpolar in distribution and abundant in North America, with core nesting habitat in Alaska and the Prairie Pothole Region of southern Canada and the northern Great Plains. Breeders favor shallow wetlands interspersed throughout prairie grasslands or arctic tundra. An early fall migrant, the species arrives on wintering areas beginning in August, after wing molt, often forming large roosting and feeding flocks on open, shallow wetlands and flooded agricultural fields. The birds consume grains, marsh plant seeds, and aquatic invertebrates throughout the fall and winter. Northern Pintails are among the earliest nesting ducks in North America, beginning shortly after ice-out in many northern areas. Individuals form new pair bonds each winter but are highly promiscuous during the nesting season, with mated and unmated males often involved in vigorous, acrobatic Pursuit Flights. Annual nest success and productivity vary with water conditions, predation, and weather. Females build nests on the ground, often long distances from water. Only the female incubates; her mate leaves shortly after incubation begins. Ducklings hatch together in one day, follow the female to water after a day in the nest, and fledge by July or August. Adults and ducklings consume mainly aquatic invertebrates during the breeding season. Predators and farming operations destroy many thousands of Northern Pintail nests annually; farming has also greatly reduced the amount of quality nesting cover available. Winter habitats are threatened by water shortages, agricultural development, contamination, and urbanization. Periods of extended drought in prairie nesting regions have caused dramatic population declines, usually followed by periods of recovery. Over the long term, however, the continental population of Northern Pintails has declined significantly from 6 million birds in the early 1970s to less than 3 million in the late 1980s and early 1990s. However, new conservation measures, such as habitat restoration and enhancement of agricultural lands, as well as prudent harvest restrictions, suggest that Northern Pintails should have a secure future in North America.

  3. Rapidly variable relatvistic absorption

    Science.gov (United States)

    Parker, M.; Pinto, C.; Fabian, A.; Lohfink, A.; Buisson, D.; Alston, W.; Jiang, J.

    2017-10-01

    I will present results from the 1.5Ms XMM-Newton observing campaign on the most X-ray variable AGN, IRAS 13224-3809. We find a series of nine absorption lines with a velocity of 0.24c from an ultra-fast outflow. For the first time, we are able to see extremely rapid variability of the UFO features, and can link this to the X-ray variability from the inner accretion disk. We find a clear flux dependence of the outflow features, suggesting that the wind is ionized by increasing X-ray emission.

  4. Rapid prototype and test

    Energy Technology Data Exchange (ETDEWEB)

    Gregory, D.L.; Hansche, B.D.

    1996-06-01

    In order to support advanced manufacturing, Sandia has acquired the capability to produce plastic prototypes using stereolithography. Currently, these prototypes are used mainly to verify part geometry and ``fit and form`` checks. This project investigates methods for rapidly testing these plastic prototypes, and inferring from prototype test data actual metal part performance and behavior. Performances examined include static load/stress response, and structural dynamic (modal) and vibration behavior. The integration of advanced non-contacting measurement techniques including scanning laser velocimetry, laser holography, and thermoelasticity into testing of these prototypes is described. Photoelastic properties of the epoxy prototypes to reveal full field stress/strain fields are also explored.

  5. Right-Rapid-Rough

    Science.gov (United States)

    Lawrence, Craig

    2003-01-01

    IDEO (pronounced 'eye-dee-oh') is an international design, engineering, and innovation firm that has developed thousands of products and services for clients across a wide range of industries. Its process and culture attracted the attention of academics, businesses, and journalists around the world, and are the subject of a bestselling book, The Art of Innovation by Tom Kelley. One of the keys to IDEO's success is its use of prototyping as a tool for rapid innovation. This story covers some of IDEO's projects, and gives reasons for why they were successful.

  6. Jāņa Streiča mākslas filmu popularitātes fenomens: auditorijas gaidas un to apmierināšana

    OpenAIRE

    Kušķe, Zane

    2010-01-01

    Bakalaura darba tēma ir „Jāņa Streiča mākslas filmu popularitātes fenomens: auditorijas gaidas un to apmierināšana". Pētnieciskā darba mērķis ir mākslas filmās iekļautās veiksmes formulas atklāšana. Tēmas aktualitāti raksturo fakts, ka līdz šim nav bijuši līdzvērtīgi pētījumi par J.Streiča radošo profesionālo darbību. Teorētiskajā daļā aplūkotas populārās kultūras teorētiskās nostādnes un mākslas filmas kā šīs kultūras sfēras sastāvdaļa. Kino un auditorijas attiecības raksturo ...

  7. Pasaules autoražošanas krīze. Cēloņi un risinājumi.

    OpenAIRE

    Zaļlapa, Arturs

    2010-01-01

    Diplomdarbā ir izpētītās mūsdienu Autorūpniecības krīzes cēloņi un sekas. Autoražošana ir viena no svarīgākām nozarēm daudzās ekonomikas, tāpēc jebkuri nepareizi prognozi un lēmumi ir cieši saistīti ar ekonomisko un politisko nestabilitāti. Balstoties uz Ekonomisko ciklu teoriju un ar autoražošanu saistīto faktoru analīzi ir risināti šādi uzdevumi: tika izdarīta autoražošanas statistikas un hronoloģijas analīze; izmantojot iegūto informāciju ir noteikti krīzes apstākļi. Darbā gaita tika izsk...

  8. An unusual case of ANA negative systemic lupus erythematosus presented with vasculitis, long-standing serositis and full-house nephropathy.

    Science.gov (United States)

    Caltik, Aysun; Demircin, Gülay; Bülbül, Mehmet; Erdogan, Ozlem; Akyüz, Sare G; Arda, Nilüfer

    2013-01-01

    Systemic lupus erythematosus (SLE) is a chronic inflammatory autoimmune disease that may affect any organ of the body. We report here an unusual case of seronegative SLE presented as vasculitis with rash, lower gastrointestinal system bleeding and acute renal failure. The patient was a 13-year-old boy, with abdominal distention, pretibial edema, arthritis and petechia on bilateral ankles. He had deteriorated renal functions (creatinine 1.65 mg/dl), hypoalbuminemia (1.6 g/dl) and hypocomplementemia with nephrotic range proteinuria and hematuria. He developed pleural effusion and peritonitis. Serum ANA, anti dsDNA, p ANCA, c ANCA, anticardiolipin IgM and IgG titers were negative. A renal biopsy was performed which revealed diffuse proliferative glomerulonephritis with full-house staining pattern in immunofluorescent microscopic examination suggesting Class IV Lupus Nephritis. He was administered a total of six courses of monthly intravenous pulse methyl prednisolone, dipyridamole, oral cyclophosphamide followed by azothiopirine and oral prednisolone therapy. The renal functions and serum albumin levels turned normal but peritonitis persisted and disappeared after the third pulse steroid therapy. In conclusion, we presented this patient to remind the possibility of SLE in such seronegative patients with unusual findings in order to avoid the delay in the management of this disease with high mortality and morbidity if not treated. Full-house nephropathy is an important clue especially for the diagnosis of ANA negative SLE.

  9. Tirdzniecības sistēmas izstrādāšana starpbanku valūtas tirgū

    OpenAIRE

    Paļitovs, Aleksandrs

    2012-01-01

    Bakalaura darba tēma ir „Tirdzniecības sistēmas izstrādāšana starpbanku valūtas tirgū”. Valūtu tirgus popularitāti veicinājusi finanšu tirgus globalizācija, datorizācija un Interneta izmantošanas palielināšanās, kā arī relatīvi neliels nepieciešamais sākotnējais ieguldījums. Ļoti bieži iesācēji bez priekšzināšanām un pieredzi valūtu tirgū pazaudē savu depozītu. Forex tirdzniecība par 80% balstās uz paša treidera psiholoģiju. Lai minimizētu treideru emocionālus un psiholoģiskus faktorus, autor...

  10. Llamas y rescoldos nacionales: Con la vida hicieron fuego, novela de Jesús Evaristo Casariego (1953 y película de Ana Mariscal (1957

    Directory of Open Access Journals (Sweden)

    Alfonso García, M.ª del Carmen

    2012-12-01

    Full Text Available This paper examines a novel by Jesús Evaristo Casariego entitled Con la vida hicieron fuego, published in 1953, and its adaptation to the cinema by Ana Mariscal in 1957. Starting out from a comparative analysis of the novel and the film highlighting the similarities and the differences between them, this paper explores the meaning of both artistic proposals. As a theoretical framework, it will rely on theories that explore the construction of national identity and its connections with gender issues.Este artículo estudia la novela de Jesús Evaristo Casariego titulada Con la vida hicieron fuego, publicada en 1953, y la adaptación cinematográfica de la obra que Ana Mariscal realizó en 1957. A partir de las similitudes y diferencias que revela el análisis comparativo del texto y el filme, el trabajo busca establecer el sentido de ambas propuestas artísticas desde la perspectiva que proporciona el marco teórico relativo a la construcción de la identidad nacional y sus relaciones con la de género.

  11. Piktogrammu izmantošana ētikas mācībās bērniem ar uztveres traucējumiem

    OpenAIRE

    Dekšeniece, Zanda

    2012-01-01

    Šī pētniecības darba tēma ir: Piktogrammu izmantošana ētikas mācībās bērniem ar uztveres traucējumiem. Par mērķi tika izvirzīts noskaidrot, kā un vai piktogrammu izmantošana palīdz bērniem ar autismu apgūt ētikas mācību. Darbs sastāv no divām daļām. Pirmajā daļā ir divas nodaļas, pirmā – autisms (kas tas ir, tā cēloņi, raksturīgās īpašības, bērna intelektuālā attīstība). Otra nodaļa ir par piktogrammām (komunikācija ar attēliem, kas tas ir, kāpēc piktogrammas ir melnbaltas, krāsainās pikt...

  12. Envisat/ASAR Images for the Calibration of Wind Drag Action in the Doñana Wetlands 2D Hydrodynamic Model

    Directory of Open Access Journals (Sweden)

    Anaïs Ramos-Fuertes

    2013-12-01

    Full Text Available Doñana National Park wetlands are located in southwest Spain, on the right bank of the Guadalquivir River, near the Atlantic Ocean coast. The wetlands dry out completely every summer and progressively flood again throughout the fall and winter seasons. Given the flatness of Doñana’s topography, the wind drag action can induce the flooding or emergence of extensive areas, detectable in remote sensing images. Envisat/ASAR scenes acquired before and during strong and persistent wind episodes enabled the spatial delineation of the wind-induced water displacement. A two-dimensional hydrodynamic model of Doñana wetlands was built in 2006 with the aim to predict the effect of proposed hydrologic restoration actions within Doñana’s basin. In this work, on-site wind records and concurrent ASAR scenes are used for the calibration of the wind-drag modeling by assessing different formulations. Results show a good adjustment between the modeled and observed wind drag effect. Displacements of up to 2 km in the wind direction are satisfactorily reproduced by the hydrodynamic model, while including an atmospheric stability parameter led to no significant improvement of the results. Such evidence will contribute to a more accurate simulation of hypothetic or design scenarios, when no information is available for the atmospheric stability assessment.

  13. "Nadie dijo que fuera fácil ser una princesa": Una etnografía virtual de las web "Pro-ana"

    Directory of Open Access Journals (Sweden)

    Federica Deiana

    2011-05-01

    Full Text Available En este artículo presentaremos el análisis de una producción virtual de contenido controvertido, conocida con el nombre de “Pro-ana”, es decir a favor de la anorexia. Este material electrónico se caracteriza por compartir una visión de los Trastorno de la Conducta Alimentaria como posibles “estilos de vida”, en clara oposición a su entendimiento como conductas patológicas y perjudiciales para los sujetos que los padecen. En este trabajo proponemos investigar las dinámicas de funcionamiento, simbolización e incorporación de la propuesta Pro-ana; analizaremos las estrategias y los recursos simbólicos utilizados para dotar esta producción de un sentido propio, centrándonos en los dispositivos que permiten al paradigma Pro-ana de establecerse como un modelo explicativo alternativo al alcance de las usuarias de estas webs.

  14. Lietišķās angļu valodas intensificēšanas iespējas studiju procesā

    OpenAIRE

    Ate, Inese

    2006-01-01

    Dotā maģistra darba tēma ir “Lietišķās angļu valodas apguves intensificēšanas iespējas studiju procesā” Maģistra darba galvenā ideja ir balstīta uz atziņu, ka studiju procesam ir jaunas mūsdienu sabiedrības izvirzītas vajadzības. Valodas apgūšanai jānorit vienlaicīgi ar tādām svarīgām šodienas realitātes iezīmēm, kā aktīvu ieinteresētību, pašapliecināšanos un spēju pielietot apgūtās prasmes sevis pilnveidošanai. Daudzi svešvalodu mācīšanas teorijas pētnieki pēdējā laikā vairāk uzmanības...

  15. Empowerment for Ladies: readings of Milady of Myself by Maria Teresa Horta and Milady of What? by Ana Luísa Amaral

    Directory of Open Access Journals (Sweden)

    Fabio Mario da Silva

    2013-10-01

    Full Text Available The reunion with the “self”, the “dressing up” of self, in an innermost representation of the “feminine/female soul”, bringing some aspects of everyday-life as important references, allows Maria Teresa Horta and Ana Luísa Amaral to construct poetry in which the feminine lyrical self takes not only possession of what she observes, but also the power to make decisions about her life, as “lady” and “owner” of herself, in a speech free of patriarchal oppression. In this article we will analyze how various “ladies” are built in these two works, underlining that Minha Senhora de Mim is configured as a milestone of Portuguese poetry by women, opening a rift to restore possession of the speech (and of the body to women without sociocultural impediments that might limit the work of the woman writer; and how Ana Luísa Amaral, paraphrasing Maria Teresa Horta in an obvious homage in Minha Senhora de Quê builds a work with its own identity within a different feminist perspective.

  16. Lēmumu pieņemšana par jauno biotehnoloģiju izmantošanu: cilmes šūnu diskurss Latvijā

    OpenAIRE

    Kalēja, Jekaterina

    2010-01-01

    Maģistra darbā „Lēmumu pieņemšana par jauno biotehnoloģiju izmantošanu: cilmes šūnu diskurss Latvijā” analizēts, kādā veidā iedzīvotāji pieņem lēmumu par nabas saites cilmes šūnu tehnoloģijas izmantošanu Latvijā. Darba teorētiskā daļa ir balstīta uz P. Burdjē teorētisko perspektīvu un kā analīzes metode ir izmantota kritiskā diskursa analīze. Analīzē iegūti dati ļauj secināt, ka lēmuma pieņemšana balstās uz nsCŠ tehnoloģijai piesaistītu simboliskā kapitāla transformāciju, plūsmām starp laukie...

  17. NoSQL datu bāžu izmantošanas iespējas uzņēmumos

    OpenAIRE

    Plankais, Edgars

    2015-01-01

    Mūsdienās arvien lielāku popularitāti iegūst NoSQL datu bāzu sistēmas, jo tās spēj saglabāt liela apjoma datus un ir piemērotas specifisku problēmu risināšanai. Darba mērķis ir izpētīt NoSQL izmantošanas iespējas uzņēmumiem, un saprast, kā tās var palīdzēt risināt uzņēmējdarbības problēmas. Darba pirmajā daļā tiek apskatītas relāciju datu bāzes un to izmantošanas nepilnības, kas bija iemesls NoSQL attīstībai. Otrajā darba daļā tiek aplūkoti NoSQL datu bāzu arhitektūras modeļi un to izmanto...

  18. Klausīšanās mācīšana un mācīšanās vidusskolā

    OpenAIRE

    Ļisicinska, Diana

    2013-01-01

    Bakalaura darbs ir veltīts ir klausīšanās mācīšanas un mācīšanās jautājumiem vidusskolā. Darba pamatā ir to problēmu izpēte, ar kurām vidusskolēni saskaras klausīšanās procesā, gatavojoties noslēguma eksāmeniem. Rīgas ģimnāzijas 10. klases skolēniem tika piedāvāts piedalīties gadījuma izpētē, kuras laikā viņi pilnveidoja klausīšanās prasmes. Gadījuma izpētes ietvaros skolēni tika sadalīti divās grupās, vienai no kurām tika piedāvāts izpildīt pirmsklausīšanas uzdevumus, kas palīdzēja viņiem la...

  19. Direct Observation by Rapid-Scan FT-IR Spectroscopy of Two-Electron-Reduced Intermediate of Tetraaza Catalyst [CoIIN4H(MeCN)]2+ Converting CO 2 to CO

    Energy Technology Data Exchange (ETDEWEB)

    Sheng, Hua [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Molecular Biophysics and integrated Bioimaging Division; Frei, Heinz [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Molecular Biophysics and integrated Bioimaging Division

    2016-07-15

    In the search for the two-electron-reduced intermediate of the tetraaza catalyst [CoIIN4H(MeCN)]2+ (N4H = 2,12-dimethyl-3,7,11,17-tetraazabicyclo[11.3.1]heptadeca-1(17),2,11,13,15-pentaene) for CO2 reduction and elementary steps that result in the formation of CO product, rapid-scan FT-IR spectroscopy of the visible-light-sensitized catalysis, using Ir(ppy)3 in wet acetonitrile (CD3CN) solution, led to the observation of two sequential intermediates. The initially formed one-electron-reduced [CoIN4H]+--CO2 adduct was converted by the second electron to a transient [CoIN4H]+--CO2 - complex that spontaneously converted CO2 to CO in a rate-limiting step on the second time scale in the dark under regeneration of the catalyst (room temperature). The macrocycle IR spectra of the [CoIN4H]+--CO2 - complex and the preceding one-electron [CoIN4H]+--CO2 intermediate show close similarity but distinct differences in the carboxylate modes, indicating that the second electron resides mainly on the CO2 ligand. Vibrational assignments are corroborated by 13C isotopic labeling. The structure and stability of the two-electron-reduced intermediate derived from the time-resolved IR study are in good agreement with recent predictions by DFT electronic structure calculations. This is the first observation of an intermediate of a molecular catalyst for CO2 reduction during the bond-breaking step producing CO. The reaction pathway for the Co tetraaza catalyst uncovered here suggests that the competition between CO2 reduction and proton reduction of a macrocyclic multi-electron catalyst is steered toward CO2 activation if the second electron is directly captured by an adduct

  20. Rapid mineralocorticoid receptor trafficking.

    Science.gov (United States)

    Gekle, M; Bretschneider, M; Meinel, S; Ruhs, S; Grossmann, C

    2014-03-01

    The mineralocorticoid receptor (MR) is a ligand-dependent transcription factor that physiologically regulates water-electrolyte homeostasis and controls blood pressure. The MR can also elicit inflammatory and remodeling processes in the cardiovascular system and the kidneys, which require the presence of additional pathological factors like for example nitrosative stress. However, the underlying molecular mechanism(s) for pathophysiological MR effects remain(s) elusive. The inactive MR is located in the cytosol associated with chaperone molecules including HSP90. After ligand binding, the MR monomer rapidly translocates into the nucleus while still being associated to HSP90 and after dissociation from HSP90 binds to hormone-response-elements called glucocorticoid response elements (GREs) as a dimer. There are indications that rapid MR trafficking is modulated in the presence of high salt, oxidative or nitrosative stress, hypothetically by induction or posttranslational modifications. Additionally, glucocorticoids and the enzyme 11beta hydroxysteroid dehydrogenase may also influence MR activation. Because MR trafficking and its modulation by micro-milieu factors influence MR cellular localization, it is not only relevant for genomic but also for nongenomic MR effects. Copyright © 2013 Elsevier Inc. All rights reserved.

  1. Rapid response manufacturing (RRM)

    Energy Technology Data Exchange (ETDEWEB)

    Cain, W.D. [Lockheed Martin Energy Systems, Inc., Oak Ridge, TN (United States); Waddell, W.L. [National Centers for Manufacturing Sciences, Ann Arbor, MI (United States)

    1997-02-18

    US industry is fighting to maintain its competitive edge in the global market place. Today markets fluctuate rapidly. Companies, to survive, have to be able to respond with quick-to-market, improved, high quality, cost efficient products. The way products are developed and brought to market can be improved and made more efficient through the proper incorporation of emerging technologies. The RRM project was established to leverage the expertise and resources of US private industries and federal agencies to develop, integrate, and deploy new technologies that meet critical needs for effective product realization. The RRM program addressed a needed change in the US Manufacturing infrastructure that will ensure US competitiveness in world market typified by mass customization. This project provided the effort needed to define, develop and establish a customizable infrastructure for rapid response product development design and manufacturing. A major project achievement was the development of a broad-based framework for automating and integrating the product and process design and manufacturing activities involved with machined parts. This was accomplished by coordinating and extending the application of feature-based product modeling, knowledge-based systems, integrated data management, and direct manufacturing technologies in a cooperative integrated computing environment. Key technological advancements include a product model that integrates product and process data in a consistent, minimally redundant manner, an advanced computer-aided engineering environment, knowledge-based software aids for design and process planning, and new production technologies to make products directly from design application software.

  2. Comparison of Rapid Diagnostic Tests and Microscopy for Malaria ...

    African Journals Online (AJOL)

    Presumptive treatment of malaria results in significant overuse of antimalarials. This study compared the diagnostic accuracy of Histidine Rich Protein II and plasmodium lactate dehydrogenase (pLDH)-based Rapid Kits( RDTs)and using expert microscopy as the gold standard for the detection of falciparum and ...

  3. A rapid and convergent synthesis of the integrastatin core

    KAUST Repository

    Tadross, Pamela M.

    2011-01-01

    The tetracyclic core of the integrastatin natural products has been prepared in a convergent and rapid manner. Our strategy relies upon a palladium(ii)-catalyzed oxidative cyclization to form the central [3.3.1]-dioxabicycle of the natural product core. Overall, the core has been completed in only 4 linear steps from known compounds. © 2011 The Royal Society of Chemistry.

  4. Rapid Refresh (RAP) [13 km

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Rapid Refresh (RAP) numerical weather model took the place of the Rapid Update Cycle (RUC) on May 1, 2012. Run by the National Centers for Environmental...

  5. Rapid Refresh (RAP) [20 km

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Rapid Refresh (RAP) numerical weather model took the place of the Rapid Update Cycle (RUC) on May 1, 2012. Run by the National Centers for Environmental...

  6. Rapid chemical separations

    CERN Document Server

    Trautmann, N

    1976-01-01

    A survey is given on the progress of fast chemical separation procedures during the last few years. Fast, discontinuous separation techniques are illustrated by a procedure for niobium. The use of such techniques for the chemical characterization of the heaviest known elements is described. Other rapid separation methods from aqueous solutions are summarized. The application of the high speed liquid chromatography to the separation of chemically similar elements is outlined. The use of the gas jet recoil transport method for nuclear reaction products and its combination with a continuous solvent extraction technique and with a thermochromatographic separation is presented. Different separation methods in the gas phase are briefly discussed and the attachment of a thermochromatographic technique to an on-line mass separator is shown. (45 refs).

  7. (ii) and ni (ii) complexes with n

    African Journals Online (AJOL)

    DR. AMINU

    II) complexes with a. Schiff base derived from. 4-dimetylamino benzaldehyde and primary amines. The chemical analysis data showed the formation of (1:1) metal - ligand ratio and a square planar geometry was suggested for Co(II) and Ni(II) ...

  8. manganese(II) and uranyl(II)

    African Journals Online (AJOL)

    Paper electrophoresis is used for the study of equilibria in binary complex systems in solution. The stability constants of ML and ML2 complex species of some metal ions copper(II), manganese(II) and uranyl(II) with a-aminobutenoic acid and hydroxyproline were determined at an ionic strength of 0.1 M and 35 ºC.

  9. Elizabeth II uus kunstigalerii

    Index Scriptorium Estoniae

    1999-01-01

    Tähistamaks oma troonile asumise 50. aastapäeva, avab Elizabeth II 6. II 2002 Buckinghami palees uue kunstigalerii, mis ehitatakse palee tiibhoonena. Arhitekt John Simpson. Elizabeth II kunstikogust

  10. Trends in nutrient concentrations, loads, and yields in streams in the Sacramento, San Joaquin, and Santa Ana Basins, California, 1975-2004

    Science.gov (United States)

    Kratzer, Charles R.; Kent, Robert; Seleh, Dina K.; Knifong, Donna L.; Dileanis, Peter D.; Orlando, James L.

    2011-01-01

    A comprehensive database was assembled for the Sacramento, San Joaquin, and Santa Ana Basins in California on nutrient concentrations, flows, and point and nonpoint sources of nutrients for 1975-2004. Most of the data on nutrient concentrations (nitrate, ammonia, total nitrogen, orthophosphate, and total phosphorus) were from the U.S. Geological Survey's National Water Information System database (35.2 percent), the California Department of Water Resources (21.9 percent), the University of California at Davis (21.6 percent), and the U.S. Environmental Protection Agency's STOrage and RETrieval database (20.0 percent). Point-source discharges accounted for less than 1 percent of river flows in the Sacramento and San Joaquin Rivers, but accounted for close to 80 percent of the nonstorm flow in the Santa Ana River. Point sources accounted for 4 and 7 percent of the total nitrogen and total phosphorus loads, respectively, in the Sacramento River at Freeport for 1985-2004. Point sources accounted for 8 and 17 percent of the total nitrogen and total phosphorus loads, respectively, in the San Joaquin River near Vernalis for 1985-2004. The volume of wastewater discharged into the Santa Ana River increased almost three-fold over the study period. However, due to improvements in wastewater treatment, the total nitrogen load to the Santa Ana River from point sources in 2004 was approximately the same as in 1975 and the total phosphorus load in 2004 was less than in 1975. Nonpoint sources of nutrients estimated in this study included atmospheric deposition, fertilizer application, manure production, and tile drainage. The estimated dry deposition of nitrogen exceeded wet deposition in the Sacramento and San Joaquin Valleys and in the basin area of the Santa Ana Basin, with ratios of dry to wet deposition of 1.7, 2.8, and 9.8, respectively. Fertilizer application increased appreciably from 1987 to 2004 in all three California basins, although manure production increased in the

  11. Autoantibodies Profile in the Sera of Patients with Sjogren]s Syndrome: The ANA Evaluation—A Homogeneous, Multiplexed System

    Directory of Open Access Journals (Sweden)

    Boris Gilburd

    2004-01-01

    Full Text Available Background: Flow-based, multiplex bead arrays (MBA have been developed for a variety of applications including the detection of antibodies to extractable nuclear antigens (ENA. It offers a rapid and sensitive method to assess multiple analyses in a single tube/well.

  12. Coordinated Control of Multi-Agent Systems in Rapidly Varying Environments Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The main objective of this Phase II STTR project is to develop advanced control algorithms that enable multiple autonomous agents to perform complex tasks in rapidly...

  13. Methodology for Computer-aided, Interactive Rapid Assessment of Local or Regional Stress Fields on Mars

    Science.gov (United States)

    Colton, S. L.; Ferrill, D. A.; Sims, D. W.; Wyrick, D. Y.; Franklin, N. M.

    2003-03-01

    We present a method for rapid assessment of stress fields on Mars: (i) mapping geologic structures, (ii) calculating stress fields, and (iii) determining resolved stresses on faults. Preliminary results are presented for northern Utopia Planitia.

  14. Las yeguas marismeñas de Doñana: naturaleza, tradición e identidades sociales en un espacio protegido

    Directory of Open Access Journals (Sweden)

    Murphy, Michael D.

    2002-12-01

    Full Text Available The breeding of Andalusia's feral marsh horses stands out among other examples of Doñana National Park's extraordinary legacy of social and cultural traditions. This is so not only because of its importance as a venerable livestock management system, unique and vibrant still despite being surprisingly little known and scarecly studied, but also because it constitutes a notable example of the contributions that Andalusian culture has made to the rest of the world. Marsh animal husbandry is, without a doubt, the cultural matrix out of which developed the livestock traditions of the Americas. By situating this cultural complex within an International comparative framework, we argue that the human involvement with Doñana's feral horses may be distinguished from other similar cases in the world because their care and maintenance has been converted, to an extraordinary degree, into a central element of the local culture. Highly emotional social processes are involved in the construction and maintenance of a collective social identity that expresses itself in perennial conflicts with the authorities of the Park over its feral horses.

    Entre el extraordinario legado de tradiciones sociales y culturales del Parque Nacional de Doñana (Suroeste de Andalucía sobresale la cría de caballos marismeños asilvestrados, no sólo por su importancia como práctica ganadera ancestral, viva e insólita, sorprendentemente poco conocida y apenas estudiada, sino también porque constituye un ejemplo eminente de las contribuciones de la cultura andaluza al resto del mundo. La ganadería marismeña es, sin duda, la matriz cultural de las tradiciones ganaderas de América. En este artículo se aborda su análisis dentro de un marco comparativo internacional del que se deduce que lo que verdaderamente distingue la cría de los caballos marismeños de otros casos paralelos en el mundo es haberse convertido en un elemento central de la cultura local, mediante

  15. The acid-tolerant L-arabinose isomerase from the mesophilic Shewanella sp. ANA-3 is highly active at low temperatures

    Science.gov (United States)

    2011-01-01

    Background L-arabinose isomerases catalyse the isomerization of L-arabinose into L-ribulose at insight biological systems. At industrial scale of this enzyme is used for the bioconversion of D-galactose into D-tagatose which has many applications in pharmaceutical and agro-food industries. The isomerization reaction is thermodynamically equilibrated, and therefore the bioconversion rates is shifted towards tagatose when the temperature is increased. Moreover, to prevent secondary reactions it will be of interest to operate at low pH. The profitability of this D-tagatose production process is mainly related to the use of lactose as cheaper raw material. In many dairy products it will be interesting to produce D-tagatose during storage. This requires an efficient L-arabinose isomerase acting at low temperature and pH values. Results The gene encoding the L-arabinose isomerase from Shewanella sp. ANA-3 was cloned and overexpressed in Escherichia coli. The purified protein has a tetrameric arrangement composed by four identical 55 kDa subunits. The biochemical characterization of this enzyme showed that it was distinguishable by its maximal activity at low temperatures comprised between 15-35°C. Interestingly, this biocatalyst preserves more than 85% of its activity in a broad range of temperatures from 4.0 to 45°C. Shewanella sp. ANA-3 L-arabinose isomerase was also optimally active at pH 5.5-6.5 and maintained over 80% of its activity at large pH values from 4.0 to 8.5. Furthermore, this enzyme exhibited a weak requirement for metallic ions for its activity evaluated at 0.6 mM Mn2+. Stability studies showed that this protein is highly stable mainly at low temperature and pH values. Remarkably, T268K mutation clearly enhances the enzyme stability at low pH values. Use of this L-arabinose isomerase for D-tagatose production allows the achievement of attractive bioconversion rates of 16% at 4°C and 34% at 35°C. Conclusions Here we reported the purification and the

  16. Ecological similarities between two Mediterranean wetlands: Sidi Boughaba (North-West Morocco and the Doñana National Park (South-West Spain

    Directory of Open Access Journals (Sweden)

    Najat Elkhiati

    2013-04-01

    Full Text Available Addressing the underlying common processes within aquatic systems located in the same geographical region has long been used as a tool for the advancement of limnology. A limnological study of the Merja Sidi Boughaba in 2009 has shown that there are many common features between the physico-chemical and biological conditions of this site and previous data reported from some of the wetlands of the Doñana National Park (South-West Spain. Both are Ramsar sites located on extensive dune systems of the Atlantic coast with a Mediterranean climate. They have a common palaeoenvironmental history that is largely responsible for their similar hydrology and water composition. Oceanic influence has probably produced a slight disproportion of Mg2+ over Ca2+ through airborne sea salt deposition and the surface evaporation of groundwater feeding these wetlands during annual flood and drought cycles. The wide spectrum of environmental conditions encountered in the Doñana wetlands is epitomised by the Merja Sidi Boughaba, where water and sediment gradually change in the same water body from north to south: from humic-coloured waters and a sandy substrate to a calcium-rich substrate with turbid and silted waters which eventually dry out. As a consequence, the community of submersed macrophytes is very rich and dominated by dense charophyte beds. The high primary production coupled with high biodiversity found in the Merja Sidi Boughaba is also shared by the Doñana wetlands. The high conservation status of both sites enables a useful comparison to be made of the water quality of shallow aquatic systems at a regional scale which, contrary to the trophic classifications developed for deep stratified lakes in temperate regions, is not based on regressions between the concentrations of chlorophyll and total phosphorus (Tot-P but on the proportions of dissolved and particulate P pools. In these Mediterranean sites, nutrients are more efficiently recycled through the

  17. Building a rapid response team.

    Science.gov (United States)

    Halvorsen, Lisa; Garolis, Salomeja; Wallace-Scroggs, Allyson; Stenstrom, Judy; Maunder, Richard

    2007-01-01

    The use of rapid response teams is a relatively new approach for decreasing or eliminating codes in acute care hospitals. Based on the principles of a code team for cardiac and/or respiratory arrest in non-critical care units, the rapid response teams have specially trained nursing, respiratory, and medical personnel to respond to calls from general care units to assess and manage decompensating or rapidly changing patients before their conditions escalate to a full code situation. This article describes the processes used to develop a rapid response team, clinical indicators for triggering a rapid response team call, topics addressed in an educational program for the rapid response team members, and methods for evaluating effectiveness of the rapid response team.

  18. Ziemeļlatgales atbrīvošana 1920.g. janvārī – februārī: militārās operācijas norise

    OpenAIRE

    Burga, Māris

    2010-01-01

    Darbā tiek apskatīta Ziemeļlatgales atbrīvošanas operācija – daļa no pēdējā un vismazāk pētītā Latvijas Neatkarības kara posma – Latgales atbrīvošanas. Tikai pēc Latgales atbrīvošanas kļuva iespējama visu latviešu apdzīvoto reģionu apvienošana un pilnvērtīgas Latvijas valsts izveide. Darba mērķis ir apskatīt un izvērtēt Latvijas armijas darbību, tās panākumus un neveiksmes, Ziemeļlatgalē, 1920. gada janvārī. Darbs aptver laika posmu no 1919. gada novembra, kad sākās gatavošanās Latgales at...

  19. Problems of rapid growth.

    Science.gov (United States)

    Kim, T D

    1980-01-01

    South Korea's export-oriented development strategy has achieved a remarkable growth record, but it has also brought 2 different problems: 1) since the country's exports accounted for about 1% of total world export volume, the 1st world has become fearful about Korea's aggressive export drive; and 2) the fact that exports account for over 30% of its total gross national product (GNP) exposes the vulnerability of South Korea's economy itself. South Korea continues to be a poor nation, although it is rated as 1 of the most rapidly growing middle income economies. A World Bank 1978 report shows Korea to be 28th of 58 middle income countries in terms of per capita GNP in 1976. Of 11 newly industrializing countries (NIC), 5 in the European continent are more advanced than the others. A recent emphasis on the basic human needs approach has tended to downgrade the concept of GNP. Korea has only an abundant labor force and is without any natural resources. Consequently, Korea utilized an export-oriented development strategy. Oil requirements are met with imports, and almost all raw materials to be processed into exportable products must be imported. To pay import bills Korea must export and earn foreign exchange. It must be emphasized that foreign trade must always be 2-way traffic. In order to export more to middle income countries like Korea, the countries of the 1st world need to ease their protectionist measures against imports from developing countries.

  20. Rapid Polymer Sequencer

    Science.gov (United States)

    Stolc, Viktor (Inventor); Brock, Matthew W (Inventor)

    2013-01-01

    Method and system for rapid and accurate determination of each of a sequence of unknown polymer components, such as nucleic acid components. A self-assembling monolayer of a selected substance is optionally provided on an interior surface of a pipette tip, and the interior surface is immersed in a selected liquid. A selected electrical field is impressed in a longitudinal direction, or in a transverse direction, in the tip region, a polymer sequence is passed through the tip region, and a change in an electrical current signal is measured as each polymer component passes through the tip region. Each of the measured changes in electrical current signals is compared with a database of reference electrical change signals, with each reference signal corresponding to an identified polymer component, to identify the unknown polymer component with a reference polymer component. The nanopore preferably has a pore inner diameter of no more than about 40 nm and is prepared by heating and pulling a very small section of a glass tubing.

  1. Rapidly rotating red giants

    Science.gov (United States)

    Gehan, Charlotte; Mosser, Benoît; Michel, Eric

    2017-10-01

    Stellar oscillations give seismic information on the internal properties of stars. Red giants are targets of interest since they present mixed modes, wich behave as pressure modes in the convective envelope and as gravity modes in the radiative core. Mixed modes thus directly probe red giant cores, and allow in particular the study of their mean core rotation. The high-quality data obtained by CoRoT and Kepler satellites represent an unprecedented perspective to obtain thousands of measurements of red giant core rotation, in order to improve our understanding of stellar physics in deep stellar interiors. We developed an automated method to obtain such core rotation measurements and validated it for stars on the red giant branch. In this work, we particularly focus on the specific application of this method to red giants having a rapid core rotation. They show complex spectra where it is tricky to disentangle rotational splittings from mixed-mode period spacings. We demonstrate that the method based on the identification of mode crossings is precise and efficient. The determination of the mean core rotation directly derives from the precise measurement of the asymptotic period spacing ΔΠ1 and of the frequency at which the crossing of the rotational components is observed.

  2. Yumurtalı Penaeid Karides (Marsupenaeus japonicus Bate, 1888 ve Penaeus semisulcatus de Hann, 1844 Anaçlarının İki Farklı Yöntem ile Canlı Nakli.

    Directory of Open Access Journals (Sweden)

    Gürel Türkmen

    2015-12-01

    Full Text Available Penaeid karides anaçlarının doğru ve uygun nakli, stresten uzak kaliteli anaç temini ve sağlıklı kuluçkahane postlarva üretiminde önemli bir faktördür. Bu çalışmada, yumurtalı Marsupenaeus japonicus ve Penaeus semisulcatus anaçlarının açık tanklarda 20 anaç/100 lt yoğunluğunda ve çift polietilen torbalarda strafor kutular (40x50x30 cm içinde üç farklı (3, 4 ve 5 anaç/5 lt stok yoğunluğunda 12 saatlik canlı nakilleri araştırılmıştır. Kuluçkahaneye alındıktan sonra, açık tank naklinde yaşama ve yumurtalarını absorbe edenlerin oranı M. japonicus için %90 ve %17 olurken bu oranlar P. semisulcatus için %75 ve %40 olarak gerçekleşmiştir. Polietilen torbalarla yapılan nakilde her iki türde de stok yoğunluğu arttıkça çözünmüş oksijen konsantrasyonu ve pH düşmüştür. 3 ve 4 anaç/5 lt stok yoğunluklarında yaşama oranın %100 olarak kaydedilmesine ve yumurtalarını absorbe edenlerin oranlarının 5 anaç/5 lt stok yoğunluğundakilerden düşük olmasına rağmen tür içi ve türler arası yoğunluklarda yeterli (P < 0.05 fark bulunmamıştır

  3. Proyecto de abastecimiento a las poblaciones de Térmens y Menàrguens desde el sistema del Canal de Piñana

    OpenAIRE

    Martín Larraz, Ángel

    2008-01-01

    Este proyecto resuelve el precario sistema de abastecimiento de agua potable actual de las poblaciones de Térmens y Menàrguens sustituyéndolo por otro nuevo, que utiliza aguas del sistema del canal de Piñana, en concreto de la tubería de abastecimiento a Lleida que actualmente se está ejecutando en su segunda fase. Se llega a la solución mediante dos tuberías de fundición dúctil una para cada localidad que llenan los depósitos ya existentes, además se ponen las bases del sistema de telegestió...

  4. Fotogrāfiju virtuālas mitināšanas vietnes “Slickpic” izstrāde

    OpenAIRE

    Koņkovs, Nikolajs

    2013-01-01

    Fotogrāfiju virtuālas mitināšanas vietne „Slickpic” ir diezgan jauna sistēma, kuru izstrādāja entuziastu komandā no Latvijas. Pašlaik, vietne ir plašāk zināma un populāra ASV nekā Latvijā. Vietnes „Slickpic” izstrāde no manas puses ir vietnes pārvaldes lietojumprogrammas izstrāde. Lietojumprogramma ir izstrādāta uz modificētas SlickPic API bāzes C# valodā ar .NET Framework 4.0. Funkcionalitāte ir līdzīga MS Windows Gallery vai Adobe Lightroom. Ar lietojumprogrammas palīdzību lietotājs ...

  5. Smaku piesārņojuma novērtējums un izplatības modelēšana Saldus novadā

    OpenAIRE

    Treinovska, Zane

    2012-01-01

    Bakalaura darbā dots smaku piesārņojuma teorētiskais raksturojums, novērtēts un modelēts smaku piesārņojums Saldus novadā, pielietojot Gausa dispersijas matemātisko modeli ALOHA. Modelēšana veikta 16 Saldus novada uzņēmumiem, kas tiek uzskatīti par potenciālajiem smaku emisiju avotiem, izmantojot 2010.gada datus. Pēc iegūtajiem rezultātiem smaku dispersija ir kartēta izmantojot ArcMap 10 datorprogrammu, nosakot piesārņojuma ietekmes zonas. Papildus veikta dažādu meteoroloģisko faktoru ietekme...

  6. Seixas, Ana Maria, Políticas Educativas e Ensino Superior em Portugal: A inevitável presença do Estado

    OpenAIRE

    Teresa Maneca Lima

    2012-01-01

    A obra Políticas Educativas e Ensino Superior em Portugal publicada por Ana Maria Seixas centra-se na análise das várias tentativas de reforma do ensino superior desde os anos 70 até à actualidade, tendo em conta o contexto de criação de um espaço europeu de ensino superior. O livro presta um importante contributo ao conhecimento do sistema educativo português, nomeadamente pela sistematização de informação e análise do processo de expansão do ensino superior, bem como das alterações ocorrida...

  7. Vildagliptīna satura un blakuspiemaisījumu satura noteikšanas AEŠH metodes izstrāde un validācija

    OpenAIRE

    Paškova, Olga

    2015-01-01

    Vildagliptīna satura un blakuspiemaisījumu satura noteikšanas AEŠH metodes izstrāde un validācija. Paškova O., zinātniskie vadītāji Dr. Chem. Bolotin A., Dr. Chem. Mekšs P., Maģistra darbs, 86 lappuses, 34 attēli, 52 tabulas, 26 literatūras avoti, 4 pielikumi. Latviešu valodā. Vildagliptīns ir jaunas klases antidiabētiskais preparāts. Katrai AFV jāzin tās saturs un piemaisījumu daudzums, jo no tā ir atkarīga medikamenta iedarbība. Darbā tika izstrādātas AEŠH/UV metodes pamatvielas satura ...

  8. Mācību sasniegumu vērtēšana 6.klases matemātikas kursā

    OpenAIRE

    Amarova, Anastasija

    2014-01-01

    Bakalaura darba tēma: „Mācību sasniegumu vērtēšana 6.klases matemātikas kursā”. Bakalaura darba autors: Anastasija Amarova. Bakalaura darba mērķis: izpētīt skolēnu mācību sasniegumu vērtēšanu 6.klases matemātikas kursā. Bakalaura darbu veido ievads, piecas nodaļas, secinājumi, divi pielikumi, izmantotās literatūras saraksts ar 29 vienībām. Bakalaura darbā tika izanalizēta pedagoģiskā un psiholoģiskā literatūra par mācību sasniegumiem 6. klases matemātikas kursā; par mācību sasniegumu vērtē...

  9. La conjura de la invisibilidad: el sujeto infantil en algunos cuentos de Ana María Matute y Silvina Ocampo

    Directory of Open Access Journals (Sweden)

    Núria Calafell Sala

    2010-01-01

    Full Text Available Lectora de las historias de Andersen, Perrault y los hermanos Grimm, la literatura de Ana María Matute está protagonizada por niños que rompen con la imagen tradicional e impuesta desde el mundo adulto. Un buen ejemplo son los protagonistas de Los niños tontos, marcados por la marginación y la exclusión del adjetivo, pero portadores de un espíritu luchador que da lugar a una mirada que se bifurca y se amplía constantemente, ya sea para enfrentarse a un exterior que les es hostil, ya para buscar nuevas líneas de fuga por las que escapar. A su vez, la argentina Silvina Ocampo lleva a cabo una exploración del yo infantil que acaba descubriendo las distintas fisuras por las que la denominada realidad se rescribe.

  10. El carnaval del río: guardado en lo puro de sus raíces carnaval de santa ana

    Directory of Open Access Journals (Sweden)

    Enrique Royero

    2014-02-01

    Full Text Available Cuando es tiempo de carnestolendas, momento de trasgresión, el ser comienza a reproducir el inventario de creatividad en sus raíces. El carn2val de Santa Ana, como una festividad legada en el proceso de aculturación ytransculturación mediante el tamiz adelantado por la Iglesia Católica durante la conquista y el coloniaje realizado por España, dejó las raíces de este festíncapaz de producir el frondoso árbol que hoy se conoce como Carnaval del Río.

  11. Sinonīmu rindas krievu un latviešu valodā funkcionēšanas aspektā.

    OpenAIRE

    Kārkliņa, Kristīne

    2014-01-01

    Bakalaura darbs veltīts krievu un latviešu valodas sinonīmu rindu sastatīšanas paņēmieniem, pamatojoties uz lietvārdiem, kas apzīmē emocijas, un vārdu sinonīmu leksiski semantiskajai analīzei. Darba teorētiskajā daļā tiek izskatītas problēmas, kas saistītas ar jēdzieniem „sinonīmija”, „sastatīšana” un „funkcionēšana”. Pētījums var ieinteresēt studentus filologus, lingvistus, kas nodarbojas ar kontrastīvās lingvistikas jautājumiem un sinonīmu rindu funkcionēšanu dažādās valodās, psihologus...

  12. Barreto, António; Benavente, Ana; Figueiredo, Eurico; Ferreira, J. M. e Alexandre, Valentim, Pátria utópica: o Grupo de Genebra revisitado

    Directory of Open Access Journals (Sweden)

    Pilar Damião de Medeiros

    2012-12-01

    Full Text Available Em Pátria utópica, António Barreto, Ana Benavente, Eurico Figueiredo, José Medeiros Ferreira e Valentim Alexandre revisitam em conjunto a decisão do exílio, o seu engajamento político em clima universitário, a estadia em Genebra como espaço marginal de resistência, de formação pessoal e académica e, por fim, o seu regresso à Pátria. A referência às aspirações e lutas políticas, à prisão, e tortura nalguns casos, às discussões nos Cafés Landolt e du Commerce em Genebra, aos debates nos comício...

  13. Stresa optimizēšanas iespējas 12-13 gadus veciem pusaudžiem skolas vidē

    OpenAIRE

    Vēvere, Ieva

    2007-01-01

    Bakalaura darbā „Stresa optimizēšanas iespējas 12-13 gadus veciem pusaudžiem skolas vidē” tiek aplūkota stresa problēma skolā, noskaidroti galvenie pusaudžu stresori skolā, ka arī analizēta skolēnu stresa un sekmju līmeņa saistība. Darba autore: Ieva Vēvere Darba vadītāja: Dr.biol., Mag.paed. doc. Inta Kraukle Darba apjoms: darbs sastāv no 48 lpp, 10 tabulām, 5 grafiskajiem attēliem un 9 pielikumiem. Darba pirmajās trīs nodaļās analizēta literatūra par stresu, tā būtību un ietekm...

  14. Influence of different mineral and Organic pesticide treatments on Cd(II), Cu(II), Pb(II), and Zn(II) contents determined by derivative potentiometric stripping analysis in Italian white and red wines.

    Science.gov (United States)

    Salvo, Francesco; La Pera, Lara; Di Bella, Giuseppa; Nicotina, Mariano; Dugo, Giacomo

    2003-02-12

    This paper deals with the use of derivative potentiometric stripping analysis (dPSA) as a rapid and precise method to determine Cd(II), Cu(II), Pb(II), and Zn(II) levels in red and white wine samples from Sicily, Campania, and Tuscany and to investigate the possible connection between the content of these metals and the pesticide treatments used in vine-growing to control plant diseases and pests. dPSA allowed direct quantitation of heavy metals in acidified wines without any sample pretreatment. Mean recoveries of Cd(II), Cu(II), Pb(II), and Zn(II) ranged from 95.5 to 99.2% for white wine samples and from 96.1 to 100.0% for red wine samples. The obtained results showed that Cd(II) was not found in any sample and that Cu(II), Pb(II), and Zn(II) levels were always lower than the toxicity limits in both fungicide- and water-treated wines. Nevertheless, the contents of metals were increased in samples from organic and inorganic pesticides treatment with respect to the water-treated samples. In particular, quinoxyfen, dinocap-penconazole, and dinocap applications considerably increased Cu(II) and Zn(II) contents in white and red wines. The levels of lead were significantly raised by azoxystrobin and sulfur treatments.

  15. Unearthing The Eruptive Personality Of El Salvador's Santa Ana (Ilamatepec) Volcano Though In-depth Stratigraphic Analysis Of Pre-1904 Deposits

    Science.gov (United States)

    Gallant, E.; Martinez-Hackert, B.

    2011-12-01

    The Santa Ana (Ilamatepec) volcano (2384 m) in densely populated El Salvador Central America presents serious volcanic hazard potential. The volcano is a prevalent part of every day life in El Salvador; the sugarcane and coffee belt of the country are to its Southern and Western flanks, recreational areas lies to its East, and second and third largest cities of El Salvador exist within its 25 km radius. Understanding the eruptive characteristics and history is imperative due to the volcano's relative size (the highest in the country) and it's explosive, composite nature. Historical records indicate at least 9 potential VEI 3 eruptions since 1521 AD. The volcano's relative inaccessibility and potential hazards do not promote a vast reservoir of research activity, as can be seen in the scarcity of published papers on topics prior to the 1904 eruption. This research represents the first steps towards creating a comprehensive stratigraphic record of the crater and characterizing its eruptive history, with an eventual goal of recreating the volcanic structure prior to its collapse. Samples of pre-1904 eruptive material were taken from the southern wall of an E-W oriented fluvial gully located within the SSW of the tertiary crater. These were analyzed using thin sections and optical microscopy, grain size distribution techniques, and scanning electron microscopy. The 15-layer sequence indicates an explosive history characterized by intense phreatomagmatic phases, plinian, sub-plinian and basaltic/andesitic composition strombolian activity. Another poster within the session will discuss an older sequence within the walls of the secondary crater. Further detailed studies will be required to gain a better understanding of the characteristics of Santa Ana Volcano.

  16. Evidences of volcanic unrest on high-temperature fumaroles by satellite thermal monitoring: The case of Santa Ana volcano, El Salvador

    Science.gov (United States)

    Laiolo, M.; Coppola, D.; Barahona, F.; Benítez, J. E.; Cigolini, C.; Escobar, D.; Funes, R.; Gutierrez, E.; Henriquez, B.; Hernandez, A.; Montalvo, F.; Olmos, R.; Ripepe, M.; Finizola, A.

    2017-06-01

    On October 1st, 2005, Santa Ana volcano (El Salvador) underwent a VEI 3 phreatomagmatic eruption after approximately one century of rest. Casualties and damages to some of the local infrastructures and surrounding plantations were followed by the evacuation of the nearby communities. The analysis of MODIS (Moderate Resolution Imaging Spectroradiometer) infrared data reveals that the main explosion was preceded by a one-year-long thermal unrest, associated to the development of a fumaroles field, located at the western rim of the summit crater lake. By combining space-based thermal flux and ground-based measurements (seismicity, sulfur emissions and lake temperatures), we suggest that the activity observed at Santa Ana between 2004 and 2005 was driven by the gradual intrusion of an undegassed magma body at a very shallow depth. Magma injection induced thermal anomalies associated with sustained degassing from the fumaroles field and promoted the interaction between the magmatic-hydrothermal system and the overlying water table. This process culminated into the VEI 3 phreatomagmatic eruption of October 2005 that strongly modified the shallow structure of the crater area. The subsequent three-years-long activity resulted from self-sealing of the fracture system and by the opening of a new fracture network directly connecting the deeper hydrothermal system with the crater lake. Our results show that satellite-based thermal data allow us to detect the expansion of the high-temperature fumarolic field. This may precede an explosive eruption and/or a lava dome extrusion. In particular, we show that thermal records can be analyzed with other geochemical (i.e. SO2 emissions) and geophysical (seismicity) data to track a shallow magmatic intrusion interacting with the surrounding hydrothermal system. This provides a remarkable support for volcano monitoring and eruption forecasting, particularly in remote areas where permanent ground data acquisition is hazardous, expensive

  17. Rapid mixing kinetic techniques.

    Science.gov (United States)

    Martin, Stephen R; Schilstra, Maria J

    2013-01-01

    Almost all of the elementary steps in a biochemical reaction scheme are either unimolecular or bimolecular processes that frequently occur on sub-second, often sub-millisecond, time scales. The traditional approach in kinetic studies is to mix two or more reagents and monitor the changes in concentrations with time. Conventional spectrophotometers cannot generally be used to study reactions that are complete within less than about 20 s, as it takes that amount of time to manually mix the reagents and activate the instrument. Rapid mixing techniques, which generally achieve mixing in less than 2 ms, overcome this limitation. This chapter is concerned with the use of these techniques in the study of reactions which reach equilibrium; the application of these methods to the study of enzyme kinetics is described in several excellent texts (Cornish-Bowden, Fundamentals of enzyme kinetics. Portland Press, 1995; Gutfreund, Kinetics for the life sciences. Receptors, transmitters and catalysis. Cambridge University Press, 1995).There are various ways to monitor changes in concentration of reactants, intermediates and products after mixing, but the most common way is to use changes in optical signals (absorbance or fluorescence) which often accompany reactions. Although absorbance can sometimes be used, fluorescence is often preferred because of its greater sensitivity, particularly in monitoring conformational changes. Such methods are continuous with good time resolution but they seldom permit the direct determination of the concentrations of individual species. Alternatively, samples may be taken from the reaction volume, mixed with a chemical quenching agent to stop the reaction, and their contents assessed by techniques such as HPLC. These methods can directly determine the concentrations of different species, but are discontinuous and have a limited time resolution.

  18. and ni(ii)

    African Journals Online (AJOL)

    userpc

    with nickel(II) and cobalt(II) chloride in 2:1 mole ratio yielded Ni(II) and Co(II) complexes respectively. The synthesized compounds were characterized based on melting point/decomposition temperature, solubility, molar conductance, magnetic susceptibility and infrared spectral analyses. The complexes have low molar ...

  19. Preparation and Antimicrobial Screeningof Cu (II, Ni (II, Zn (II Cd (II Complexes

    Directory of Open Access Journals (Sweden)

    R. M. Desai

    2006-01-01

    Full Text Available The metal complexes of Ni(II, Cu(II, Zn(II Cd(II with organic ligands viz Hydrazine hydrate, 1,2-N,N'-Bisammonium thiocarbamoyl ethane and 1,4-N,N'-Bisammonium thiocarbamoyl benzene have been prepared. These ligands and metal complexes of dithiocarbamates were screened for their antimicrobial activity against various microbs.

  20. Copper (II), cobalt (II), nickel (II) and zinc (II) complexes of Schiff ...

    Indian Academy of Sciences (India)

    Abstract. New Schiff base chelates of Cu(II), Co(II), Ni(II) and Zn(II) derived from benzil-2,4-dinitrophenylhydrazone with aniline have been synthesised. Microanalytical data, molar conductance, and magnetic susceptibility values have been obtained, and IR, 1H NMR, 13C NMR, UV-Vis, CV and EPR spectral studies have ...

  1. Rapid Active Sampling Package

    Science.gov (United States)

    Peters, Gregory

    2010-01-01

    A field-deployable, battery-powered Rapid Active Sampling Package (RASP), originally designed for sampling strong materials during lunar and planetary missions, shows strong utility for terrestrial geological use. The technology is proving to be simple and effective for sampling and processing materials of strength. Although this originally was intended for planetary and lunar applications, the RASP is very useful as a powered hand tool for geologists and the mining industry to quickly sample and process rocks in the field on Earth. The RASP allows geologists to surgically acquire samples of rock for later laboratory analysis. This tool, roughly the size of a wrench, allows the user to cut away swaths of weathering rinds, revealing pristine rock surfaces for observation and subsequent sampling with the same tool. RASPing deeper (.3.5 cm) exposes single rock strata in-situ. Where a geologist fs hammer can only expose unweathered layers of rock, the RASP can do the same, and then has the added ability to capture and process samples into powder with particle sizes less than 150 microns, making it easier for XRD/XRF (x-ray diffraction/x-ray fluorescence). The tool uses a rotating rasp bit (or two counter-rotating bits) that resides inside or above the catch container. The container has an open slot to allow the bit to extend outside the container and to allow cuttings to enter and be caught. When the slot and rasp bit are in contact with a substrate, the bit is plunged into it in a matter of seconds to reach pristine rock. A user in the field may sample a rock multiple times at multiple depths in minutes, instead of having to cut out huge, heavy rock samples for transport back to a lab for analysis. Because of the speed and accuracy of the RASP, hundreds of samples can be taken in one day. RASP-acquired samples are small and easily carried. A user can characterize more area in less time than by using conventional methods. The field-deployable RASP used a Ni

  2. Rapid Robot Design Validation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Energid Technologies will create a comprehensive software infrastructure for rapid validation of robotic designs. The software will support push-button validation...

  3. Rapid Robot Design Validation Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Energid Technologies will create a comprehensive software infrastructure for rapid validation of robot designs. The software will support push-button validation...

  4. Sociālo tīklu izmantošana pusaudžu vecumā un to vadīšanas iespējas interešu izglītībā

    OpenAIRE

    Biezais, Artūrs

    2015-01-01

    Pētījuma nosaukums ir „Sociālo tīklu izmantošana pusaudžu vecumā un to vadīšanas iespējas interešu izglītībā”. Dažādos pētījumos ir pierādīts, ka tieši pusaudžu vecumposms ir tas, kurā bērni visvairāk laika pavada sociālajos tīklos. Viņi tiem piekļūst ar datoru, ar viedtālruņu un planšetdatoru palīdzību. Neskatoties uz to, ka bērni sociālos tīklus ļoti aktīvi izmanto ārpus skolas, viņi tos izmanto arī skolā un pat mācību stundās. Tā ir mūsdienu realitāte, kas visnotaļ, atkarībā no sociālo med...

  5. Radošās darbības atraisīšana un attīstīšana pētot fovismu vizuālās mākslas stundās 7.klasē

    OpenAIRE

    Alsberga, Mārīte

    2008-01-01

    Diplomdarba mērķis – izpētīt kā fovisma virziena apguve sekmē skolēnu radošās darbības atraisīšanu un attīstīšanu 7. klasē. Diplomdarbs ar nosaukumu „Radošās darbības atraisīšana un attīstīšana pētot fovismu vizuālās mākslas stundās 7.klasē ” sastāv no ievada, 3 nodaļām, nobeiguma, izmantotās literatūras saraksta, anotācijas latviešu un angļu valodā, 4 pielikumiem. Pirmā nodaļa – fovisma virziens; Otrā nodaļa - teorētiskās pamatnostādnes; Trešā nodaļa – pedagoģiskā izmēģinājuma ...

  6. Rapid prototyping in medical sciences

    Directory of Open Access Journals (Sweden)

    Ákos Márk Horváth

    2015-09-01

    Full Text Available Even if it sound a bit incredible rapid prototyping (RPT as production method has been used for decades in other professions. Nevertheless medical science just started discover the possibilities of this technology and use the offered benefits of 3D printing. In this paper authors have investigated the pharmaceutical usage of rapid prototyping.

  7. Terapias utilizadas no Hospital Colônia Sant'Ana: berço da psiquiatria catarinense (1941-1960 Terapias utilizadas en el Hospital Colônia Sant'Ana: la origen de la psiquiatria catarinenese (1941-1960 Therapies used in Hospital Colônia Sant'Ana: the cradle of psychiatry in Santa Catarina State, Brazil (1941-1960

    Directory of Open Access Journals (Sweden)

    Miriam Süsskind Borenstein

    2007-12-01

    Full Text Available Trata-se de uma pesquisa qualitativa de natureza sócio-histórica cujo objetivo foi historicizar o tratamento prestado aos pacientes psiquiátricos internados no antigo Hospital Colônia Santa'Ana (HCS, no período de 1941 a 1960. Para a coleta de dados foram realizadas entrevistas semi-estruturadas com cinco funcionários que trabalharam no Hospital no período, utilizando-se o Método de História Oral (HO. Após a análise das entrevistas utilizando-se da análise de conteúdo de Bardin, chegou-se aos seguintes resultados: os doentes psiquiátricos internados faziam uso de algumas terapias como: eletrochoque, insulinoterapia, cardiazol, psicofármacos, praxiterapia e assistência heterofamiliar. Embora muitas destas terapias atualmente estejam em desuso, e sejam criticadas por diversos segmentos sociais, estavam na época, em consonância ao preconizado pela psiquiatria mundial.El presente artículo es producto de una investigación cualitativa de naturaleza socio-histórica, cuyo objetivo fue el de historiar el tratamiento dado a los pacientes psiquiátricos internados en el antiguo Hospital Colônia Santa'Ana (HCS, en el período de 1941 a 1960. Para la recolección de los datos fueron realizadas entrevistas parcialmente elaboradas con cinco empleados que trabajaron en el Hospital en el período citado, utilizándose para ello el Método de Historia Oral (HO. Después del análisis de las entrevistas, para el cual se utilizó el análisis de contenido de Bardin, se llegó a los siguientes resultados: en los enfermos psiquiátricos internados se empleaban algunas terapias como: electroshock, insulinoterapia, cardiazol, psicofármacos, laborterapia y asistencia heterofamiliar. Aunque actualmente muchas de estas terapias se encuentran en desuso y son criticadas por diversos segmentos sociales, en la época estaban de acuerdo a lo recomendado por la psiquiatría mundial.This article is a qualitative research with socio-historical approach

  8. Manganese(II) chelates of bioinorganic and medicinal relevance: Synthesis, characterization, antibacterial activity and 3D-molecular modeling of some penta-coordinated manganese(II) chelates in O,N-donor coordination matrix of β-diketoenolates and picolinate

    OpenAIRE

    R.C. Maurya; Bohre, P.; Sahu, S.; Martin, M.H.; Sharma, A. K.

    2016-01-01

    Four new mixed-ligand complexes of manganese(II) of the composition [Mn(pa)(L)(H2O)], where paH = picolinic acid and LH = acetoacetanilide (aaH), o-acetoacetanisidide (o-aansH), o-acetoacetotoluidide (o-aatdH) or ethylacetoacetate (eacacH), have been synthesized by the interaction of MnCl2·4H2O with the said ligands in aqueous-ethanol medium. The complexes so obtained have been characterized on the basis of elemental analyses, molar conductance and magnetic measurements, thermogravimetric ana...

  9. Processing of angiotensin II (A-II) and (Sar1,Ala8)A-II by cultured bovine adrenocortical cells.

    Science.gov (United States)

    Crozat, A; Penhoat, A; Saez, J M

    1986-06-01

    Bovine adrenocortical cells, cultured in a chemically defined medium, were used to study the fate of [125I] iodoangiotensin II ([125I]iodo-A-II) and its antagonist (Sar1,Ala8)A-II ([125I]iodo-Saralasin). The binding of both ligands was time and temperature dependent. The maximum specific binding at 37 C, which was reached within 1 h, was followed by a decline with a half-life of about 2 h and 8 h for [125I]iodo-A-II and [125I]iodo-Saralasin, respectively. The decrease of the specific binding was parallel to the appearance in the medium of degraded ligand. At 4 C, the binding of [125I]iodo-A-II was stable for 12 h and no degradation of ligand occurred. Under several experimental conditions, about 70% of the total [125I]iodo-A-II bound was internalized, whereas, in the case of [125I]iodo-Saralasin, less than 25% of the total bound ligand was internalized. These differences in the binding kinetics between A-II and its antagonist were mainly the differences in the rate of internalization of the bound ligands, more rapid for [125I]iodo-A-II (t1/2 approximately equal to 10 min) than for [125I]iodo-Saralasin (t1/2 = 90 min). On the other hand, the rate of degradation of internalized ligand was similar for both ligands (t1/2 = 15 min). Ionophore monensin enhanced the total cellular uptake of both ligands by increasing the amount of internalized ligands. Monensin did not modify the rate of internalization of the two ligands but markedly decreased their rate of degradation (t1/2 approximately equal to 60 min). These results indicate that both A-II and its antagonist are internalized and degraded by adrenocortical cells, but the rate of internalization of the antagonist is lower than that of the agonist. They also show that receptor-mediated endocytosis is the main pathway by which A-II is rapidly degraded by adrenocortical cells. Since A-II receptors are present in many tissues, the receptor-mediated degradation could explain the very short half-life in plasma of this

  10. How Rapid is Rapid Prototyping? Analysis of ESPADON Programme Results

    Directory of Open Access Journals (Sweden)

    Ian D. Alston

    2003-05-01

    Full Text Available New methodologies, engineering processes, and support environments are beginning to emerge for embedded signal processing systems. The main objectives are to enable defence industry to field state-of-the-art products in less time and with lower costs, including retrofits and upgrades, based predominately on commercial off the shelf (COTS components and the model-year concept. One of the cornerstones of the new methodologies is the concept of rapid prototyping. This is the ability to rapidly and seamlessly move from functional design to the architectural design to the implementation, through automatic code generation tools, onto real-time COTS test beds. In this paper, we try to quantify the term “rapid” and provide results, the metrics, from two independent benchmarks, a radar and sonar beamforming application subset. The metrics show that the rapid prototyping process may be sixteen times faster than a conventional process.

  11. Type II Supernova Spectral Diversity. II. Spectroscopic and Photometric Correlations

    Science.gov (United States)

    Gutiérrez, Claudia P.; Anderson, Joseph P.; Hamuy, Mario; González-Gaitan, Santiago; Galbany, Lluis; Dessart, Luc; Stritzinger, Maximilian D.; Phillips, Mark M.; Morrell, Nidia; Folatelli, Gastón

    2017-11-01

    We present an analysis of observed trends and correlations between a large range of spectral and photometric parameters of more than 100 type II supernovae (SNe II), during the photospheric phase. We define a common epoch for all SNe of 50 days post-explosion, where the majority of the sample is likely to be under similar physical conditions. Several correlation matrices are produced to search for interesting trends between more than 30 distinct light-curve and spectral properties that characterize the diversity of SNe II. Overall, SNe with higher expansion velocities are brighter, have more rapidly declining light curves, shorter plateau durations, and higher 56Ni masses. Using a larger sample than previous studies, we argue that “Pd”—the plateau duration from the transition of the initial to “plateau” decline rates to the end of the “plateau”—is a better indicator of the hydrogen envelope mass than the traditionally used optically thick phase duration (OPTd: explosion epoch to end of plateau). This argument is supported by the fact that Pd also correlates with s 3, the light-curve decline rate at late times: lower Pd values correlate with larger s 3 decline rates. Large s 3 decline rates are likely related to lower envelope masses, which enables gamma-ray escape. We also find a significant anticorrelation between Pd and s 2 (the plateau decline rate), confirming the long standing hypothesis that faster declining SNe II (SNe IIL) are the result of explosions with lower hydrogen envelope masses and therefore have shorter Pd values. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile; and the Gemini Observatory, Cerro Pachon, Chile (Gemini Program GS- 2008B-Q-56). Based on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere, Chile (ESO Programs 076.A-0156, 078.D-0048, 080.A-0516, and 082.A-0526).

  12. Análisis de la comunicación grupal: un año de experiencia con un grupo terapéutico de ayuda interactiva

    Directory of Open Access Journals (Sweden)

    Marina Roustan

    2017-01-01

    Full Text Available La ayuda interactiva grupal basada en la comunicación y sustentada en la combinación de los ejes de trabajo analítico, formativo y de ayuda social, está entendida como la voluntad y el interés en querer ayudar y ser ayudado, con el objetivo de ex- plotar la capacidad propia para desplegar perspectivas de futuro resilientes acordes a los deseos propios. Este artículo presenta un modelo de implicación práctica que deriva de una investigación empírica realizada con la metodología observacional, que describe y analiza la evolución de un grupo de tarea y relación como caso único, a lo largo de un año de tratamiento. Palabras clave: Análisis de la comunicación, Ayuda interactiva, Grupo de comunicación, Psicología psico-educativa. Abstract e group interactive help based on communication and supported by the combination of analytical, educational and welfare-work axes, is understood as the willingness and interest in wanting to help and be helped, with the aim of exploiting one’s ability to deploy prospects commensurate with one’s own desires resilient future. is article presents a model of practical implication that derives from an empirical research with observational methodology, describes and analyzes the evolution of task and relationship group as a unique case, over one year of treatment. Key words: Communication analysis, Interactive support, Group communication, Psycho-educational psychology. Resumo A ajuda interativa em grupo fundamentada na comunicação e apoiado pela combinação dos eixos de trabalho analí- tico, formativo e apoio social, é entendida como a vontade e interesse em querer ajudar e ser ajudado, a m de explorar a capacidade de implantar perspectivas proporcionais próprios desejos de um futuro resistente. Este artigo apresenta um modelo de implicação prática derivada da pesquisa empírica com a metodologia de observação que descreve e analisa a evolução de um

  13. Solid Phase Extraction of Bryophyte Lipids / Briofītu lipīdu cietfāzes ekstrakcijas frakcionēšana

    Directory of Open Access Journals (Sweden)

    Klavina Laura

    2015-11-01

    Full Text Available Pētījuma ietvaros izstrādāta vienkārša, ātra un viegli atkārtojama analītiska metode briofītu lipīdu frakcionēšanai. Lipīdu frakcijas frakcionēšanai izmantoja cietfāzes ekstrakciju ar silikagēlu un ar NH2 grupām modificētu silikagēlu, iegūtās vielu grupas kvantificēja kā to trimetilsilil atvasinājumus, izmantojot gāzes hromatogrāfiju-masas spektrometriju. Frakcionēšanu veica, izmantojot eluentu polaritātes gradienta principu (eluenti: heksāns, heksāns/hloroforms 5:1, hloroforms, kā pēdējo eluentu ar NH2 grupām modificēta silikagēla gadījumā izmantojot skābes (etiķskābes šķīdumu. Izpētes objekti bija divi Latvijā plaši izplatīti sūnaugi (Polytrichum commune, Dicranum polysetum, kuru sastāvā identificēja vairāk nekā 45 dažādus savienojumus, daudzi no kuriem ir ar augstu bioloģisko aktivitāti. Sūnaugu sastāvā identificēja sterolus, tokoferolus, taukskābes un citi savienojumus. Izmantotā frakcionēšanas shēma pavēra iespējas identificēt daudzus savienojumus, kuri kopējā ekstrakta hromatogrammā nebija uzrādīti, piemēram, alkānu rindas savienojumi, vairāki steroli. Līdz ar to sūnaugu lipīdu cietfāzes frakcionēšanas metode ļāva noteikt vielu klātbūtni, kuras atrodas mikrodaudzumos, bet kuras varēja ļaut izsekot brīofītu pārvērtībām bioģeoķīmiskos procesos. Ieteiktā frakcionēšanas metode ļāva arī identificēt vairākas vielu grupas, kuras varētu būt perspektīvas kā jaunas bioloģiski aktīvas vielas, kā arī palīdzēja labāk izprast briofītu metabolismu, piemēram starpsugu atšķirības un sastāva sezonālās mainības raksturu.

  14. Determination of Pb(II), Zn(II), Cd(II), and Co(II) ions by flame atomic absorption spectrometry in food and water samples after preconcentration by coprecipitation with Mo(VI)-diethyldithiocarbamate.

    Science.gov (United States)

    Tufekci, Mehmet; Bulut, Volkan Numan; Elvan, Hamide; Ozdes, Duygu; Soylak, Mustafa; Duran, Celal

    2013-02-01

    A new, simple, and rapid separation and preconcentration procedure, for determination of Pb(II), Cd(II), Zn(II), and Co(II) ions in environmental real samples, has been developed. The method is based on the combination of coprecipitation of analyte ions by the aid of the Mo(VI)-diethyldithiocarbamate-(Mo(VI)-DDTC) precipitate and flame atomic absorption spectrometric determinations. The effects of experimental conditions like pH of the aqueous solution, amounts of DDTC and Mo(VI), standing time, centrifugation rate and time, sample volume, etc. and also the influences of some foreign ions were investigated in detail on the quantitative recoveries of the analyte ions. The preconcentration factors were found to be 150 for Pb(II), Zn(II) and Co(II), and 200 for Cd(II) ions. The detection limits were in the range of 0.1-2.2 μg L(-1) while the relative standard deviations were found to be lower than 5 % for the studied analyte ions. The accuracy of the method was checked by spiked/recovery tests and the analysis of certified reference material (CRM TMDW-500 Drinking Water). The procedure was successfully applied to seawater and stream water as liquid samples and baby food and dried eggplant as solid samples in order to determine the levels of Pb(II), Cd(II), Zn(II), and Co(II) ions.

  15. and Cu(II)

    African Journals Online (AJOL)

    MBI

    thereby enhancing higher affinity for the metal ions when compared to the monodentate ligands. Stability constant values of various metal ion complexes involving chelating ligands such as. Ni(II) – famotidine C8H15N7O2S3 complex, Cu-. Dapsone complex, Co(II), and Ni(II) – mixed ligand complexes of amino acids and ...

  16. Equilibrium and kinetic studies of Pb(II, Cd(II and Zn(II sorption by Lagenaria vulgaris shell

    Directory of Open Access Journals (Sweden)

    Mitić-Stojanović Dragana-Linda

    2012-01-01

    Full Text Available The sorption of lead, cadmium and zinc ions from aqueous solution by Lagenaria vulgaris shell biosorbent (LVB in batch system was investigated. The effect of relevant parameters such as contact time, biosorbent dosage and initial metal ions concentration was evaluated. The Pb(II, Cd(II and Zn(II sorption equilibrium (when 98% of initial metal ions were sorbed was attained within 15, 20 and 25 min, respectively. The pseudo first, pseudo-second order, Chrastil’s and intra-particle diffusion models were used to describe the kinetic data. The experimental data fitted the pseudo-second order kinetic model and intra-particle diffusion model. Removal efficiency of lead(II, cadmium(II and zinc(II ions rapidly increased with increasing biosorbent dose from 0.5 to 8.0 g dm-3. Optimal biosorbent dose was set to 4.0 g dm-3. An increase in the initial metal concentration increases the sorption capacity. The sorption data of investigated metal ions are fitted to Langmuir, Freundlich and Temkin isotherm models. Langmuir model best fitted the equilibrium data (r2 > 0.99. Maximal sorption capacities of LVB for Pb(II, Cd(II and Zn(II at 25.0±0.5°C were 0.130, 0.103 and 0.098 mM g-1, respectively. The desorption experiments showed that the LVB could be reused for six cycles with a minimum loss of the initial sorption capacity.

  17. Comparison of APACHE II and three abbreviated APACHE II scores for predicting outcome among emergency trauma patients.

    Science.gov (United States)

    Polita, Jorge Roberto; Gomez, Jussara; Friedman, Gilberto; Ribeiro, Sérgio Pinto

    2014-07-01

    to compare the ability of the APACHE II score and three different abbreviated APACHE II scores: simplified APACHE II (s-APACHE II), Rapid Acute Physiology score (RAPS) and Rapid Emergency Medicine score to evaluate in-hospital mortality of trauma patients at the emergency department (ED). retrospective analysis of a prospective cohort study. All patients' victims of trauma admitted to the ED, during a 5 months period. For all entries to the ED, APACHE II score was calculated. APACHE II system was abbreviated by excluding the laboratory data to calculate s-APACHE II score for each patient. Individual data were reanalyzed to calculate RAPS and REMS. APACHE II score and its subcomponents were collected, and in-hospital mortality was assessed. The area under the receiver operating characteristic (AUROC) curve was used to determine the predictive value of each score. 163 patients were analyzed. In-hospital mortality rate was 10.4%. s-APACHE II, RAPS and REMS scores were correlated with APACHE II score (r2= 0.96, r2= 0.82, r2= 0.92; p APACHE II, AUROC 0.788 [95% CI 0.717 to 0.848] for s-APACHE II, AUROC 0.806 [95% CI 0.737 to 0.864] for RAPS, AUROC 0.761 [95% CI 0.688 to 0.824] for REMS. abbreviated APACHE II scores have similar ability to evaluate in-hospital mortality of emergency trauma patients in comparison to APACHE II score.

  18. Arqueología de un espacio habitado, trabajado y defendido. El sistema fortificado de Salinas de Añana (Álava

    Directory of Open Access Journals (Sweden)

    Plata Montero, Alberto

    2009-12-01

    Full Text Available The stratigraphic analysis of the wall of the village of Salinas de Añana (Álava together with the excavations within its fortified area have offered a lot of information about the evolution of its built environment from the Early Medieval period until now. This research paper consists of two parts. Main recorded phases obtained thanks to the archaeological work are firstly described. Comprehension of spatial order resulted after the foundation of a village at the beginnings of the 12th century and the gathering of several hamlets that since the Late Antiquity populated, worked and defended the Valle Salado, is exposed in the second part. In order to understand this process, space syntax analysis, methodology developed within English scientific context, has been applied, showing an special attention to those instruments which enable to determine a global pattern of settlements (Alpha analysis, because this pattern links the social logic of space with the spatial logic of the society that created it.La lectura estratigráfica de la muralla de la villa alavesa de Salinas de Añana, así como la ejecución de excavaciones en su recinto fortificado, nos han proporcionado abundante información sobre la evolución de su paisaje construido desde la Alta Edad Media hasta la actualidad. La investigación que presentamos se divide en dos partes. En la primera, describimos las principales fases documentadas durante la intervención arqueológica. En la segunda, nos hemos centrado en comprender el ordenamiento espacial resultante tras el proceso de fundación de una villa creada a principios del siglo XII en la que, además, se agruparon las distintas comunidades aldeanas que desde la Tardoantigüedad habitaban, trabajaban y defendían el Valle Salado. Para ello, hemos empleado la metodología del «Análisis Sintáctico del Espacio» desarrollada en el mundo anglosajón, prestando una especial atención a las herramientas dirigidas a determinar el patr

  19. Crónica festiva de Ana María González y Zúñiga a la virgen de Guadalupe: Florido ramo (1747

    Directory of Open Access Journals (Sweden)

    Estela Castillo Hernández

    2017-07-01

    Full Text Available Se presenta un estudio de la obra poética religiosa de Ana María González y Zúñiga. Se analiza el poema cronístico Florido ramo, que compuso para describir las festividades con las que el pueblo novohispano en 1747 celebró la jura de la Virgen de Guadalupe como patrona de Nueva España. La crónica festiva de González destaca por dos razones: la primera, porque hasta ese momento la mayoría de las composiciones elaboradas en torno a la Guadalupana eran escritas por hombres(su crónica es una excepción a esta costumbre; el segundo motivo es por el buen manejo que hace la autora de varias fuentes, temas, tópicos y motivos literarios barrocos, así como de diversos lugares comunes de la literatura guadalupana, para relatar y presentarla procesión, los peregrinos, las manifestaciones devotas, los espacios, el decorado y la imagen Guadalupana. This is a study of Ana María González y Zúñiga’s religious poetry. I analyze her poem Florido ramo, a chronicle of the 1747 festivities with which New Spain celebrated the naming of the Virgin of Guadalupe as patroness of New Spain. González y Zúñiga’s festive chronicle is important for two reasons: first, because until it was written, most compositions on the theme of the Guadalupana had been written by men(therefore, her chronicle is an exception to this custom; the second reason is González y Zúñiga’s impressive implementation of various sources, topics and baroque literary motifs, as well as common places of Guadalupe literature, with the intention of reporting and portraying the procession, the pilgrims, the religious demonstrations, the spaces, the decoration and the miraculous image of Guadalupe.

  20. Alterations caused to soil organic matter by post-fire rehabilitation actions in a pine forest from doñana national park (southwest Spain)

    Science.gov (United States)

    González-Pérez, José A.; Jiménez-Morillo, Nicasio T.; Jordán, Antonio; Zavala, Lorena M.; Granged, Arturo J. P.; González-Vila, Francisco J.

    2016-04-01

    Post-fire rehabilitation actions and recovery attempts of burned soils include a range of management practices (tillage, tree logging, reforestation …), in some cases producing an additional damage to that directly caused by fire. Among negative impacts derived from unappropriated rehab practices are the increase soil erosion, loss of soil fertility and alterations in the hydrological cycle. Analytical pyrolysis (Py-GC/MS) is an appropriate technique to study organic matter characteristics within complex matrices. Here this technique is used to study the alterations caused by burning and post-fire rehab plans to soil organic matter (SOM). Fire and post-fire rehab actions impact on SOM is studied in a sandy soil under pine (Pinus pinea) forest that was affected by a severe fire in August 2012 in Doñana National Park (SW Spain). Bulk samples as well as its sieved soil fractions (coarse, 1-2 mm, and fine, forest fire (González-Pérez et al., 2008). The SOM from the BR soil fine fraction was found of a more labile nature (high relative proportions of fatty acids, peptide- and carbohydrate-derived compounds) than that in the UB and B soils. This contribution from labile compounds may be explained by topsoil mixing caused by the post-fire rehab actions i.e. soil tilling/ploughing and burn tree logging and removal. References: González-Pérez JA, González-Vila FJ, González-Vázquez R, Arias ME, Rodríguez J, Knicker H, 2008. Use of multiple biogeochemical parameters to monitor the recovery of soils after forest fires. Organic Geochemistry 39, 940-944. DOI: 10.1016/j.orggeochem.2008.03.014. Jiménez-Morillo NT, González-Pérez JA, Jordán A, Zavala LM, de la Rosa JM, Jiménez-González MA, González-Vila FJ. 2014. Organic matter fractions controlling soil water repellency in sandy soils from the Doñana National Park (Southwestern Spain). Land Degradation & Development. DOI: 10.1002/ldr.2314. Acknowledgements: This study is part of the results of the GEOFIRE and