Development of small solid rocket boosters for the ILR-33 sounding rocket

Science.gov (United States)

Nowakowski, Pawel; Okninski, Adam; Pakosz, Michal; Cieslinski, Dawid; Bartkowiak, Bartosz; Wolanski, Piotr

2017-09-01

This paper gives an overview of the development of a 6000 Newton-class solid rocket motor for suborbital applications. The design configuration and results of interior ballistics calculations are given. The initial use of the motor as the main propulsion system of the H1 experimental in-flight test platform, within the Polish Small Sounding Rocket Program, is presented. Comparisons of theoretical and experimental performance are shown. Both on-ground and in-flight tests are discussed. A novel composite-case manufacturing technology, which enabled to reach high propellant mass fractions, was validated and significant cost-reductions were achieved. This paper focuses on the process of adapting the design for use as the booster stage of the ILR-33 sounding rocket, under development at the Institute of Aviation in Warsaw, Poland. Parallel use of two of the flight-proven rocket motors along with the main stage is planned. The process of adapting the rocket motor for booster application consists of stage integration, aerothermodynamics and reliability analyses. The separation mechanism and environmental impact are also discussed within this paper. Detailed performance analysis with focus on propellant grain geometry is provided. The evolution of the design since the first flights of the H1 rocket is covered and modifications of the manufacturing process are described. Issues of simultaneous ignition of two motors and their non-identical performance are discussed. Further applications and potential for future development are outlined. The presented results are based on the initial work done by the Rocketry Group of the Warsaw University of Technology Students' Space Association. The continuation of the Polish Small Sounding Rocket Program on a larger scale at the Institute of Aviation proves the value of the outcomes of the initial educational project.

Monitoring of arrhythmia and sudden death in a hemodialysis population: The CRASH-ILR Study.

Directory of Open Access Journals (Sweden)

Paul R Roberts

Full Text Available It has been suggested that sudden cardiac death (SCD contributes around 50% of cardiovascular and 27% of all-cause mortality in hemodialysis patients. The true burden of arrhythmias and arrhythmic deaths in this population, however, remains poorly characterised. Cardio Renal Arrhythmia Study in Hemodialysis (CRASH-ILR is a prospective, implantable loop recorder single centre study of 30 established hemodialysis patients and one of the first to provide long-term ambulatory ECG monitoring.30 patients (60% male aged 68±12 years receiving hemodialysis for 45±40 months with varied etiology (diabetes 37%, hypertension 23% and left ventricular ejection fraction (LVEF 55±8% received a Reveal XT implantable loop recorder (Medtronic, USA between August 2011 and October 2014. ECG data from loop recorders were transmitted at each hemodialysis session using a remote monitoring system. Primary outcome was SCD or implantation of a (tachy or bradyarrhythmia controlling device and secondary outcome, the development of arrhythmia necessitating medical intervention.During 379,512 hours of continuous ECG monitoring (mean 12,648±9,024 hours/patient, there were 8 deaths-2 SCD and 6 due to generalised deterioration/sepsis. 5 (20% patients had a primary outcome event (2 SCD, 3 pacemaker implantations for bradyarrhythmia. 10 (33% patients reached an arrhythmic primary or secondary end point. Median event free survival for any arrhythmia was 2.6 years (95% confidence intervals 1.6-3.6 years.The findings confirm the high mortality rate seen in hemodialysis populations and contrary to initial expectations, bradyarrhythmias emerged as a common and potentially significant arrhythmic event.

The service range offered by InfE

International Nuclear Information System (INIS)

Bluhm, F.

1995-01-01

Information Erdgas (InfE) in Essen was founded 25 years ago. This was at a time when some initiative was needed to firmly establish the still rather young energy source of natural gas in the German thermal energy market. As a supraregional marketing institution, InfE had a twofold task: Firstly, to start a variety of advertising and information activities to arouse a general interest in natural gas among various consumer groups and create an attractive product image; and secondly, to promote marketing activities locally and support regional and local gas supply companies with a wide range of services. This dual task of InfE, subsidiary to Ruhrgas AG, Germany's largest long-distance gas supply company, has remained the same until today. Of course its spectrum of activities has been rearranged from time to time and adapted to the changed environment. In 1993, VNG in Leipzig was set up as a partner of InfE, offering the same range of services. (orig.) [de

SLR and GPS spatial techniques in ITRF. Argentine results.

Science.gov (United States)

Actis, Eloy Vicente; Huang, Dongping; Márquez, Raúl; Adarvez, Sonia; Flores, Matías; Brizuela, Diego; Nievas, Jesica; Podestá, Ricardo; Pacheco, Ana M.; Rojas, Hernán Alvis; Yin, Zhiqiang; Li, Jinzeng; Han, Yanben; Liu, Weidong; Wang, Rui

2012-08-01

Along the late 30 years spatial geodetic techniques enable us to measure horizontal and vertical deformations of the Earth’s surface with a very high precision. Performing this task we made Satellite Laser Ranging (SLR), and Global Positioning System (GPS) observations in South America ILRS 7406 Station placed at Observatorio Astronómico Félix Aguilar (OAFA) in San Juan, Argentina, accomplishing a Cooperation Agreement between CAS - NAOC and OAFA - UNSJ. Trough LAGEOS II Satellite observations we obtain rectangular coordinates of San Juan ILRS Station in the Terrestrial Reference Frame (ITR 2000), standing out that Argentine Station data were included in the late arrangements ITRF given by International Earth Rotation and Reference System Service (IERS). Spatial and temporary variations of the epoch 2010 - 2011 were evaluated finding out remarkable displacements, of about a half meter, related with seismic events on the region. We confirm these deformations by means of GP S determinations referred to Permanent GPS Station placed nearby the SLR Station.

Measuring Relativistic effects in the field of the Earth with Laser Ranged Satellites and the LARASE research program

Science.gov (United States)

Lucchesi, David; Anselmo, Luciano; Bassan, Massimo; Magnafico, Carmelo; Pardini, Carmen; Peron, Roberto; Pucacco, Giuseppe; Stanga, Ruggero; Visco, Massimo

2017-04-01

The main goal of the LARASE (LAser RAnged Satellites Experiment) research program is to obtain refined tests of Einstein's theory of General Relativity (GR) by means of very precise measurements of the round-trip time among a number of ground stations of the International Laser Ranging Service (ILRS) network and a set of geodetic satellites. These measurements are guaranteed by means of the powerful and precise Satellite Laser Ranging (SLR) technique. In particular, a big effort of LARASE is dedicated to improve the dynamical models of the LAGEOS, LAGEOS II and LARES satellites, with the objective to obtain a more precise and accurate determination of their orbit. These activities contribute to reach a final error budget that should be robust and reliable in the evaluation of the main systematic errors sources that come to play a major role in masking the relativistic precession on the orbit of these laser-ranged satellites. These error sources may be of gravitational and non-gravitational origin. It is important to stress that a more accurate and precise orbit determination, based on more reliable dynamical models, represents a fundamental prerequisite in order to reach a sub-mm precision in the root-mean-square of the SLR range residuals and, consequently, to gather benefits in the fields of geophysics and space geodesy, such as stations coordinates knowledge, geocenter determination and the realization of the Earth's reference frame. The results reached over the last year will be presented in terms of the improvements achieved in the dynamical model, in the orbit determination and, finally, in the measurement of the relativistic precessions that act on the orbit of the satellites considered.

39 CFR Appendix A to Part 121 - Tables Depicting Service Standard Day Ranges

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Tables Depicting Service Standard Day Ranges A Appendix A to Part 121 Postal Service UNITED STATES POSTAL SERVICE POST OFFICE SERVICES [DOMESTIC MAIL] SERVICE STANDARDS FOR MARKET-DOMINANT MAIL PRODUCTS Pt. 121, App. A Appendix A to Part 121—Tables...

Financial impact of adopting implantable loop recorder diagnostic for unexplained syncope compared with conventional diagnostic pathway in Portugal.

Science.gov (United States)

Providência, Rui; Candeias, Rui; Morais, Carlos; Reis, Hipólito; Elvas, Luís; Sanfins, Vitor; Farinha, Sara; Eggington, Simon; Tsintzos, Stelios

2014-05-06

To estimate the short- and long-term financial impact of early referral for implantable loop recorder diagnostic (ILR) versus conventional diagnostic pathway (CDP) in the management of unexplained syncope (US) in the Portuguese National Health Service (PNHS). A Markov model was developed to estimate the expected number of hospital admissions due to US and its respective financial impact in patients implanted with ILR versus CDP. The average cost of a syncope episode admission was estimated based on Portuguese cost data and landmark papers. The financial impact of ILR adoption was estimated for a total of 197 patients with US, based on the number of syncope admissions per year in the PNHS. Sensitivity analysis was performed to take into account the effect of uncertainty in the input parameters (hazard ratio of death; number of syncope events per year; probabilities and unit costs of each diagnostic test; probability of trauma and yield of diagnosis) over three-year and lifetime horizons. The average cost of a syncope event was estimated to be between 1,760€ and 2,800€. Over a lifetime horizon, the total discounted costs of hospital admissions and syncope diagnosis for the entire cohort were 23% lower amongst patients in the ILR group compared with the CDP group (1,204,621€ for ILR, versus 1,571,332€ for CDP). The utilization of ILR leads to an earlier diagnosis and lower number of syncope hospital admissions and investigations, thus allowing significant cost offsets in the Portuguese setting. The result is robust to changes in the input parameter values, and cost savings become more pronounced over time.

Intramuscular leukemic relapse: clinical signs and imaging findings. A multicentric analysis

Energy Technology Data Exchange (ETDEWEB)

Surov, Alexey [Martin Luther University Halle-Wittenberg, Department of Radiology, Halle (Germany); University of Leipzig, Department of Diagnostic and Interventional Radiology, Leipzig (Germany); Kiratli, Hayyam [Hacettepe University School of Medicine, Department of Ophthalmology, Ankara (Turkey); Im, Soo Ah [Seoul St. Mary' s Hospital, Department of Radiology, Seoul (Korea, Republic of); Manabe, Yasuhiro [National Hospital Organization Okayama Medical Center, Department of Neurology, Okayama (Japan); O' Neill, Alibhe; Shinagare, Atul B. [Brigham and Women' s Hospital, Department of Radiology, Boston, MA (United States); Spielmann, Rolf Peter [Martin Luther University Halle-Wittenberg, Department of Radiology, Halle (Germany)

2014-09-26

Leukemia is a group of malignant diseases involving peripheral blood and bone marrow. Extramedullary tumor manifestation in leukemia can also occur. They more often involve lymph nodes, skin, and bones. Intramuscular leukemic relapse (ILR) is very unusual. The aim of this analysis was to summarize the reported data regarding clinical signs and radiological features of ILR. The PubMed database was searched for publications related to ILR. After an analysis of all identified articles, 20 publications matched the inclusion criteria. The authors of the 20 publications were contacted and provided imaging of their cases for review. The following were recorded: age, gender, primary diagnosis, clinical signs, pattern, localization and size of the intramuscular leukemic relapse. Images of 16 patients were provided [8 computer tomographic (CT) images and 15 magnetic resonance images, MRI]. Furthermore, one patient with ILR was identified in our institutional database. Therefore, images of 17 patients were available for further analysis. Overall, 32 cases with ILR were included in the analysis. In most cases acute myeloid leukemia was diagnosed. Most ILRs were localized in the extremities (44 %) and in the extraocular muscles (44 %). Clinically, ILR manifested as local pain, swelling and muscle weakness. Radiologically, ILR presented most frequently with diffuse muscle infiltration. On postcontrast CT/MRI, most lesions demonstrated homogeneous enhancement. ILRs were hypo-/isointense on T1w and hyperintense on T2w images. ILR manifests commonly as focal pain, swelling and muscle weakness. ILR predominantly involved the extraocular musculature and the extremities. Radiologically, diffuse muscle infiltration was the most common imaging finding. (orig.)

Pattern of optometry practice and range of services in India.

Science.gov (United States)

Thite, Nilesh; Jaggernath, Jyoti; Chinanayi, Farai; Bharadwaj, Shrikant; Kunjeer, Gauri

2015-05-01

This study was conducted to evaluate the range of services provided by optometrists in various modes of optometric practice in India. An online questionnaire was administered to 1674 optometrists to collect information on the range of optometric services offered. Data were analyzed based on variables including sex, educational qualification, and modes of practice. Two-sample Wilcoxon rank sum tests, χ tests, and Fisher exact text were used to conduct inferential statistics. A total of 563 valid and completed survey questionnaires were received from graduates of 41 optometry institutes working across 23 states of India. Of these, 225 (40.0%) were female, 288 (51.2%) had completed postgraduate education, and 340 (60.5%) were involved in more than one mode of practice. The top three modes of practice were hospital-based practice (44.8%), academia (42.8%), and optical retail (33.0%). Of the 441, out of 563 (78.3%) respondents involved in patient care, the majority (98.4%) performed refraction and routine eye examination, 70.3% dispensed contact lenses, and 66.9% practiced optical dispensing. Lower involvement was seen in providing binocular-vision (45.1%) and low-vision services (30.2%). Higher education was associated with advanced level of practice (p < 0.05) except clinical investigative procedures. There was a significant association between postgraduate studies and involvement in academics and research (p < 0.01). Most optometrists are engaged in multiple modes of practice, with optical practice, hospital-based practice, and academia being the leading modes. Optometrists need to be more involved in providing the core optometric services of binocular vision and low vision. Higher education has an impact on the level of optometric practice.

US Forest Service experimental forests and ranges: an untapped resource for social science

Science.gov (United States)

Susan Charnley; Lee K. Cerveny

2011-01-01

For a century, US Forest Service experimental forests and ranges (EFRs) have been a resource for scientists conducting long-term research relating to forestry and range management social science research has been limited, despite the history of occupation and current use of these sites for activities ranging from resource extraction and recreation to public education....

Use of Implantable Loop Recorders to Unravel the Cause of Unexplained Syncope

Directory of Open Access Journals (Sweden)

Dr. Aniket Puri, DM, FACC, FAPSIC, FSCAI

2013-03-01

Full Text Available Syncope is a symptom of many underlying disease states, which range from the relatively benign to the life threatening. There are numerous investigations done for patients with recurrent unexplained syncope which may have very low yield when it comes to making a definitive diagnosis. Recently, the implantable loop recorder (ILR for continuous monitoring of the cardiac rhythm has been launched in India. This review will briefly discuss these current availabel strategies and focus on the usefulness of an ILR in the definitive diagnosis and treatment of patients with a recurrent unexplained syncope.

Ten years of SLR production in Argentina

Science.gov (United States)

Pacheco, A.; Podestá, R.; Yin, Z.; Liu, W.; Actis, E.; Adarvez, S.; Quinteros, J.; Podestá, F.

2017-07-01

SLR technique is a proved astro-geodetic art with a significant power to contribute to Earth and Space Sciences. Therefore, scientific applications of SLR System are able to perform multiple tasks in the fields of Astrometry, Geodesy and Geophysics. The results we show here were obtained from satellite observations made at SLR 7406 Station of Observatorio Astronómico Félix Aguilar (OAFA) in San Juan, Argentina. The telescope was installed early on 2006, in concordance with an International Cooperation Agreement between Universidad Nacional de San Juan, Argentina and Chinese Academy of Sciences. In this abstract we show the current research being done with ILRS 7406 station: Length of day (LOD) and Angular velocity of Earth Rotation, calculated weekly; Pole Motion. ILRS7406 is daily surveying Pole coordinates x and y; Tracking SLR to GNSS constellations. SLR System contributes to the adjustment and validation of satellite GALILEO, GPS, GLONASS, and BEIDOU orbits. Our station is nowadays member of the new ITRF 2014 frame, and these past years has been one of the 3 highest producing SLR Stations on the ILRS net, composed of about 40 stations distributed all around the world. The obtained results during this first 10 years of experience are useful to enhance the traditional collaboration between OAFA and international services such as ILRS, IERS and NASA.

Library Services and Construction Act. Long Range Plan, 1982-1986 Updates.

Science.gov (United States)

Seidenberg, Edward

This 1982-86 update to long-range planning designed to continue the improvement of library facilities and services in Texas includes a review of how the plan developed, the various environmental factors affecting library operations, the present development of libraries, information needs and approaches to satisfying those needs, and methods for…

Evaluation of vaccine cold chain in urban health centers of municipal corporation of surat city, Western India.

Science.gov (United States)

Naik, Ashish K; Rupani, Mihir P; Bansal, R K

2013-12-01

The success of immunization depends highly on the level of cold chain maintenance. The aim of the study was to assess the condition of cold chain equipment, practices adopted for cold chain maintenance and knowledge of the vaccinators. It was a cross-sectional study conducted in 20 UHCs of Surat Municipal Corporation (SMC). Cold chain equipment were observed with regards to their condition, along with the practices adopted by vaccinators for cold chain maintenance. A pre-designed and pre-tested questionnaire was used to interview the vaccinators regarding their knowledge and awareness regarding cold chain practices, management and handling. Data were entered and analyzed using Epi Info v 3.5.1. Simple proportions were calculated. Absence of separate stabilizer for deep freezers and ILRs (85%), ill-maintained temperature-record register, lack of criss-cross pattern of ice packs in deep freezer (65%), presence of things other than ice packs in deep freezer (10%) and things other than vaccines in ILR (10%) indicate poor cold chain maintenance. In addition to this, expired vaccines in ILR (5%), vaccines in the "unusable" stages of VVM (15%), lack of emergency contact number nearby in case of cold chain failure (85%), lack of inverter (85%), lack of generator (85%) and failure to note time of reconstitution on the vaccine vial at the time of vaccination (25%) indicate poor cold chain practices. Lack of knowledge of defrosting of ILR and deep freezer (45%), lack of knowledge about Shake test (40%), lack of knowledge of temperature range to be maintained in deep freezer (70%) and in ILR (15%) indicate poor knowledge of vaccinators. Cold chain maintenance and practices need improvement. Knowledge of vaccinators was overall unsatisfactory.

Use of implantable and external loop recorders in syncope with unknown causes

Directory of Open Access Journals (Sweden)

Kaoru Tanno

2017-12-01

Full Text Available The gold standard for diagnosing syncope is to elucidate the symptom-electrocardiogram (ECG correlation. The ECG recordings during syncope allow physicians to either confirm or exclude an arrhythmia as the mechanism of syncope. Many studies have investigated the use of internal loop recorder (ILR, while few studies have used external loop recorder (ELR for patients with unexplained syncope. The aim of this review is to clarify the clinical usefulness of ILR and ELR in the diagnosis and management of patients with unexplained syncope. Many observational and four randomized control studies have shown that ILR for patients with unknown syncope is a useful tool for early diagnosis and improving diagnosis rate. ILR also provides important information on the mechanism of syncope and treatment strategy. However, there is no evidence of total mortality or quality of life improvements with ILR. The diagnostic yield of ELR in patients with syncope was similar to that with ILR within the same timeframe. Therefore, ELR could be considered for long-term ECG monitoring before a patient switches to using ILR. A systematic approach and selection of ECG monitoring tools reduces health care costs and improves the selection of patients for optimal treatment possibilities. Keywords: Internal loop recorder, External loop recorder, Unknown Syncope

An evaluation of the range and availability of intensive smoking cessation services in Ireland.

LENUS (Irish Health Repository)

Currie, LM

2009-06-27

BACKGROUND: A review of smoking cessation (SC) services in Ireland is a necessary step in improving service planning and provision. AIMS: To assess the range and availability of intensive SC services in Ireland in 2006. METHODS: A survey of SC service providers in Ireland was conducted. Descriptive analysis and simple linear regression analysis was used. RESULTS: Response rate was 86.3% (63\\/73). All service providers surveyed are employing evidence-based interventions; the most common form of support is individual counselling with initial sessions averaging 40 min and weekly review sessions 20 min in duration. Reaching the recommended target of treating 5.0% of smokers does not seem feasible given the current distribution of resources and there appears to be regional differences in resource allocation. CONCLUSIONS: While intensive SC services are available in all four Health Service Executive Areas, it would appear that there is little uniformity or consistency countrywide in the scope and structure of these services.

Systematic review on the treatment of isolated local recurrence of pancreatic cancer after surgery; re-resection, chemoradiotherapy and SBRT.

Science.gov (United States)

Groot, Vincent P; van Santvoort, Hjalmar C; Rombouts, Steffi J E; Hagendoorn, Jeroen; Borel Rinkes, Inne H M; van Vulpen, Marco; Herman, Joseph M; Wolfgang, Christopher L; Besselink, Marc G; Molenaar, I Quintus

2017-02-01

The majority of patients who have undergone a pancreatic resection for pancreatic cancer develop disease recurrence within two years. In around 30% of these patients, isolated local recurrence (ILR) is found. The aim of this study was to systematically review treatment options for this subgroup of patients. A systematic search was performed in PubMed, Embase and the Cochrane Library. Studies reporting on the treatment of ILR after initial curative-intent resection of primary pancreatic cancer were included. Primary endpoints were morbidity, mortality and survival after ILR treatment. After screening 1152 studies, 18 studies reporting on 313 patients undergoing treatment for ILR were included. Treatment options for ILR included surgical re-resection (8 studies, 100 patients), chemoradiotherapy (7 studies, 153 patients) and stereotactic body radiation therapy (SBRT) (4 studies, 60 patients). Morbidity and mortality were reported for re-resection (29% and 1%, respectively), chemoradiotherapy (54% and 0%) and SBRT (3% and 1%). Most patients had a prolonged disease-free interval before recurrence. Median survival after treatment of ILR of up to 32, 19 and 16 months was reported for re-resection, chemoradiotherapy and SBRT, respectively. In selected patients, treatment of ILR following pancreatic resection for pancreatic cancer seems safe, feasible and associated with relatively good survival. Copyright © 2016 International Hepato-Pancreato-Biliary Association Inc. Published by Elsevier Ltd. All rights reserved.

Methods and Algorythms of Alternatives Ranging in Managing the Telecommunication Services Guality.

Directory of Open Access Journals (Sweden)

Pham Quang Hiep

2015-07-01

Full Text Available The article deals with methods of solving the problem of ranging of alternatives in information-analytical system of managing the quality of telecommunication services rendering process. Tasks of choice are determined, in which the alternatives are as follows: states of quality of different objects in the structure of telecommunication company management. An algorithm of ranging of objects is elaborated for the case of using unstructured set of indices. The algorithm enables to determine the objects priorities and to select the best ones among them. The suggested methods may be used while elaborating the programs of improvement of telecommunication companies competitiveness.

Current Trends and Challenges in Satellite Laser Ranging

Science.gov (United States)

Appleby, Graham M.; Bianco, Giuseppe; Noll, Carey E.; Pavlis, Erricos C.; Pearlman, Michael R.

2016-12-01

Satellite Laser Ranging (SLR) is used to measure accurately the distance from ground stations to retro-reflectors on satellites and on the Moon. SLR is one of the fundamental space-geodetic techniques that define the International Terrestrial Reference Frame (ITRF), which is the basis upon which many aspects of global change over space, time, and evolving technology are measured; with VLBI the two techniques define the scale of the ITRF; alone the SLR technique defines its origin (geocenter). The importance of the reference frame has recently been recognized at the inter-governmental level through the United Nations, which adopted in February 2015 the Resolution "Global Geodetic Reference Frame for Sustainable Development." Laser Ranging provides precision orbit determination and instrument calibration and validation for satellite-borne altimeters for the better understanding of sea level change, ocean dynamics, ice mass-balance, and terrestrial topography. It is also a tool to study the dynamics of the Moon and fundamental constants and theories. With the exception of the currently in-orbit GPS constellation, all GNSS satellites now carry retro-reflectors for improved orbit determination, harmonization of reference frames, and in-orbit co-location and system performance validation; the next generation of GPS satellites due for launch from 2019 onwards will also carry retro-reflectors. The ILRS delivers weekly realizations that are accumulated sequentially to extend the ITRF and the Earth Orientation Parameter series with a daily resolution. SLR technology continues to evolve towards the next-generation laser ranging systems and it is expected to successfully meet the challenges of the GGOS2020 program for a future Global Space Geodetic Network. Ranging precision is improving as higher repetition rate, narrower pulse lasers, and faster detectors are implemented within the network. Automation and pass interleaving at some stations is expanding temporal coverage and

HEVC for high dynamic range services

Science.gov (United States)

Kim, Seung-Hwan; Zhao, Jie; Misra, Kiran; Segall, Andrew

2015-09-01

Displays capable of showing a greater range of luminance values can render content containing high dynamic range information in a way such that the viewers have a more immersive experience. This paper introduces the design aspects of a high dynamic range (HDR) system, and examines the performance of the HDR processing chain in terms of compression efficiency. Specifically it examines the relation between recently introduced Society of Motion Picture and Television Engineers (SMPTE) ST 2084 transfer function and the High Efficiency Video Coding (HEVC) standard. SMPTE ST 2084 is designed to cover the full range of an HDR signal from 0 to 10,000 nits, however in many situations the valid signal range of actual video might be smaller than SMPTE ST 2084 supported range. The above restricted signal range results in restricted range of code values for input video data and adversely impacts compression efficiency. In this paper, we propose a code value remapping method that extends the restricted range code values into the full range code values so that the existing standards such as HEVC may better compress the video content. The paper also identifies related non-normative encoder-only changes that are required for remapping method for a fair comparison with anchor. Results are presented comparing the efficiency of the current approach versus the proposed remapping method for HM-16.2.

Feasibility of Spanish-language acquisition for acute medical care providers: novel curriculum for emergency medicine residencies.

Science.gov (United States)

Grall, Kristi H; Panchal, Ashish R; Chuffe, Eliud; Stoneking, Lisa R

2016-01-01

Language and cultural barriers are detriments to quality health care. In acute medical settings, these barriers are more pronounced, which can lead to poor patient outcomes. We implemented a longitudinal Spanish-language immersion curriculum for emergency medicine (EM) resident physicians. This curriculum includes language and cultural instruction, and is integrated into the weekly EM didactic conference, longitudinal over the entire 3-year residency program. Language proficiency was assessed at baseline and annually on the Interagency Language Roundtable (ILR) scale, via an oral exam conducted by the same trained examiner each time. The objective of the curriculum was improvement of resident language skills to ILR level 1+ by year 3. Significance was evaluated through repeated-measures analysis of variance. The curriculum was launched in July 2010 and followed through June 2012 (n=16). After 1 year, 38% had improved over one ILR level, with 50% achieving ILR 1+ or above. After year 2, 100% had improved over one level, with 90% achieving the objective level of ILR 1+. Mean ILR improved significantly from baseline, year 1, and year 2 (F=55, df =1; Planguage skills in EM residents. The curriculum improved EM-resident language proficiency above the goal in just 2 years. Further studies will focus on the effect of language acquisition on patient care in acute settings.

Implantable loop recorders for assessment of syncope: increased diagnostic yield and less adverse outcomes with the latest generation devices.

Science.gov (United States)

Bartoletti, A; Bocconcelli, P; De Santo, T; Ghidini Ottonelli, A; Giuli, S; Massa, R; Svetlich, C; Tarsi, G; Corbucci, G; Tronconi, F; Vitale, E

2013-08-01

Aim of the study was to compare the diagnostic yield of implantable loop recorders (ILR) of two successive generations for the assessment of syncope. Data on patients who had undergone ILR implantation for unexplained syncope in four Italian public hospitals were retrospectively acquired from the Medtronic Clinical Service database. After implantation, routine follow-up examinations were performed every 90 days, while urgent examinations were carried out in the event of syncope recurrence. The following findings were regarded as diagnostic: ECG documentation of a syncope recurrence; documentation of any of the arrhythmias listed by the current guidelines as diagnostic findings even if asymptomatic. Between November 2002 and March 2010, 107 patients received an ILR (40 Medtronic Reveal® Plus; 67 Medtronic Reveal® DX/XT) and underwent at least one follow-up examination. Diagnoses were made in 7 (17.5%) and 24 (35.8%) (P=0.043) patients, with a median time of 228 and 65 days, respectively. Three (42.9%) and 21 (87.5%) (P=0.029) diagnoses were based on automatically detected events, while adverse outcomes occurred in 6 and in 1 (P=0.01) patients, respectively. Our results show that the new-generation device offer a higher diagnostic yield, mainly as a result of its improved automatic detection function, and is associated with fewer adverse outcomes.

Archiving Space Geodesy Data for 20+ Years at the CDDIS

Science.gov (United States)

Noll, Carey E.; Dube, M. P.

2004-01-01

Since 1982, the Crustal Dynamics Data Information System (CDDIS) has supported the archive and distribution of geodetic data products acquired by NASA programs. These data include GPS (Global Positioning System), GLONASS (GLObal NAvigation Satellite System), SLR (Satellite Laser Ranging), VLBI (Very Long Baseline Interferometry), and DORIS (Doppler Orbitography and Radiolocation Integrated by Satellite). The data archive supports NASA's space geodesy activities through the Solid Earth and Natural Hazards (SENH) program. The CDDIS data system and its archive have become increasingly important to many national and international programs, particularly several of the operational services within the International Association of Geodesy (IAG), including the International GPS Service (IGS), the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS), the International DORIS Service (IDS), and the International Earth Rotation Service (IERS). The CDDIS provides easy and ready access to a variety of data sets, products, and information about these data. The specialized nature of the CDDIS lends itself well to enhancement and thus can accommodate diverse data sets and user requirements. All data sets and metadata extracted from these data sets are accessible to scientists through ftp and the web; general information about each data set is accessible via the web. The CDDIS, including background information about the system and its user communities, the computer architecture, archive contents, available metadata, and future plans will be discussed.

Injectable loop recorder implantation in an ambulatory setting by advanced practice providers: Analysis of outcomes.

Science.gov (United States)

Kipp, Ryan; Young, Natasha; Barnett, Anne; Kopp, Douglas; Leal, Miguel A; Eckhardt, Lee L; Teelin, Thomas; Hoffmayer, Kurt S; Wright, Jennifer; Field, Michael

2017-09-01

Implantable loop recorder (ILR) insertion has historically been performed in a surgical environment such as the electrophysiology (EP) lab. The newest generation loop recorder (Medtronic Reveal LINQ™, Minneapolis, MN, USA) is injectable with potential for implantation in a non-EP lab setting by advanced practice providers (APPs) facilitating improved workflow and resource utilization. We report the safety and efficacy of injectable ILR placement in the ambulatory care setting by APPs. A retrospective review was performed including all patients referred for injectable ILR placement from March 2014 to November 2015. All device placement procedures were performed in an ambulatory care setting using the standard manufacturer deployment kit with sterile technique and local anesthetic following a single dose of intravenous antibiotics. Acute procedural success and complication rates following injectable ILR placement in the ambulatory setting were reviewed. During the study period, 125 injectable ILRs were implanted. Acute procedural success with adequate sensing (R-waves ≥ 0.2 mV) occurred in 100% of patients. There were no acute procedural complications. Subacute complications occurred in two patients (1.6% of implantations), including one possible infection treated with oral antibiotics and one device removal due to pain at the implant site. In this retrospective single-center study, implantation of injectable ILR in an ambulatory care setting by APPs following a single dose of intravenous antibiotics and standard manufacturer technique yielded a low complication rate with high acute procedural success. Use of this implantation strategy may improve EP lab workflow while providing a safe and effective technique for device placement. © 2017 Wiley Periodicals, Inc.

Report of Investigation: Jill Vines Loftus, Senior Executive Service (Redacted)

Science.gov (United States)

2015-06-16

i11ore ilr,lportantthan $3 a day and that she pill’l;:s Jn the terminal garage when on personal leisure travel as well, She added, "I’ve got h1gg11ge...air travel we reviewecl, M~. Loft4s «hose united AlrJini;s or non. city-pitir flights for per~onal oonven\\ence, preference,.and her partici,palio!lin...nd clain1e4 $·149.40 in fue!expenses. We ctetermined tlmtMs. Loftus di.dn~texerci~\\! prudence· bi travel ol’ gOod irteWa!’dship oftravel 11.mds Md

International Study on Syncope of Uncertain Etiology 2: the management of patients with suspected or certain neurally mediated syncope after the initial evaluation Rationale and study design

NARCIS (Netherlands)

Brignole, M.; Sutton, R.; Menozzi, C.; Moya, A.; Garcia-Civera, R.; Benditt, D.; Vardas, P.; Wieling, W.; Andresen, D.; Migliorini, R.; Hollinworth, D.

2003-01-01

Study design Multi-centre, prospective observational study Objectives Main objective is to verify the value of implantable loop recorder (ILR) in assessing the mechanism of syncope and the efficacy of the ILR-guided therapy after syncope recurrence. Inclusion criteria Patients who met the following

Recurrent unexplained palpitations (RUP) study comparison of implantable loop recorder versus conventional diagnostic strategy.

Science.gov (United States)

Giada, Franco; Gulizia, Michele; Francese, Maura; Croci, Francesco; Santangelo, Lucio; Santomauro, Maurizio; Occhetta, Eraldo; Menozzi, Carlo; Raviele, Antonio

2007-05-15

The aim of the study was to compare the diagnostic yield and the costs of implantable loop recorder (ILR) with those of the conventional strategy in patients with unexplained palpitations. In patients with unexplained palpitations, especially in those with infrequent symptoms, the conventional strategy, including short-term ambulatory electrocardiogram (ECG) monitoring and electrophysiological study, sometimes fails to establish a diagnosis. We studied 50 patients with infrequent (1 min) palpitations. Before enrollment, patients had a negative initial evaluation, including history, physical examination, and ECG. Patients were randomized either to conventional strategy (24-h Holter recording, a 4-week period of ambulatory ECG monitoring with an external recorder, and electrophysiological study) (n = 24) or to ILR implantation with 1-year monitoring (n = 26). Hospital costs of the 2 strategies were calculated. A diagnosis was obtained in 5 patients in the conventional strategy group, and in 19 subjects in the ILR group (21% vs. 73%, p < 0.001). Despite the higher initial cost, the cost per diagnosis in the ILR group was lower than in the conventional strategy group (euro 3,056 +/- euro 363 vs. euro 6,768 +/- euro 6,672, p = 0.012). In subjects without severe heart disease and with infrequent palpitations, ILR is a safe and more cost-effective diagnostic approach than conventional strategy.

An Efficient Genetic Algorithm for Routing Multiple UAVs under Flight Range and Service Time Window Constraints

OpenAIRE

KARAKAYA, Murat; SEVİNÇ, Ender

2017-01-01

Recently using Unmanned Aerial Vehicles (UAVs) either for military or civilian purposes is getting popularity. However, UAVs have their own limitations which require adopted approaches to satisfy the Quality of Service (QoS) promised by the applications depending on effective use of UAVs. One of the important limitations of the UAVs encounter is the flight range. Most of the time, UAVs have very scarce energy resources and, thus, they have relatively short flight ranges. Besides, for the appl...

A phylogenetic transform enhances analysis of compositional microbiota data.

Science.gov (United States)

Silverman, Justin D; Washburne, Alex D; Mukherjee, Sayan; David, Lawrence A

2017-02-15

Surveys of microbial communities (microbiota), typically measured as relative abundance of species, have illustrated the importance of these communities in human health and disease. Yet, statistical artifacts commonly plague the analysis of relative abundance data. Here, we introduce the PhILR transform, which incorporates microbial evolutionary models with the isometric log-ratio transform to allow off-the-shelf statistical tools to be safely applied to microbiota surveys. We demonstrate that analyses of community-level structure can be applied to PhILR transformed data with performance on benchmarks rivaling or surpassing standard tools. Additionally, by decomposing distance in the PhILR transformed space, we identified neighboring clades that may have adapted to distinct human body sites. Decomposing variance revealed that covariation of bacterial clades within human body sites increases with phylogenetic relatedness. Together, these findings illustrate how the PhILR transform combines statistical and phylogenetic models to overcome compositional data challenges and enable evolutionary insights relevant to microbial communities.

MASS OUTFLOW IN THE SEYFERT 1 GALAXY NGC 5548

International Nuclear Information System (INIS)

Crenshaw, D. M.; Kraemer, S. B.; Schmitt, H. R.; Kaastra, J. S.; Arav, N.; Gabel, J. R.; Korista, K. T.

2009-01-01

We present a study of the intrinsic UV absorption and emission lines in an historically low-state spectrum of the Seyfert 1 galaxy NGC 5548, which we obtained in 2004 February at high spatial and spectral resolution with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. We isolate a component of emission with a width of 680 km s -1 that arises from an 'intermediate-line region' (ILR), similar to that we discovered in NGC 4151, at a distance of ∼1 pc from the central continuum source. From a detailed analysis of the five intrinsic absorption components in NGC 5548 and their behavior over a span of eight years, we present evidence that most of the UV absorbers only partially cover the ILR and do not cover an extended region of UV continuum emission, most likely from hot stars in the circumnuclear region. We also find that four of the UV absorbers are at much greater distances (greater than 70 pc) than the ILR, and none have sufficient N V or C IV column densities to be the ILR in absorption. At least a portion of the UV absorption component 3, at a radial velocity of -530 km s -1 , is likely responsible for most of the X-ray absorption, at a distance less than 7 pc from the central source. The fact that we see the ILR in absorption in NGC 4151 and not in NGC 5548 suggests that the ILR is located at a relatively large polar angle (∼45 deg.) with respect to the narrow-line region outflow axis.

Mobile technology for expansion of service range medan public library

Science.gov (United States)

Siregar, A. R.; Dewiyana, H.

2018-03-01

The information society, especially library users, expects an easier and faster way to get information and share knowledge. The library also implements the best way to provide the best service and the easiest way to disseminate and share information with its users. One technology that allows libraries more closely with their users is mobile technology. This paper aims to determine the basic conditions of mobile technology services and mobile services most needed library users, as well as constraints faced by libraries and users in the application of mobile technology. This paper will help libraries to develop better M-Library services in expanding the reach of library services. Methods of data collection were conducted through surveys through questionnaires, interviews, and direct observation. The results of the use of mobile technology applications in libraries bring great advantages to provide better library services and to improve accessibility of library resources in the easiest way, but due to lack of funds, lack of skills and lack of staff, many libraries are unable to provide this service with very successful.

US Forest Service Experimental Forests and Ranges Network: a continental research platform for catchment-scale research

Science.gov (United States)

Daniel Neary; Deborah Hayes; Lindsey Rustad; James Vose; Gerald Gottfried; Stephen Sebesteyn; Sherri Johnson; Fred Swanson; Mary Adams

2012-01-01

The US Forest Service initiated its catchment research program in 1909 with the first paired catchment study at Wagon Wheel Gap, Colorado, USA. It has since developed the Experimental Forests and Ranges Network, with over 80 long-term research study sites located across the contiguous USA, Alaska, Hawaii, and the Caribbean. This network provides a unique, powerful...

Historical range of variation assessment for wetland and riparian ecosystems, U.S. Forest Service Rocky Mountain Region

Science.gov (United States)

Edward Gage; David J. Cooper

2013-01-01

This document provides an overview of historical range of variation concepts and explores their application to wetland and riparian ecosystems in the US Forest Service Rocky Mountain Region (Region 2), which includes National Forests and National Grasslands occurring in the states of Colorado, Wyoming, Nebraska, Kansas, and South Dakota. For each of five ecosystem...

An integral metallic-fueled and lead-cooled reactor concept for the 4th generation reactor

International Nuclear Information System (INIS)

Santos, Adimir dos; Nascimento, Jamil Alves do

2002-01-01

An Integral Lead Reactor (ILR) concept is proposed for the 4th generation reactor to be used in the future. The ILR is loaded with metallic fuel and cooled by lead. It was evaluated in the 300-1500 MWe power range with the Japanese Fast Set 2 cross sections library. This set was tested against several fast benchmarks and the criticality uncertainty was found to be 0.51 %Δk. The reactor is started with U-Zr and changes to the U-TRU-Zr-RE fuel in a stepwise way. In the equilibrium cycle, the burnup reactivity is less than β eff for a core of the order of 300 MWe, pin diameter of 10.4 mm and a pin-pinch to diameter ratio of 1.308. The lead void reactivity is negative for reactor power less than 750 MWe. There is a need to improve the nuclear data for the major actinides. (author)

An integral metallic-fueled and lead-cooled reactor concept for the 4th generation reactor

International Nuclear Information System (INIS)

Santos, A. dos; Nascimento, J.A. do

2002-01-01

An Integral Lead Reactor (ILR) concept is proposed for the 4th generation reactor to be used in the future. The ILR is loaded with metallic fuel and cooled by lead. It was evaluated in the 300-1500 MWe power range with the Japanese Fast Set 2 cross sections library. This set was tested against several fast benchmarks and the criticality uncertainty was found to be 0.51 % Δk. The reactor is started with U-Zr and changes to the U-TRU-Zr-RE fuel in a stepwise way. In the equilibrium cycle, the burnup reactivity is less than β eff for a core of the order of 300 MWe, pin diameter of 10.4 mm and a pin-pitch to diameter ratio of 1.308. The lead void reactivity is negative for reactor power less than 750 MWe. There is a need to improve the nuclear data for the major actinides. (author)

Status of the R and D activities on fast reactors and accelerators driven system in Brazil

International Nuclear Information System (INIS)

Maiorino, J.R.

2002-01-01

An Integral Lead Reactor (ILR) concept is proposed for the 4th generation reactor to be used in the future. The ILR is loaded with metallic fuel and cooled by lead. It was evaluated in the 300-1500 MWe power range with the Japanese Fast Set 2 cross sections library. This set was tested against several fast benchmarks and the criticality uncertainty was found to be 0.51 % Δk. The reactor is started with U-Zr and changes to the U-TRU-Zr-RE fuel in a stepwise way. In the equilibrium cycle, the burnup reactivity is less than β eff for a core of the order of 300 MWe, pin diameter of 10.4 mm and a pin-pitch to diameter ratio of 1.308. The lead void reactivity is negative for reactor power less than 750 MWe. There is a need to improve the nuclear data for the major actinides. (author)

Managing Groundwater Recharge and Pumping for Late Summer Streamflow Increases: Quantifying Uncertainty Using Null Space Monte Carlo

Science.gov (United States)

Tolley, D. G., III; Foglia, L.; Harter, T.

2017-12-01

Late summer and early fall streamflow decreases caused by climate change and agricultural pumping contribute to increased water temperatures and result in large disconnected sections during dry years in many semi-arid regions with Mediterranean climate. This negatively impacts aquatic habitat of fish species such as coho and fall-run Chinook salmon. In collaboration with local stakeholders, the Scott Valley Integrated Hydrologic Model (SVIHMv3) was developed to assess future water management scenarios with the goal of improving aquatic species habitat while maintaining agricultural production in the valley. The Null Space Monte Carlo (NSMC) method available in PEST was used to quantify the range of predicted streamflow changes for three conjunctive use scenarios: 1) managed aquifer recharge (MAR), 2) in lieu recharge (ILR, substituting surface-water irrigation for irrigation with groundwater while flows are available), and 3) MAR + ILR. Random parameter sets were generated using the calibrated covariance matrix of the model, which were then recalibrated if the sum of squared residuals was greater than 10% of the original sum of squared weighted residuals. These calibration-constrained stochastic parameter sets were then used to obtain a distribution of streamflow changes resulting from implementing the conjunctive use scenarios. Preliminary results show that while the range of streamflow increases using managed aquifer recharge is much narrower (i.e., greater degree of certainty) than in lieu recharge, there are potentially much greater benefits to streamflow by implementing in lieu recharge (although also greater costs). Combining the two scenarios provides the greatest benefit for increasing late summer and early fall streamflow, as most of the MAR streamflow increases are during the spring and early summer which ILR is able to take advantage of. Incorporation of uncertainty into model predictions is critical for establishing and maintaining stakeholder trust

Diagnosis of the nutrient compositional space of fruit crops

Directory of Open Access Journals (Sweden)

Léon-Étienne Parent

2011-03-01

Full Text Available Tissue analysis is a useful tool for the nutrient management of fruit orchards. The mineral composition of diagnostic tissues expressed as nutrient concentration on a dry weight basis has long been used to assess the status of 'pure' nutrients. When nutrients are mixed and interact in plant tissues, their proportions or concentrations change relatively to each other as a result of synergism, antagonism, or neutrality, hence producing resonance within the closed space of tissue composition. Ternary diagrams and nutrient ratios are early representations of interacting nutrients in the compositional space. Dual and multiple interactions were integrated by the Diagnosis and Recommendation Integrated System (DRIS into nutrient indexes and by Compositional Nutrient Diagnosis into centered log ratios (CND-clr. DRIS has some computational flaws such as using a dry matter index that is not a part as well as nutrient products (e.g. NxCa instead of ratios. DRIS and CND-clr integrate all possible nutrient interactions without defining an ad hoc interactive model. They diagnose D components while D-1 could be diagnosed in the D-compositional Hilbert space. The isometric log ratio (ilr coordinates overcome these problems using orthonormal binary nutrient partitions instead of dual ratios. In this study, it is presented a nutrient interactive model as well as computation methods for DRIS and CND-clr and CND-ilr coordinates (CND-ilr using leaf analytical data from an experimental apple orchard in Southwestern Quebec, Canada. It was computed the Aitchison and Mahalanobis distances across ilr coordinates as measures of nutrient imbalance. The effect of changing nutrient concentrations on ilr coordinates are simulated to identify the ones contributing the most to nutrient imbalance.

Footwear Matters: Influence of Footwear and Foot Strike on Load Rates during Running.

Science.gov (United States)

Rice, Hannah M; Jamison, Steve T; Davis, Irene S

2016-12-01

Running with a forefoot strike (FFS) pattern has been suggested to reduce the risk of overuse running injuries, due to a reduced vertical load rate compared with rearfoot strike (RFS) running. However, resultant load rate has been reported to be similar between foot strikes when running in traditional shoes, leading to questions regarding the value of running with a FFS. The influence of minimal footwear on the resultant load rate has not been considered. This study aimed to compare component and resultant instantaneous loading rate (ILR) between runners with different foot strike patterns in their habitual footwear conditions. Twenty-nine injury-free participants (22 men, seven women) ran at 3.13 m·s along a 30-m runway, with their habitual foot strike and footwear condition. Ground reaction force data were collected. Peak ILR values were compared between three conditions; those who habitually run with an RFS in standard shoes, with an FFS in standard shoes, and with an FFS in minimal shoes. Peak resultant, vertical, lateral, and medial ILR were lower (P strike. When running with an FFS, peak posterior ILR were lower (P strike. Therefore, it appears that footwear alters the load rates during running, even with similar foot strike patterns.

Heart rhythm at the time of death documented by an implantable loop recorder

DEFF Research Database (Denmark)

Gang, Uffe Jakob Ortved; Jøns, Christian; Jørgensen, Rikke Mørch

2009-01-01

Aims The aims of this study were to describe arrhythmias documented with an implantable loop recorder (ILR) in post-acute myocardial infarction (AMI) patients with left ventricular dysfunction at the time of death and to establish the correlation to mode of death. Methods and results Post......-mortem ILR device interrogations were analysed from patients dying in the CARISMA study. Mode of death was classified by a modified CAST classification. Twenty-six patients died with an implanted ILR. Of these, 16 had an electrocardiogram recorded at the time of death. Ventricular tachycardia (VT......)/ventricular fibrillation (VF) was terminal rhythm in eight patients and bradyarrhythmias were observed in another eight patients. Of the deaths with peri-mortem recordings, seven were classified as sudden cardiac death (SCD). In six of these, VF was documented at the time of death. Six monitored deaths were classified...

Threatened plant resources: distribution and ecosystem services in the world's high elevation park of the karakoram ranges

International Nuclear Information System (INIS)

Shedayi, A.; Xu, M.; Hussain, F.; Sadia, S.; Bano, S.

2016-01-01

This study aims to investigate diversity, distribution, status, ecosystem services and threats to the plant resources in the study area based on field survey and ethno ecological knowledge for effective conservation and sustainable ecosystem services. The present study was conducted in the world's high elevation Khunjerab National Park (KNP) of the Karakoram ranges in Pakistan bordering China. Tremendous ecosystem services are obtained from the park and considered the most important habitat for many plant biodiversity and wildlife species. Field surveys were conducted to collect plants in transect along the road side of seven valleys ranging from 3160m to 4934m altitudinal variation. The names and traditional uses were recorded from the local people of the area by semi structured questionnaires and direct interviews. The data was analyzed by excel spreadsheets, direct matrix ranking, and pair comparison tests. Asteraceae was the dominant family with 15% species followed by Chenopodiaceae 10%, Poaceae 8%, Papilionaceae and Rocaceae 7% each, Brasicaceae 6%. Plant resources contribute direct and indirect ecosystem services such as food, medicine, fuel, timber, thatching, water purification, mineral and soil retention, and most importantly as sink of global carbon stock especially in the high altitude peatlands. Herbs were the dominant species in the area with 89%. Fodder is the most common usage for plants, followed by medicine. Plants with percentages 27% and 39% found to be highly palatable and palatable respectively. Competition for food between wildlife and livestock was high recorded for 60% plants. Plants used to cure various diseases including stomachache, asthma, cancer and tuberculosis etc. Plant resources in KNP are unique and vary with climate and altitude. This floral wealth is under tremendous threats of global climate change and anthropogenic activities like overgrazing, increasing population, and a rapidly declining traditional knowledge for

Heart rhythm at the time of death documented by an implantable loop recorder

DEFF Research Database (Denmark)

Gang, Uffe Jakob Ortved; Jøns, Christian; Jørgensen, Rikke Mørch

2010-01-01

The aims of this study were to describe arrhythmias documented with an implantable loop recorder (ILR) in post-acute myocardial infarction (AMI) patients with left ventricular dysfunction at the time of death and to establish the correlation to mode of death.......The aims of this study were to describe arrhythmias documented with an implantable loop recorder (ILR) in post-acute myocardial infarction (AMI) patients with left ventricular dysfunction at the time of death and to establish the correlation to mode of death....

Co-location satellite GPS and SLR geodetic techniques at the Felix Aguilar Astronomical Observatory of San Juan, Argentina

Science.gov (United States)

Podestá, R.; Pacheco, A. M.; Alvis Rojas, H.; Quinteros, J.; Podestá, F.; Albornoz, E.; Navarro, A.; Luna, M.

2018-01-01

This work shows the strategy followed for the co-location of the Satellite Laser Ranging (SLR) ILRS 7406 telescope and the antenna of the permanent Global Positioning System (GPS) station, located at the Félix Aguilar Astronomical Observatory (OAFA) in San Juan, Argentina. The accomplishment of the co-location consisted in the design, construction, measurement, adjustment and compensation of a geodesic net between the stations SLR and GPS, securing support points solidly built in the soil. The co-location allows the coordinates of the station to be obtained by combining the data of both SLR and GPS techniques, achieving a greater degree of accuracy than individually. The International Earth Rotation and Reference Systems Service (IERS) considers the co-located stations as the most valuable and important points for the maintenance of terrestrial reference systems and their connection with the celestial ones. The 3 mm precision required by the IERS has been successfully achieved.

Photon Pressure Force on Space Debris TOPEX/Poseidon Measured by Satellite Laser Ranging

Science.gov (United States)

Kucharski, D.; Kirchner, G.; Bennett, J. C.; Lachut, M.; Sośnica, K.; Koshkin, N.; Shakun, L.; Koidl, F.; Steindorfer, M.; Wang, P.; Fan, C.; Han, X.; Grunwaldt, L.; Wilkinson, M.; Rodríguez, J.; Bianco, G.; Vespe, F.; Catalán, M.; Salmins, K.; del Pino, J. R.; Lim, H.-C.; Park, E.; Moore, C.; Lejba, P.; Suchodolski, T.

2017-10-01

The (TOPography EXperiment) TOPEX/Poseidon (T/P) altimetry mission operated for 13 years before the satellite was decommissioned in January 2006, becoming a large space debris object at an altitude of 1,340 km. Since the end of the mission, the interaction of T/P with the space environment has driven the satellite's spin dynamics. Satellite laser ranging (SLR) measurements collected from June 2014 to October 2016 allow for the satellite spin axis orientation to be determined with an accuracy of 1.7°. The spin axis coincides with the platform yaw axis (formerly pointing in the nadir direction) about which the body rotates in a counterclockwise direction. The combined photometric and SLR data collected over the 11 year time span indicates that T/P has continuously gained rotational energy at an average rate of 2.87 J/d and spins with a period of 10.73 s as of 19 October 2016. The satellite attitude model shows a variation of the cross-sectional area in the Sun direction between 8.2 m2 and 34 m2. The direct solar radiation pressure is the main factor responsible for the spin-up of the body, and the exerted photon force varies from 65 μN to 228 μN around the mean value of 138.6 μN. Including realistic surface force modeling in orbit propagation algorithms will improve the prediction accuracy, giving better conjunction warnings for scenarios like the recent close approach reported by the ILRS Space Debris Study Group—an approximate 400 m flyby between T/P and Jason-2 on 20 June 2017.

26 CFR 1.167(a)-11 - Depreciation based on class lives and asset depreciation ranges for property placed in service...

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation based on class lives and asset depreciation ranges for property placed in service after December 31, 1970. 1.167(a)-11 Section 1.167(a)-11...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(a)-11 Depreciation...

CDDIS: NASA's Archive of Space Geodesy Data and Products Supporting GGOS

Science.gov (United States)

Noll, Carey; Michael, Patrick

2016-01-01

The Crustal Dynamics Data Information System (CDDIS) supports data archiving and distribution activities for the space geodesy and geodynamics community. The main objectives of the system are to store space geodesy and geodynamics related data and products in a central archive, to maintain information about the archival of these data,to disseminate these data and information in a timely manner to a global scientific research community, and provide user based tools for the exploration and use of the archive. The CDDIS data system and its archive is a key component in several of the geometric services within the International Association of Geodesy (IAG) and its observing systemthe Global Geodetic Observing System (GGOS), including the IGS, the International DORIS Service (IDS), the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS), and the International Earth Rotation and Reference Systems Service (IERS). The CDDIS provides on-line access to over 17 Tbytes of dataand derived products in support of the IAG services and GGOS. The systems archive continues to grow and improve as new activities are supported and enhancements are implemented. Recently, the CDDIS has established a real-time streaming capability for GNSS data and products. Furthermore, enhancements to metadata describing the contents ofthe archive have been developed to facilitate data discovery. This poster will provide a review of the improvements in the system infrastructure that CDDIS has made over the past year for the geodetic community and describe future plans for the system.

Atlantic Test Range (ATR)

Data.gov (United States)

Federal Laboratory Consortium — ATR controls fully-instrumented and integrated test ranges that provide full-service support for cradle-to-grave testing. Airspace and surface target areas are used...

Balancing guava nutrition with liming and fertilization

Directory of Open Access Journals (Sweden)

Amanda Hernandes

2012-12-01

Full Text Available Guava response to liming and fertilization can be monitored by tissue testing. Tissue nutrient signature is often diagnosed against nutrient concentration standards. However, this approach has been criticized for not considering nutrient interactions and to generate numerical biases as a result of data redundancy, scale dependency and non-normal distribution. Techniques of compositional data analysis can control those biases by balancing groups of nutrients, such as those involved in liming and fertilization. The sequentially arranged and orthonormal isometric log ratios (ilr or balances avoid numerical bias inherent to compositional data. The objectives were to relate tissue nutrient balances with the production of "Paluma" guava orchards differentially limed and fertilized, and to adjust the current patterns of nutrient balance with the range of more productive guava trees. It was conducted one experiment of 7-yr of liming and three experiments of 3-yr with N, P and K trials in 'Paluma' orchards on an Oxisol. Plant N, P, K, Ca and Mg were monitored yearly. It was selected the [N, P, K | Ca, Mg], [N, P | K], [N | P] and [Ca | Mg] balances to set apart the effects of liming (Ca-Mg and fertilizers (N-K on macronutrient balances. Liming largely influenced nutrient balances of guava in the Oxisol while fertilization was less influential. The large range of guava yields and nutrient balances allowed defining balance ranges and comparing them with the critical ranges of nutrient concentration values currently used in Brazil and combined into ilr coordinates.

Desirable forest structures for a restored Front Range

Science.gov (United States)

Yvette L. Dickinson; Rob Addington; Greg Aplet; Mike Babler; Mike Battaglia; Peter Brown; Tony Cheng; Casey Cooley; Dick Edwards; Jonas Feinstein; Paula Fornwalt; Hal Gibbs; Megan Matonis; Kristen Pelz; Claudia Regan

2014-01-01

As part of the federal Collaborative Forest Landscape Restoration Program administered by the US Forest Service, the Colorado Front Range Collaborative Forest Landscape Restoration Project (FR-CFLRP, a collaborative effort of the Front Range Roundtable1 and the US Forest Service) is required to define desired conditions for lower montane ponderosa pine (Pinus ponderosa...

ORF Alignment: NC_003552 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available FSVARGETLGLFGKSGSGKTTIGRCIVGLEKPTGGEILVQ 60 ... Query: 126 ELAELTGLRPEHLARYPGHLSGGEIQRIVLARIMALSPDFIVADEPTSMLDV...SVQAQILR 185 ... ELAELTGLRPEHLARYPGHLSGGEIQRIVLARIMALSPDFIVADEPTSMLDVSVQAQ...ILR Sbjct: 121 ELAELTGLRPEHLARYPGHLSGGEIQRIVLARIMALSPDFIVADEPTSMLDVSVQAQILR 180 ...

Ventricular Tachycardia Detected by Implantable Loop Recorder in a Child with Recurrent Syncope

Directory of Open Access Journals (Sweden)

İsa Özyılmaz

2014-06-01

Full Text Available In this article, we present a 10-year-old boy who was admitted to the hospital with recurrent syncope. There was no remarkable finding in patient’s physical examination, family history, and the diagnostic 12-lead electrocardiogram (ECG, chest x-ray, ECG Holter monitoring, event recording, echocardiography, coronary computed tomography (CT angiography, Ajmaline test for the diagnosis of Brugada syndrome, brain magnetic resonance imaging, and sleep/wake electroencephalogram. We started beta-blocker therapy because the patient had exercise-induced syncope. An Implantable loop recorder (ILR was inserted to the patient. Three years later, polymorphic ventricular tachycardia called torsades de pointes was detected by the ILR during syncope occurred with exercise. The patient had been taking high-dose betablocker treatment, an implantable cardioverter defibrillator was implanted into the patient. ILR can play an important role in the diagnosis of life-threatening arrhythmia in children with unexplained syncope. (The Me­di­cal Bul­le­tin of Ha­se­ki 2014; 52: 123-5

The Crustal Dynamics Data Information System: A Resource to Support Scientific Analysis Using Space Geodesy

Science.gov (United States)

Noll. Carey E.

2010-01-01

Since 1982. the Crustal Dynamics Data Information System (CDDIS) has supported the archive and distribution of geodetic data products acquired by the National Aeronautics and Space Administration (NASA) as well as national and international programs. The CDDIS provides easy, timely, and reliable access to a variety of data sets, products, and information about these data. These measurements. obtained from a global network of nearly 650 instruments at more than 400 distinct sites, include DORIS (Doppler Orbitography and Radiopositioning Integrated by Satellite), GNSS (Global Navigation Satellite System), SLR and LLR (Satellite and Lunar Laser Ranging), and VLBI (Very Long Baseline Interferometry). The CDDIS data system and its archive have become increasingly important to many national and international science communities, particularly several of the operational services within the International Association of Geodesy (IAG) and its observing system the Global Geodetic Observing System (GGOS), including the International DORIS Service (IDS), the International GNSS Service (IGS). the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS). and the International Earth rotation and Reference frame Service (IERS), Investigations resulting from the data and products available through the CDDIS support research in many aspects of Earth system science and global change. Each month, the CDDIS archives more than one million data and derived product files totaling over 90 Gbytes in volume. In turn. the global user community downloads nearly 1.2 TBytes (over 10.5 million files) of data and products from the CDDIS each month. The requirements of analysts have evolved since the start of the CDDIS; the specialized nature of the system accommodates the enhancements required to support diverse data sets and user needs. This paper discusses the CDDIS. including background information about the system and its. user communities

Clear Purpose...Complete Commitment: A Long-Range Program To Provide Louisianians with Library and Information Services Adequate to Their Needs, 1993-1997.

Science.gov (United States)

Jaques, Thomas F.

This long range plan, which was prepared in compliance with the Library Services and Construction Act (LSCA), begins with an overview of the library public and the state library agency in Louisiana. Identification of needs and action plans are presented in the following goal areas: (1) improving state library administration; (2) extending services…

5 CFR 534.502 - Pay range.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Pay range. 534.502 Section 534.502 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY UNDER OTHER SYSTEMS Pay for Senior-Level and Scientific and Professional Positions § 534.502 Pay range. A pay rate fixed under this...

Clear Purpose...Complete Commitment. A Long-Range Program To Provide Louisianians with Library and Information Services Adequate to Their Needs, 1990/91-1995.

Science.gov (United States)

Jaques, Thomas F.

This long-range library program for the state of Louisiana identifies specific inadequacies in public library services, resources, facilities, and personnel. It identifies the people who are to be served, and reveals geographical, socioeconomic, and educational barriers to the expanded use of libraries. Finally, it presents specific goals and…

Central Laboratories Services

Data.gov (United States)

Federal Laboratory Consortium — The TVA Central Laboratories Services is a comprehensive technical support center, offering you a complete range of scientific, engineering, and technical services....

Usefulness of implantable loop recorder in a patient with syncope during bathing

Directory of Open Access Journals (Sweden)

Motohiro Nakao, MD

2013-02-01

Full Text Available A 27-year-old man presented to our hospital with a 1-year-hisory of repeated syncope, which particularly occurred while bathing or on a hot day. The head-up tilt test did not induce arrhythmia; however, blood pressure decreased by 39 mm Hg without any symptoms. Given that no bradycardia/tachycardia was induced on electrophysiological study and carotid sinus massage, an implantable loop recorder (ILR was implanted. After 2 months, syncope again occurred during bathing at midnight. Sinus arrest and a maximum ventricular pause of 10.2 s were documented using the ILR. After pacemaker implantation, the patient had not experienced syncope for 14 months.

Service marketing

Directory of Open Access Journals (Sweden)

Babić-Hodović Vesna

2002-01-01

Full Text Available Development of postindustrial society and services revolution created numerous changes in size of consumer demand, consumer reaction and priorities. Continuous change on the side of demand and offer must follow changes in marketing orientation. Leader in that change is services marketing which by knowing services range and all the changes builds a new concept called Relationship Marketing.

Service modelling

NARCIS (Netherlands)

Steen, M.W.A.; Iacob, Maria Eugenia; Lankhorst, M.M.; Jonkers, H.; Zoet, M.; Engelsman, W.; Versendaal, J.; Proper, H.A.; Debije, L.; Gaaloul, K.; Lankhorst, M.

2012-01-01

The development of enterprise services involves making design decisions at different levels, ranging from strategic to infrastructural choices, and concerning many different aspects, ranging from customer interaction to information registration concerns. In order to support an agile development

Techno-Economic Analysis of BEV Service Providers Offering Battery Swapping Services

Energy Technology Data Exchange (ETDEWEB)

Neubauer, J. S.; Pesaran, A.

2013-01-01

Battery electric vehicles (BEVs) offer the potential to reduce both oil imports and greenhouse gas emissions, but high upfront costs, battery-limited vehicle range, and concern over high battery replacement costs may discourage potential buyers. A subscription model in which a service provider owns the battery and supplies access to battery swapping infrastructure could reduce upfront and replacement costs for batteries with a predictable monthly fee, while expanding BEV range. Assessing the costs and benefits of such a proposal are complicated by many factors, including customer drive patterns, the amount of required infrastructure, battery life, etc. The National Renewable Energy Laboratory has applied its Battery Ownership Model to compare the economics and utility of BEV battery swapping service plan options to more traditional direct ownership options. Our evaluation process followed four steps: (1) identifying drive patterns best suited to battery swapping service plans, (2) modeling service usage statistics for the selected drive patterns, (3) calculating the cost-of-service plan options, and (4) evaluating the economics of individual drivers under realistically priced service plans. A service plan option can be more cost-effective than direct ownership for drivers who wish to operate a BEV as their primary vehicle where alternative options for travel beyond the single-charge range are expensive, and a full-coverage-yet-cost-effective regional infrastructure network can be deployed. However, when assumed cost of gasoline, tax structure, and absence of purchase incentives are factored in, our calculations show the service plan BEV is rarely more cost-effective than direct ownership of a conventional vehicle.

Contrasting nutritional acclimation of sugar maple (Acer saccharum Marsh. and red maple (Acer rubrum L. to increasing conifers and soil acidity as demonstrated by foliar nutrient balances

Directory of Open Access Journals (Sweden)

Alexandre Collin

2016-07-01

Full Text Available Sugar maple (Acer saccharum Marshall, SM is believed to be more sensitive to acidic and nutrient-poor soils associated with conifer-dominated stands than red maple (Acer rubrum L., RM. Greater foliar nutrient use efficiency (FNUE of RM is likely the cause for this difference. In the context of climate change, this greater FNUE could be key in favouring northward migration of RM over SM. We used the concept of foliar nutrient balances to study the nutrition of SM and RM seedlings along an increasing gradient in forest floor acidity conditioned by increasing proportions of conifers (pH values ranging from 4.39 under hardwoods, to 4.29 under mixed hardwood-conifer stands and 4.05 under conifer-dominated stands. Nutrients were subjected to isometric log-ratio (ilr transformation, which views the leaf as one closed system and considers interactions between nutrients. The ilr method eliminates numerical biases and weak statistical inferences based on raw or operationally’’ log-transformed data. We analyzed foliar nutrients of SM and RM seedlings and found that the [Ca,Mg,K|P,N] and [Ca,Mg|K] balances of SM seedlings were significantly different among soil acidity levels, whereas they did not vary for RM seedlings. For SM seedlings, these differences among soil acidity levels were due to a significant decrease in foliar Ca and Mg concentrations with increasing forest floor acidity. Similar differences in foliar balances were also found between healthy and declining SM stands estimated from literature values. Conversely, foliar balances of RM seedlings did not differ among soil acidity levels, even though untransformed foliar nutrient concentrations were significantly different. This result highlights the importance of using ilr transformation, since it provides more sensitive results than standard testing of untransformed nutrient concentrations. The lower nutrient requirements of RM and its greater capacity to maintain nutrient equilibrium are

Techno-Economic Analysis of BEV Service Providers Offering Battery Swapping Services: Preprint

Energy Technology Data Exchange (ETDEWEB)

Neubauer, J.; Pesaran, A.

2013-03-01

Battery electric vehicles (BEVs) offer the potential to reduce both oil imports and greenhouse gas emissions, but high upfront costs, battery-limited vehicle range, and concern over high battery replacement costs may discourage potential buyers. A subscription model in which a service provider owns the battery and supplies access to battery swapping infrastructure could reduce upfront and replacement costs for batteries with a predictable monthly fee, while expanding BEV range. Assessing the costs and benefits of such a proposal are complicated by many factors, including customer drive patterns, the amount of required infrastructure, battery life, etc. The National Renewable Energy Laboratory has applied its Battery Ownership Model to compare the economics and utility of BEV battery swapping service plan options to more traditional direct ownership options. Our evaluation process followed four steps: (1) identifying drive patterns best suited to battery swapping service plans, (2) modeling service usage statistics for the selected drive patterns, (3) calculating the cost-of-service plan options, and (4) evaluating the economics of individual drivers under realistically priced service plans. A service plan option can be more cost-effective than direct ownership for drivers who wish to operate a BEV as their primary vehicle where alternative options for travel beyond the single-charge range are expensive, and a full-coverage-yet-cost-effective regional infrastructure network can be deployed. However, when assumed cost of gasoline, tax structure, and absence of purchase incentives are factored in, our calculations show the service plan BEV is rarely more cost-effective than direct ownership of a conventional vehicle.

Exploring Modularity in Services

DEFF Research Database (Denmark)

Avlonitis, Viktor; Hsuan, Juliana

2017-01-01

the effects of modularity and integrality on a range of different analytical levels in service architectures. Taking a holistic approach, the authors synthesize and empirically deploy a framework comprised of the three most prevalent themes in modularity and service design literature: Offering (service...... insights on the mirroring hypothesis of modularity theory to services. Originality/value The paper provides a conceptualization of service architectures drawing on service design, modularity, and market relationships. The study enriches service design literature with elements from modularity theory...

Losses Loom Longer Than Gains : Modeling the Impact of Service Crises on Perceived Service Quality over Time

NARCIS (Netherlands)

Gijsenberg, Maarten J.; van Heerde, Harald J.; Verhoef, Peter C.

2015-01-01

Service providers sometimes face mass service failures. These problems occur across service industries, ranging from severe Internet outages to severe delays for airlines or trains. A key question that has not been addressed in the literature is: how do service crises impact perceived service

The service of public services performance management

DEFF Research Database (Denmark)

Lystbæk, Christian Tang

perspectives on the potential impact of public service performance measurement offer a range of contradictory propositions. Its alleged benefits include public assurance, better functioning of supply markets for public services, and direct improvements of public services. But the literature also demonstrates...... the existence of significant concern about the actual impact, the costs and unintended consequences associated with performance measurement.  Performance measurement and management have been part of the political agenda within the public sphere since their adoption in the post-Second World War period...... of political masters and their mistresses rather than public service. Another area of concern is the cost of performance measurement. Hood & Peters (2004:278) note that performance measurement is likely to “distract middle- and upper-level officials, create massive paperwork, and produce major unintended...

The service of public services performance measurement

DEFF Research Database (Denmark)

Lystbæk, Christian Tang

2014-01-01

that performance measurement serves as “rituals of verification” which promotes the interests of political masters and their mistresses rather than public service. Another area of concern is the cost of performance measurement. Hood & Peters (2004:278) note that performance measurement is likely to “distract...... measurement suggests a range of contested and contradictory propositions. Its alleged benefits include public assurance, better functioning of supply markets for public services, and direct improvements of public services. But the literature also demonstrates the existence of significant concern about...... the actual impact, the costs and unintended consequences associated with performance measurement. This paper identifies the main rationales and rationalities in the scholarly discourse on public services performance measurement. It concludes with some suggestions on how to deal with the many rationales...

Childhood bereavement services: a survey of UK provision.

Science.gov (United States)

Rolls, L; Payne, S

2003-07-01

The purpose of the study was to identify the location, range and type of childhood bereavement service provision in the UK. A questionnaire was mailed to 127 services who were either solely dedicated to childhood bereavement or who offered a service within the range of work of a host organization and for which there was a supporting organizational structure. Responses were received from 108 services (a response rate of 85%). The findings identified that 85% of childhood bereavement services are located in the voluntary sector; 14% are dedicated childhood bereavement services, while 86% are offered as part of a host organization. Forty-four per cent of host organizations are hospices. The majority of services (73%) relied on both paid and unpaid staff, with 11% relying entirely on paid staff and 14% of services relying entirely on unpaid staff. The interventions offered ranged from individual family work (86%), individual child work (62%), groupwork with families (53%) and groupwork with children (45%). In addition, services offered prebereavement support (64%), a 'drop-in' service (17%), information and advice (95%), training (32%) and the provision of resources (88%). As well as offering a service to children and their families, 74% of childhood bereavement services provided a service to 'secondary users', such as schools (66%), the emergency services (28%) and other professionals (63%). In terms of funding, 12% of services relied solely on external sources of funding, including donations, legacies, revenue from the host organization or grants, while 12% of services relied solely on internal sources of funding, including fundraising and training. The majority of services (73%), however, gained income from a range of sources. The study identifies the diversity of provision that has implications for the evaluation of childhood bereavement services.

Tracking on non-active collaborative objects from San Fernando Laser station

Science.gov (United States)

Catalán, Manuel; Quijano, Manuel; Cortina, Luis M.; Pazos, Antonio A.; Martín-Davila, José

2016-04-01

The Royal Observatory of the Spanish Navy (ROA) works on satellite geodesy from the early days of the space age, when the first artificial satellite tracking telescope was installed in 1958: the Baker-Nunn camera. In 1975 a French satellite Laser ranging (SLR) station was installed and operated at ROA . Since 1980, ROA has been operating this instrument which was upgraded to a third generation and it is still keep into a continuous update to reach the highest level of operability. Since then ROA has participated in different space geodesy campaigns through the International Laser Service Stations (ILRS) or its European regional organization (EUROLAS), tracking a number of artificial satellites types : ERS, ENVISAT, LAGEOS, TOPEX- POSEIDON to name but a few. Recently we opened a new field of research: space debris tracking, which is receiving increasing importance and attention from international space agencies. The main problem is the relatively low accuracy of common used methods. It is clear that improving the predicted orbit accuracy is necessary to fulfill our aims (avoiding unnecessary anti-collision maneuvers,..). Following results obtained by other colleagues (Austria, China, USA,...) we proposed to share our time-schedule using our satellite ranging station to obtain data which will make orbital elements predictions far more accurate (sub-meter accuracy), while we still keep our tracking routines over active satellites. In this communication we report the actions fulfill until nowadays.

Service models and realization of differentiated services networks

Science.gov (United States)

Elizondo, Antonio J.; Garcia Osma, Maria L.; Einsiedler, Hans J.; Roth, Rudolf; Smirnov, Michael I.; Bartoli, Maurizio; Castelli, Paolo; Varga, Balazs; Krampell, Magnus

2001-07-01

Internet Service Providers need to offer Quality of Service (QoS) to fulfil the requirements of applications of their customers. Moreover, in a competitive market environment costs must be low. The selected service model must be effective and low in complexity, but it should still provide high quality and service differentiation, that the current Internet is not yet capable to support. The Differentiated Services (DiffServ) Architecture has been proposed for enabling a range of different Classes of Service (CoS). In the EURESCOM project P1006 several European service providers co-operated to examine various aspects involved in the introduction of service differentiation using the DiffServ approach. The project explored a set of service models for Expedited Forwarding (EF) and Assured Forwarding (AF) and identified requirements for network nodes. Besides, we addressed also measurement issues, charging and accounting issues. Special attention has been devoted to requirements of elastic traffic that adapts its sending rate to congestion state and available bandwidth. QoS mechanisms must prove Transmission Control Protocol (TCP) friendliness. TCP performance degrades under multiple losses. Since RED based queue management may still cause multiple discards, a modified marking scheme called Capped Leaky Bucket is proposed to improve the performance of elastic applications.

Productivity in Public Services

OpenAIRE

Helen Simpson

2007-01-01

This paper discusses issues arising in the measurement of productivity in public services. Compared to measuring productivity in the private sector difficulties arise because the output of public services is often un-priced and because some public services are consumed collectively. A key problem is measuring the full range of outputs and quality improvements delivered by public sector organisations that are valued by society. Without comprehensive measures of output productivity statistics m...

Differential Expression of P450 Genes and nAChR Subunits Associated With Imidacloprid Resistance in Laodelphax striatellus (Hemiptera: Delphacidae).

Science.gov (United States)

Zhang, Yueliang; Liu, Baosheng; Zhang, Zhichun; Wang, Lihua; Guo, Huifang; Li, Zhong; He, Peng; Liu, Zewen; Fang, Jichao

2018-05-28

Imidacloprid is a key insecticide used for controlling sucking insect pests, including the small brown planthopper (Laodelphax striatellus, Fallén) (Hemiptera: Delphacidae), an important agricultural pest of rice. A strain of L. striatellus (YN-ILR) developed 21-fold resistance when selected with imidacloprid on a susceptible YN strain. An in vitro study on piperonyl butoxide synergism indicated that enhanced detoxification mediated by cytochrome P450s contributed to imidacloprid resistance to some extent, and multiple P450 genes showed altered expression in the imidacloprid-resistant YN-ILR strain compared with the susceptible YN strain (CYP425B1-CYP6BD10 had 1.51- to 11.45-fold higher expression, CYP4CE2-CYP4DD1V2 had 0.12- to 0.57-fold lower expression). While there were no mutations in target nicotinic acetylcholine receptor (nAChR) genes, subunits of Lsα1, Lsβ1, and Lsβ3 in the YN-ILR strain showed 3.86-, 4.39-, and 2.59-fold higher expression and Lsa8 displayed 0.38-fold lower expression than the YN strain. Moreover, 21-fold moderate imidacloprid resistance in individuals of L. striatellus did not produce a fitness cost. The findings suggest that L. striatellus has the capacity to develop resistance to imidacloprid through P450 detoxification and potential target nAChR expression changes, and moderate imidacloprid resistance was not associated with a fitness cost.

CSIR eNews: Knowledge services

CSIR Research Space (South Africa)

CSIR

2007-12-01

Full Text Available CSIR Knowledge Services has added another offering to its current range of expertise. The newly established project management services area is designed to improve project success rates in terms of the three-dimensional goal of project management, i...

Report to Congress on Sustainable Ranges

Science.gov (United States)

2014-02-01

high capacity transmission lines, solar arrays, and geothermal 4 | 2014 Sustainable Ranges Report February 2014 Chapter 1: Military Service... geothermal power and associated transmission infrastructure both on- and off-shore will require close attention to ensure the Marine Corps’ access...Weapons Systems Training Facility (NWSTF) Boardman; offshore wind development proposed south of Pearl Harbor, HI, NAWC China Lake, CA/Nevada Test

Analysis Tool Web Services from the EMBL-EBI.

Science.gov (United States)

McWilliam, Hamish; Li, Weizhong; Uludag, Mahmut; Squizzato, Silvano; Park, Young Mi; Buso, Nicola; Cowley, Andrew Peter; Lopez, Rodrigo

2013-07-01

Since 2004 the European Bioinformatics Institute (EMBL-EBI) has provided access to a wide range of databases and analysis tools via Web Services interfaces. This comprises services to search across the databases available from the EMBL-EBI and to explore the network of cross-references present in the data (e.g. EB-eye), services to retrieve entry data in various data formats and to access the data in specific fields (e.g. dbfetch), and analysis tool services, for example, sequence similarity search (e.g. FASTA and NCBI BLAST), multiple sequence alignment (e.g. Clustal Omega and MUSCLE), pairwise sequence alignment and protein functional analysis (e.g. InterProScan and Phobius). The REST/SOAP Web Services (http://www.ebi.ac.uk/Tools/webservices/) interfaces to these databases and tools allow their integration into other tools, applications, web sites, pipeline processes and analytical workflows. To get users started using the Web Services, sample clients are provided covering a range of programming languages and popular Web Service tool kits, and a brief guide to Web Services technologies, including a set of tutorials, is available for those wishing to learn more and develop their own clients. Users of the Web Services are informed of improvements and updates via a range of methods.

Composite Broadcasting and Ranging via a Satellite Dual-Frequency MPPSK System

Directory of Open Access Journals (Sweden)

Yu Yao

2013-01-01

Full Text Available Since digital video broadcasting via satellite (DVB-S signals are “inefficient”, regarding the amount of information they convey on the bandwidth they occupy, a joint broadcasting and ranging system would constitute a unique platform for future digital video broadcasting satellite services effecting the essential tasks of satellite navigation system and direct to home (DTH services, in terms of both spectrum efficiency and cost effectiveness. In this paper, the design of dual frequency M-ary position phase shift keying (MPPSK system which is suitable for, respectively, performing both data transmission and range measurement is proposed. The approach is based on MPPSK modulation waveforms utilized in digital video broadcasting. In particular, requirements that allow for employing such signals for range measurements with high accuracy and high range are investigated. Also, the relationship between the frequency difference of dual frequency MPPSK system and range accuracy is discussed. Moreover, the selection of MPPSK modulation parameter for data rate and ranging is considered. In addition to theoretical considerations, the paper presents system simulations and measurement results of new systems, demonstrating the high spectral utilization of integrated broadcasting and ranging applications.

Home Care Services: Questions to Ask

Science.gov (United States)

Healthy Lifestyle Healthy aging Home care services range from medical care to help with daily household chores. If ... 12, 2017 Original article: http://www.mayoclinic.org/healthy-lifestyle/healthy-aging/in-depth/home-care-services/art- ...

5 CFR 534.403 - SES rate range.

Science.gov (United States)

2010-01-01

... first day of the first applicable pay period beginning on or after January 1, 2004, the minimum rate of basic pay of the SES rate range is set at an amount equal to the minimum rate of basic pay under 5 U.S.C... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY UNDER OTHER SYSTEMS Pay and...

Public Support As A Center Of Gravity For National Space Power

Science.gov (United States)

2014-04-01

Advisors: Doctor Dale Hayden Lieutenant Colonel David Hanson Major Mark Ciesel Major Carrie Chappell Maxwell Air Force Base, Alabama...2011. Wechsler , Jill. The Role of GPS in Precise Time and Frequency Dissemination. 1990. http://ilrs.gsfc.nasa.gov/docs/timing/gpsrole.pdf

Privacy-Preserving Location-Based Services

Science.gov (United States)

Chow, Chi Yin

2010-01-01

Location-based services (LBS for short) providers require users' current locations to answer their location-based queries, e.g., range and nearest-neighbor queries. Revealing personal location information to potentially untrusted service providers could create privacy risks for users. To this end, our objective is to design a privacy-preserving…

Programming NET Web Services

CERN Document Server

Ferrara, Alex

2007-01-01

Web services are poised to become a key technology for a wide range of Internet-enabled applications, spanning everything from straight B2B systems to mobile devices and proprietary in-house software. While there are several tools and platforms that can be used for building web services, developers are finding a powerful tool in Microsoft's .NET Framework and Visual Studio .NET. Designed from scratch to support the development of web services, the .NET Framework simplifies the process--programmers find that tasks that took an hour using the SOAP Toolkit take just minutes. Programming .NET

Switching Service Providers: Reasons, Service Types, and Sequences

African Journals Online (AJOL)

In Keaveney.s (1995) landmark study on the reasons for switching service providers, data were gathered using critical incident technique (CIT); here the original findings are tested using survey method. Keaveney.s typology of reasons for switching is supported across a range of categories but, in this new study, the reasons ...

Range Flight Safety Requirements

Science.gov (United States)

Loftin, Charles E.; Hudson, Sandra M.

2018-01-01

The purpose of this NASA Technical Standard is to provide the technical requirements for the NPR 8715.5, Range Flight Safety Program, in regards to protection of the public, the NASA workforce, and property as it pertains to risk analysis, Flight Safety Systems (FSS), and range flight operations. This standard is approved for use by NASA Headquarters and NASA Centers, including Component Facilities and Technical and Service Support Centers, and may be cited in contract, program, and other Agency documents as a technical requirement. This standard may also apply to the Jet Propulsion Laboratory or to other contractors, grant recipients, or parties to agreements to the extent specified or referenced in their contracts, grants, or agreements, when these organizations conduct or participate in missions that involve range flight operations as defined by NPR 8715.5.1.2.2 In this standard, all mandatory actions (i.e., requirements) are denoted by statements containing the term “shall.”1.3 TailoringTailoring of this standard for application to a specific program or project shall be formally documented as part of program or project requirements and approved by the responsible Technical Authority in accordance with NPR 8715.3, NASA General Safety Program Requirements.

Developing a competitive advantage in the market for radiology services.

Science.gov (United States)

Kropf, R; Szafran, A J

1988-01-01

This article describes how managers of outpatient diagnostic radiology services can develop a competitive advantage by increasing the value of services to patients and referring physicians. A method is presented to identify changes to services that increase their value. The method requires the definition of the "value chains" of patients and referring physicians. Particular attention is paid to the use of information systems technology to suggest and implement service changes. A narrow range of health services was selected because the approach requires a detailed understanding of consumers and how they use services. The approach should, however, be examined carefully by managers seeking to develop a competitive advantage for a wide range of health services.

Lymph node metastasis of carcinomas of transverse colon including flexures. Consideration of the extramesocolic lymph node stations.

Science.gov (United States)

Perrakis, Aristotelis; Weber, Klaus; Merkel, Susanne; Matzel, Klaus; Agaimy, Abbas; Gebbert, Carol; Hohenberger, Werner

2014-10-01

Complete mesocolic excision (CME) is nowadays state of the art in the treatment of colon cancer. In cases of carcinoma of transverse colon and of both flexures an extramesocolic lymph node metastasis can be found in the infrapancreatic lymph node region (ILR) and across the gastroepiploic arcade (GLR). These direct metastatic routes were not previously systematically considered. In order to validate our hypothesis of these direct metastatic pathways and to obtain evidence of our approach of including dissection of these areas as part of CME, we initiated a prospective study evaluating these lymph node regions during surgery. Forty-five consecutive patients with primary tumour manifestation in transverse colon and both flexures between May 2010 and January 2013 were prospectively analyzed. Patients were followed up for at least 6 months. Mode of surgery, histopathology, morbidity and mortality were evaluated. Twenty-six patients had a carcinoma of transverse colon, 16 patients one of hepatic flexure and four patients one of splenic flexure. The median lymph node yield was 40. Occurrence of lymph node metastasis in ILR was registered in five patients and in GLR in four patients. The mean lymph node ratio was 0.085. Postoperative complications occurred in nine patients, and postoperative mortality was 2 %. We were able to demonstrate this novel metastatic route of carcinomas of the transverse colon and of both flexures in ILR and GLR. These could be considered as regional lymph node regions and have to be included into surgery for cancer of the transverse colon including both flexures.

Community care and social services.

OpenAIRE

Renwick, D.

1996-01-01

The aim of community care is to enable people with various types of disability to live in their own homes, rather than in institutions. This involves the provision of support and services at home by various agencies. After a critical report in 1986 identified problems with coordination and flexibility of community care services, the white paper Caring for People (1989) stated the government's aim to provide a "needs led," responsive range of services, promoting maximum independence of those w...

Abnormal ranges of vital signs in children in Japanese prehospital settings.

Science.gov (United States)

Nosaka, Nobuyuki; Muguruma, Takashi; Knaup, Emily; Tsukahara, Kohei; Enomoto, Yuki; Kaku, Noriyuki

2015-10-01

The revised Fire Service Law obliges each prefectural government in Japan to establish a prehospital acuity scale. The Foundation for Ambulance Service Development (FASD) created an acuity scale for use as a reference. Our preliminary survey revealed that 32 of 47 prefectures directly applied the FASD scale for children. This scale shows abnormal ranges of heart rate and respiratory rate in young children. This study aimed to evaluate the validity of the abnormal ranges on the FASD scale to assess its overall performance for triage purposes in paediatric patients. We evaluated the validity of the ranges by comparing published centile charts for these vital signs with records of 1,296 ambulance patients. A large portion of the abnormal ranges on the scale substantially overlapped with the normal centile charts. Triage decisions using the FASD scale of vital signs properly classified 22% ( n  = 287) of children. The sensitivity and specificity for high urgency were as high as 91% (95% confidence interval, 82-96%) and as low as 18% (95% confidence interval, 16-20%). We found there is room for improvement of the abnormal ranges on the FASD scale.

75 FR 25313 - Proposed Collection; Comment Request

Science.gov (United States)

2010-05-07

... (Financial Statement) reviewed or audited by an independent certified public accountant; (ii) Single Audit A... financial statement that has been audited by an independent certified public accountant; (ii) an ILR... of its continuing effort to reduce paperwork and respondent burden, invites the general public and...

Systematic review on the treatment of isolated local recurrence of pancreatic cancer after surgery; re-resection, chemoradiotherapy and SBRT

NARCIS (Netherlands)

Groot, Vincent P.; van Santvoort, Hjalmar C.; Rombouts, Steffi J E; Hagendoorn, Jeroen; Borel Rinkes, Inne H M; van Vulpen, Marco; Herman, Joseph M.; Wolfgang, Christopher L.; Besselink, Marc G.; Molenaar, I. Quintus

Background: The majority of patients who have undergone a pancreatic resection for pancreatic cancer develop disease recurrence within two years. In around 30% of these patients, isolated local recurrence (ILR) is found. The aim of this study was to systematically review treatment options for this

Visualizing attitudes towards service levels

NARCIS (Netherlands)

K.Y. Lam (Kar Yin); M. van de Velden (Michel); Ph.H.B.F. Franses (Philip Hans)

2011-01-01

textabstractTo assess the attitudes with respect to the quality of banks’ service levels, we use survey data amongst more than 250 Chief Financial Officers (CFOs) of a range of Netherlands-based companies. These companies range from small to very large (including multinationals as Philips and Shell)

Amazon Web Services- a Case Study

OpenAIRE

Narendula, Rammohan

2012-01-01

The Amazon Web Services (AWS) is a set (more than 25) of proprietary web-based services owned by Amazon.com. All these services ranging from simple storage to sophisticated database services constitute the cloud platform oered by Amazon. An extensive list of customers for AWS include Dropbox, UniLever, Airbnb, Nasdaq, Netflix. As of 2007, there are more than 300K developers actively using AWS. It is one of the pioneers which brought the cloud computing closer to masses helping number of start...

78 FR 21906 - Six Rivers National Forest, California, Trinity Summit Range Assessment Environmental Impact...

Science.gov (United States)

2013-04-12

..., wilderness characteristics, water quality, soil productivity, and quality fish and wildlife habitat... DEPARTMENT OF AGRICULTURE Forest Service Six Rivers National Forest, California, Trinity Summit Range Assessment Environmental Impact Statement AGENCY: Forest Service, USDA. ACTION: Notice of Intent...

Remote Excavation of Heavily Contaminated UXO Sites. The Range Master

National Research Council Canada - National Science Library

Crandall, Alan L

2007-01-01

USA Environmental, Inc., and Timberline Environmental Services, Inc., developed the Range Master, a remote controlled scraper with an integrated power screen, to excavate and sift the top 12 inches of heavily contaminated UXO sites...

jORCA: easily integrating bioinformatics Web Services.

Science.gov (United States)

Martín-Requena, Victoria; Ríos, Javier; García, Maximiliano; Ramírez, Sergio; Trelles, Oswaldo

2010-02-15

Web services technology is becoming the option of choice to deploy bioinformatics tools that are universally available. One of the major strengths of this approach is that it supports machine-to-machine interoperability over a network. However, a weakness of this approach is that various Web Services differ in their definition and invocation protocols, as well as their communication and data formats-and this presents a barrier to service interoperability. jORCA is a desktop client aimed at facilitating seamless integration of Web Services. It does so by making a uniform representation of the different web resources, supporting scalable service discovery, and automatic composition of workflows. Usability is at the top of the jORCA agenda; thus it is a highly customizable and extensible application that accommodates a broad range of user skills featuring double-click invocation of services in conjunction with advanced execution-control, on the fly data standardization, extensibility of viewer plug-ins, drag-and-drop editing capabilities, plus a file-based browsing style and organization of favourite tools. The integration of bioinformatics Web Services is made easier to support a wider range of users. .

Service Users' Experiences of a Brief Intervention Service for Children and Adolescents: A Service Evaluation

Science.gov (United States)

Gallagher, Jen; Schlösser, Annette

2015-01-01

Ten per cent of young people experience mental health difficulties at any one time. Prevention and early intervention leads to better prognosis for young people's mental well-being in the short and long term. Child and Adolescent Mental Health Services (CAMHS) must be able to provide swift and effective interventions for a range of difficulties to…

78 FR 53005 - Proposed Data Collection; Comment Request: Community Development Financial Institutions Fund...

Science.gov (United States)

2013-08-27

...) reviewed or audited by an independent certified public accountant; (ii) Single Audit A-133 (if applicable... has been audited by an independent certified public accountant; (ii) an ILR (including the IRS... general public and other Federal agencies to take this opportunity to comment on continuing information...

Systematic review on the treatment of isolated local recurrence of pancreatic cancer after surgery; re-resection, chemoradiotherapy and SBRT

NARCIS (Netherlands)

Groot, Vincent P.; van Santvoort, Hjalmar C.; Rombouts, Steffi J. E.; Hagendoorn, Jeroen; Borel Rinkes, Inne H. M.; van Vulpen, Marco; Herman, Joseph M.; Wolfgang, Christopher L.; Besselink, Marc G.; Molenaar, I. Quintus

2017-01-01

The majority of patients who have undergone a pancreatic resection for pancreatic cancer develop disease recurrence within two years. In around 30% of these patients, isolated local recurrence (ILR) is found. The aim of this study was to systematically review treatment options for this subgroup of

Rhythm Control and Its Relation to Symptoms during the First Two Years after Radiofrequency Ablation for Atrial Fibrillation

DEFF Research Database (Denmark)

Björkenheim, Anna; Brandes, Axel; Chemnitz, Alexander

2016-01-01

the electrocardiogram (ECG), has an automatic AF detection algorithm, and has a possibility for patients to activate an ECG recording during symptoms. METHODS: Fifty-seven patients (mean age 57 ± 9 years, 60% male, 88% paroxysmal AF) underwent AF ablation following ILR implantation. Device data were downloaded...

Expression analysis of the Toll-like receptor and TIR domain adaptor families of zebrafish.

NARCIS (Netherlands)

Meijer, A.H.; Krens, SF Gabby; Rodriguez, IA Medina; He, S; Bitter, W.; Snaar-Jagalska, B Ewa; Spaink, H.P.

2004-01-01

The zebrafish genomic sequence database was analysed for the presence of genes encoding members of the Toll-like receptors (TLR) and interleukin receptors (IL-R) and associated adaptor proteins containing a TIR domain. The resulting predictions show the presence of one or more counterparts for the

On the Intermediate Line Region in AGNs

Energy Technology Data Exchange (ETDEWEB)

Adhikari, Tek P.; Różańska, Agata; Hryniewicz, Krzysztof [Nicolaus Copernicus Astronomical Center, Polish Academy of Sciences, Warsaw (Poland); Czerny, Bozena [Nicolaus Copernicus Astronomical Center, Polish Academy of Sciences, Warsaw (Poland); Center for Theoretical Physics, Polish Academy of Sciences, Warsaw (Poland); Ferland, Gary J., E-mail: tek@camk.edu.pl [Department of Physics and Astronomy, The University of Kentucky, Lexington, KY (United States)

2017-09-29

In this paper we explore the intermediate line region (ILR) by using the photoionisation simulations of the gas clouds present at different radial distances from the center, corresponding to the locations from BLR out to NLR in four types of AGNs. We let for the presence of dust whenever conditions allow for dust existence. All spectral shapes are taken from the recent multi-wavelength campaigns. The cloud density decreases with distance as a power law. We found that the slope of the power law density profile does not affect the line emissivity radial profiles of major emission lines: Hβ, He II, Mg II, C III, and O III. When the density of the cloud at the sublimation radius is as high as 10{sup 11.5} cm{sup −3}, the ILR should clearly be seen in the observations independently of the shape of the illuminating radiation. Moreover, our result is valid for low ionization nuclear emission regions of active galaxies.

Semantic Web Technologies for Mobile Context-Aware Services

National Research Council Canada - National Science Library

Sadeh, Norman M

2006-01-01

The emergence of Semantic Web Services and automated service discovery, access and composition functionality will enable higher levels of interoperability and automation across a broad range of contexts (e.g...

Collaborative Service Arrangements

DEFF Research Database (Denmark)

J. May, Peter; Winter, Søren

While much of prior research on collaboration addresses the service delivery network as a whole, we address collaborative relationships between one type of organization—municipal employment services—and a range of governmental and non-governmental partners for employment services in Denmark....... Municipalities differ in the type, degree, and character of collaboration with these partners. As others have found in prior research, we find that organizational benefits, trust, and a variety of contextual factors help shape the extent of collaboration. But, the relevance of these and problem-solving benefits...

Utilizing Context in Location-Aware Short-Range Wireless Communication

Directory of Open Access Journals (Sweden)

Vesa A. Korhonen

2010-01-01

Full Text Available We discuss how a short-range wireless communication service implemented for modern mobile communication devices can provide additional value for both the consumer and the service/product provider. When used as an information search tool, such systems allow services and products being promoted at the location they are available. For the customer, it may provide a “digitally augmented vision”, an enhanced view to the current environment. With data filtering and search rules, this may provide a self-manageable context, where the user's own personal environment and preferences to the features available in the current surroundings cooperate with a direct connection to the web-based social media. A preliminary design for such service is provided. The conclusion is that the method can generate additional revenue to the company and please the customers' buying process. In addition to the marketing, the principles described here are also applicable to other forms of human interaction.

Mapping Ecosystem Services: An Integrated Biophysical and Economic Evaluation

OpenAIRE

Hayha, T.

2014-01-01

Forests provide a wide range of ecosystem services, from timber and non-wood products (provisioning services) to carbon sequestration, hydrogeological protection (regulating services), and recreation and aesthetic experiences (cultural services). Nonmarketed forest ecosystem services tend to be undervalued due to the lack of a market price and a clear understanding of their vital support to socio-economic systems. Ecosystem services are interlinked, and therefore the optimization of one typol...

Orbit and clock determination of BDS regional navigation satellite system based on IGS M-GEX and WHU BETS tracking network

Science.gov (United States)

GENG, T.; Zhao, Q.; Shi, C.; Shum, C.; Guo, J.; Su, X.

2013-12-01

BeiDou Navigation Satellite System (BDS) began to provide the regional open service on December 27th 2012 and will provide the global open service by the end of 2020. Compared to GPS, the space segment of BDS Regional System consists of 5 Geostationary Earth Orbit satellites (GEO), 5 Inclined Geosynchronous Orbit satellites (IGSO) and 4 Medium Earth orbit (MEO) satellites. Since 2011, IGS Multiple-GNSS Experiment (M-GEX) focuses on tracking the newly available GNSS signals. This includes all signals from the modernized satellites of the GPS and GLONASS systems, as well as signals of the BDS, Galileo and QZSS systems. Up to now, BDS satellites are tracked by around 25 stations with a variety of different antennas and receivers from different GNSS manufacture communities in M-GEX network. Meanwhile, there are 17 stations with Unicore Communications Incorporation's GPS/BDS receivers in BeiDou Experimental Tracking Stations (BETS) network by Wuhan University. In addition, 5 BDS satellites have been tracking by the International Laser Ranging Service (ILRS). BDS performance is expected to be further studied by the GNSS communities. Following an introduction of the BDS system and above different tracking network, this paper discusses the achieved BDS characterization and performance assessment. Firstly, the BDS signal and measurement quality are analyzed with different antennas and receivers in detail compared to GPS. This includes depth of coverage for satellite observation, carrier-to-noise-density ratios, code noise and multipath, carrier phase errors. Secondly, BDS Precise Orbit Determination (POD) is processed. Different arc lengths and sets of orbit parameters are tested using Position And Navigation Data Analysis software (PANDA) which is developed at the Wuhan University. GEO, IGSO and MEO satellites orbit quality will be assessed using overlap comparison, 2-day orbit fit and external validations with Satellite Laser Range (SLR). Then BDS satellites are equipped

Providing Device Independence to Mobile Services

OpenAIRE

Nylander, Stina; Bylund, Markus

2002-01-01

People want user interfaces to services that are functional and well suited to the device they choose for access. To provide this, services must be able to offer device specific user interfaces for the wide range of devices available today. We propose to combine the two dominant approaches to platform independence, "Write Once, Run Every-where™" and "different version for each device", to create multiple device specific user interfaces for mobile services. This gives possibilities to minimize...

Logistics management in Universal Immunisation Programme.

Science.gov (United States)

Bachani, D; Bansal, R D

1990-01-01

The review of the National Immunization Programme of India in 1989 focused attention to the issue of storage and distribution of vaccines. Cold-chain equipment such as walk-in-coolers (WICs), deep freezers, ice-lined refrigerators (ILRs), and vaccine carriers proliferated after the introduction of the universal immunization program (UIP) but the available units fell short of the official targets in 1988, especially ILRs (7500 proposed and 2876 available) and vaccine carriers (250,000 proposed and 35,500 available). Some states had over 6 months of supplies of vaccines whose management posed problems of losing potency: oral polio virus (OPV) potency was acceptable in 63% of stock in 1988. Syringes, needles, stoves, pressure-cooker sterilizers, dial thermometers, and refrigerator repair kits were in short supply especially at the primary health care (PHC) level. Only 1/3 of subcenters had sterilizers and 58% had vaccines carriers. Logistics management on the state level required provision of vaccines based on previous use and eligible population with even distribution throughout the year. On the district level WICs were needed for every district with 1.5 million inhabitants. Recording of vaccine requirement, utilization, and storage would aid target allocations and avoid wastage. On the institutional and PHC level an ILR and a transporting vehicle was needed. The number of women and children eligible for immunization had to be calculated based on real population figures. Cold-chain capacity of 30,000-40,000 vials was required for a district as well as about 500 reusable syringes and needles a year along with vaccination cards exceeding the number of women and children by 10% for recordkeeping at the PHC center.

BOWS (bioinformatics open web services) to centralize bioinformatics tools in web services.

Science.gov (United States)

Velloso, Henrique; Vialle, Ricardo A; Ortega, J Miguel

2015-06-02

Bioinformaticians face a range of difficulties to get locally-installed tools running and producing results; they would greatly benefit from a system that could centralize most of the tools, using an easy interface for input and output. Web services, due to their universal nature and widely known interface, constitute a very good option to achieve this goal. Bioinformatics open web services (BOWS) is a system based on generic web services produced to allow programmatic access to applications running on high-performance computing (HPC) clusters. BOWS intermediates the access to registered tools by providing front-end and back-end web services. Programmers can install applications in HPC clusters in any programming language and use the back-end service to check for new jobs and their parameters, and then to send the results to BOWS. Programs running in simple computers consume the BOWS front-end service to submit new processes and read results. BOWS compiles Java clients, which encapsulate the front-end web service requisitions, and automatically creates a web page that disposes the registered applications and clients. Bioinformatics open web services registered applications can be accessed from virtually any programming language through web services, or using standard java clients. The back-end can run in HPC clusters, allowing bioinformaticians to remotely run high-processing demand applications directly from their machines.

[Health services research for the public health service (PHS) and the public health system].

Science.gov (United States)

Hollederer, A; Wildner, M

2015-03-01

There is a great need for health services research in the public health system and in the German public health service. However, the public health service is underrepresented in health services research in Germany. This has several structural, historical and disciplinary-related reasons. The public health service is characterised by a broad range of activities, high qualification requirements and changing framework conditions. The concept of health services research is similar to that of the public health service and public health system, because it includes the principles of multidisciplinarity, multiprofessionalism and daily routine orientation. This article focuses on a specified system theory based model of health services research for the public health system and public health service. The model is based on established models of the health services research and health system research, which are further developed according to specific requirements of the public health service. It provides a theoretical foundation for health services research on the macro-, meso- and microlevels in public health service and the public health system. Prospects for public health service are seen in the development from "old public health" to "new public health" as well as in the integration of health services research and health system research. There is a significant potential for development in a better linkage between university research and public health service as is the case for the "Pettenkofer School of Public Health Munich". © Georg Thieme Verlag KG Stuttgart · New York.

36 CFR 222.2 - Management of the range environment.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Management of the range environment. 222.2 Section 222.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... environment. (a) Allotments will be designated on the National Forest System and on other lands under Forest...

77 FR 35355 - User Fee Schedule for Trade Promotion Services

Science.gov (United States)

2012-06-13

...-XA17 User Fee Schedule for Trade Promotion Services AGENCY: U.S. & Foreign Commercial Service... promotion services under the current fee structure. ITA provides a wide range of trade promotion information... these more intensive trade promotion services. The fee revenue is expected to continue to contribute to...

Industrial services at CERN

CERN Multimedia

2002-01-01

The Bulletin looks at industrial services contracts and the real impact of the cost reductions at CERN. The level of industrial services contracts varies from one phase to another. For example, during the dismantling of LEP (photo) it rose substiantially to fall again at the end of dismantling. Industrial services contracts are an important resource for CERN. The level and nature of such contracts changes according to the phase of operation of the Laboratory. A construction phase, as for the LHC, requires a higher level of industrial services contracts compared with a period of normal running. During the operation of LEP, industrial services contracts were thus maintained at a level of 120 MCHF per year. The level rose to 156 MCHF in 2001 to include contracts awarded for dismantling LEP, and fell to about 144 MCHF in 2002 when the dismantling was complete. During the whole LHC construction period, up to 2007, industrial services spending will be stable in the range 135-140 MCHF per year. For the running pe...

Storage Manager and File Transfer Web Services

International Nuclear Information System (INIS)

William A Watson III; Ying Chen; Jie Chen; Walt Akers

2002-01-01

Web services are emerging as an interesting mechanism for a wide range of grid services, particularly those focused upon information services and control. When coupled with efficient data transfer services, they provide a powerful mechanism for building a flexible, open, extensible data grid for science applications. In this paper we present our prototype work on a Java Storage Resource Manager (JSRM) web service and a Java Reliable File Transfer (JRFT) web service. A java client (Grid File Manager) on top of JSRM and is developed to demonstrate the capabilities of these web services. The purpose of this work is to show the extent to which SOAP based web services are an appropriate direction for building a grid-wide data management system, and eventually grid-based portals

The energy services market in France

International Nuclear Information System (INIS)

2004-06-01

This study aims to answer the following questions: what is the french market value? What are its development perspectives? What services range is necessary? How increase the added value of proposed services? Which choice between the competence internalization and the subcontracting? What threat represent the providers on a market usually dominated by the energy suppliers and services providers? How will the french and european market combine? The following operators are studied (key data, energy services policy) by Eurostaf: Amec Spie, Cegelec, Dalkia, EDF, Elyo, Endesa Energia, Energie Rhone, GDF, RWE Solutions, Vinci Energies. (A.L.B.)

Conceptualizing urban household energy use: Climbing the 'Energy Services Ladder'

International Nuclear Information System (INIS)

Sovacool, Benjamin K.

2011-01-01

This article begins by defining energy services and identifying how they differ according to sector, urban and rural areas, and direct and indirect uses. It then investigates household energy services divided into three classes: lower income, middle income, and upper income. It finds that the primary energy technologies involved with low-income households involve a greater number of fuels and carriers, ranging from dung and fuelwood to liquefied petroleum gas and charcoal, but a fewer number of services. Middle-income households throughout the world tend to rely on electricity and natural gas, followed by coal, liquefied petroleum gas, and kerosene. These homes utilize energy to produce a much broader range services. The upper class or rich have access to the same energy fuels, carriers, and technologies as middle-income homes and families, but consume more energy (and more high luxury items). The study highlights how focusing on energy services reorients the direction of energy policy interventions, that energy services are neither uniform nor innate, and by noting exciting areas of potential research. - Research highlights: → The primary energy technologies involved with low-income households involve a greater number of fuels and carriers, ranging from dung and fuelwood to liquefied petroleum gas and charcoal, but a fewer number of services. → Middle-income households throughout the world tend to rely on electricity and natural gas, followed by coal, liquefied petroleum gas, and kerosene. These homes utilize energy to produce a much broader range services. → The upper class or rich have access to the same energy fuels, carriers, and technologies as middle-income homes and families, but consume more energy (and more high luxury items).

Factors promoting tourism services and their development

Directory of Open Access Journals (Sweden)

Simona Cristina Martin

2013-10-01

Because the fact that tourism services are intangible, sales through self-service are impossible, which makes indispensable the presence of the seller or counselor at the point of sale. Unable to clearly differentiate against competitors, tourist trips wholesalers will practice a more limited range of methods of sales promotion.

Improving Service Responses for People with Learning Disabilities Who Have Been Sexually Assaulted: An Audit of Forensic Services

Science.gov (United States)

Olsen, Angela; Majeed-Ariss, Rabiya; Teniola, Simonette; White, Catherine

2017-01-01

Background: People with learning disabilities are more likely to experience sexual abuse and less likely to access support than the general population, this is due to a range of variables at the individual, societal and service-delivery level. This study presents a service evaluation of St Mary's Sexual Assault Referral Centre, Manchester to…

Developing products and services for a deregulated market while regulated

International Nuclear Information System (INIS)

Haites, E.F.

1997-01-01

Products and services developed for a deregulated electric power industry were discussed. The wide-ranging discussion covered products created by unbundling existing services, new products and services related to energy use, products created by expansion into communications services, and the pricing of products and services. In addition to products and services, the discussion also covered strategies for a deregulated market and the challenges of raising equity capital in a regulated environment

The ecosystem services valuation tool and its future developments

OpenAIRE

Liekens, Inge; Broekx, Steven; Smeets, Nele; Staes, Jan; Biest, Van der, Katrien; Schaafsma, Marije; Nocker, De, Leo; Meire, Patrick; Cerulus, Tanya

2014-01-01

Abstract: Although methodologies for classification, quantification, and valuation of ecosystem services are improving drastically, applications of the ecosystem services concept in day-to-day decision-making processes remain limited, especially at the planning level. Nevertheless, spatial planning decisions would benefit from systematic considerations of their effects on ecosystem services. Assessing the impacts of policy on a wide range of ecosystem services contributes to more cost-effecti...

Vegetation and environmental features of forest and range ecosystems

Science.gov (United States)

George A. Garrison; Ardell J. Bjugstad; Don A. Duncan; Mont E. Lewis; Dixie R. Smith

1977-01-01

This publication describes the 34 ecosystems into which all the land of the 48 contiguous states has been classified in the Forest-Range Environmental Study (FRES) of the Forest Service, U.S. Department of Agriculture. The description of each ecosystem discusses physiography, climate, vegetation, fauna, soils, and land use. For a number of the ecosystems, the...

Northwest range-plant symbols adapted to automatic data processing.

Science.gov (United States)

George A. Garrison; Jon M. Skovlin

1960-01-01

Many range technicians, agronomists, foresters, biologists, and botanists of various educational institutions and government agencies in the Northwest have been using a four-letter symbol list or code compiled 12 years ago from records of plants collected by the U.S. Forest Service in Oregon and Washington, This code has served well as a means of entering plant names...

Managing bay and estuarine ecosystems for multiple services

Science.gov (United States)

Needles, Lisa A.; Lester, Sarah E.; Ambrose, Richard; Andren, Anders; Beyeler, Marc; Connor, Michael S.; Eckman, James E.; Costa-Pierce, Barry A.; Gaines, Steven D.; Lafferty, Kevin D.; Lenihan, Junter S.; Parrish, Julia; Peterson, Mark S.; Scaroni, Amy E.; Weis, Judith S.; Wendt, Dean E.

2013-01-01

Managers are moving from a model of managing individual sectors, human activities, or ecosystem services to an ecosystem-based management (EBM) approach which attempts to balance the range of services provided by ecosystems. Applying EBM is often difficult due to inherent tradeoffs in managing for different services. This challenge particularly holds for estuarine systems, which have been heavily altered in most regions and are often subject to intense management interventions. Estuarine managers can often choose among a range of management tactics to enhance a particular service; although some management actions will result in strong tradeoffs, others may enhance multiple services simultaneously. Management of estuarine ecosystems could be improved by distinguishing between optimal management actions for enhancing multiple services and those that have severe tradeoffs. This requires a framework that evaluates tradeoff scenarios and identifies management actions likely to benefit multiple services. We created a management action-services matrix as a first step towards assessing tradeoffs and providing managers with a decision support tool. We found that management actions that restored or enhanced natural vegetation (e.g., salt marsh and mangroves) and some shellfish (particularly oysters and oyster reef habitat) benefited multiple services. In contrast, management actions such as desalination, salt pond creation, sand mining, and large container shipping had large net negative effects on several of the other services considered in the matrix. Our framework provides resource managers a simple way to inform EBM decisions and can also be used as a first step in more sophisticated approaches that model service delivery.

Selling gas, selling services

International Nuclear Information System (INIS)

Moncel, V.

1999-01-01

Traditionally, the commercial activities of gas companies have been limited almost exclusively to the sale of gas. However, several socioeconomic factors specific to the gas industry, such as increasing customer expectations, competition between gas operators, a growing emphasis on services in many companies and the opening of public monopolies to competition, will bring inevitable change. Moreover, these developments coincide with imminent gas market opening. In response to the changing situation, the gas industry will seek to develop a range of multi-service offers, probably through external partnerships. (authors)

Stakeholder Expectations of Service Quality in a University Web Portal

Science.gov (United States)

Tate, Mary; Evermann, Joerg; Hope, Beverley; Barnes, Stuart

Online service quality is a much-studied concept. There is considerable evidence that user expectations and perceptions of self-service and online service quality differ in different business domains. In addition, the nature of online services is continually changing and universities have been at the forefront of this change, with university websites increasingly acting as a portal for a wide range of online transactions for a wide range of stakeholders. In this qualitative study, we conduct focus groups with a range of stakeholders in a university web portal. Our study offers a number of insights into the changing nature of the relationship between organisations and customers. New technologies are influencing customer expectations. Customers increasingly expect organisations to have integrated information systems, and to utilise new technologies such as SMS and web portals. Organisations can be slow to adopt a customer-centric viewpoint, and persist in providing interfaces that are inconsistent or require inside knowledge of organisational structures and processes. This has a negative effect on customer perceptions.

Heat and mass transfer in building services design

CERN Document Server

Moss, Keith

1998-01-01

Building design is increasingly geared towards low energy consumption. Understanding the fundamentals of heat transfer and the behaviour of air and water movements is more important than ever before. Heat and Mass Transfer in Building Services Design provides an essential underpinning knowledge for the technology subjects of space heating, water services, ventilation and air conditioning. This new text: *provides core understanding of heat transfer and fluid flow from a building services perspective *complements a range of courses in building services engineering *

Integrated services and maintenance in nuclear power plants

International Nuclear Information System (INIS)

Roos, Georg

2001-01-01

The general situation concerning services and nuclear power maintenance is reviewed following liberalization of Europa's power market. Issues relating to outsourcing maintenance services, effectiveness and reducing cost structure of maintenance are addressed on the cases of power markets in northern countries, Spain, Switzerland, Germany and Hungary. A special attention is paid on range of maintenance activity offered and performanced by Framatome. Ways of reducing costs in the field of maintenance as well as of reducing outage time are indicated. In conclusion, the following items are emphasized: - liberalization of Europe's power market in eastern Europe at its beginning; - in-house service in eastern Europe with numerous personnel; - Framatome ANP covers the entire range of maintenance competence; - consultance can be the first approach for a common co-operation

Investigating service features to sustain engagement in early intervention mental health services.

Science.gov (United States)

Becker, Mackenzie; Cunningham, Charles E; Christensen, Bruce K; Furimsky, Ivana; Rimas, Heather; Wilson, Fiona; Jeffs, Lisa; Madsen, Victoria; Bieling, Peter; Chen, Yvonne; Mielko, Stephanie; Zipursky, Robert B

2017-08-23

To understand what service features would sustain patient engagement in early intervention mental health treatment. Mental health patients, family members of individuals with mental illness and mental health professionals completed a survey consisting of 18 choice tasks that involved 14 different service attributes. Preferences were ascertained using importance and utility scores. Latent class analysis revealed segments characterized by distinct preferences. Simulations were carried out to estimate utilization of hypothetical clinical services. Overall, 333 patients and family members and 183 professionals (N = 516) participated. Respondents were distributed between a Professional segment (53%) and a Patient segment (47%) that differed in a number of their preferences including for appointment times, individual vs group sessions and mode of after-hours support. Members of both segments shared preferences for many of the service attributes including having crisis support available 24 h per day, having a choice of different treatment modalities, being offered help for substance use problems and having a focus on improving symptoms rather than functioning. Simulations predicted that 60% of the Patient segment thought patients would remain engaged with a Hospital service, while 69% of the Professional segment thought patients would be most likely to remain engaged with an E-Health service. Patients, family members and professionals shared a number of preferences about what service characteristics will optimize patient engagement in early intervention services but diverged on others. Providing effective crisis support as well as a range of treatment options should be prioritized in the future design of early intervention services. © 2017 John Wiley & Sons Australia, Ltd.

The benefits of Outsourcing facility services when selecting right service provider for a hotel:Case Kämp Group Oy

OpenAIRE

Paudyal, Manoj; Acharya, Saroj

2015-01-01

This research paper examines about the outsourcing of facility services in the Kämp group of hotels. The scope of the study includes Facility Management, outsourcing facilities services, and the selection process of the service providers for a hotel. The research was carried at the hotels of Kämp group Oy in the Metropolitan Area of Helsinki. Facility management includes wide ranges of non-core functions such as Property management, real estates, design and technology. Activities such as secu...

Whole-coal versus ash basis in coal geochemistry: a mathematical approach to consistent interpretations

Science.gov (United States)

Geboy, Nicholas J.; Engle, Mark A.; Hower, James C.

2013-01-01

Several standard methods require coal to be ashed prior to geochemical analysis. Researchers, however, are commonly interested in the compositional nature of the whole-coal, not its ash. Coal geochemical data for any given sample can, therefore, be reported in the ash basis on which it is analyzed or the whole-coal basis to which the ash basis data are back calculated. Basic univariate (mean, variance, distribution, etc.) and bivariate (correlation coefficients, etc.) measures of the same suite of samples can be very different depending which reporting basis the researcher uses. These differences are not real, but an artifact resulting from the compositional nature of most geochemical data. The technical term for this artifact is subcompositional incoherence. Since compositional data are forced to a constant sum, such as 100% or 1,000,000 ppm, they possess curvilinear properties which make the Euclidean principles on which most statistical tests rely inappropriate, leading to erroneous results. Applying the isometric logratio (ilr) transformation to compositional data allows them to be represented in Euclidean space and evaluated using traditional tests without fear of producing mathematically inconsistent results. When applied to coal geochemical data, the issues related to differences between the two reporting bases are resolved as demonstrated in this paper using major oxide and trace metal data from the Pennsylvanian-age Pond Creek coal of eastern Kentucky, USA. Following ilr transformation, univariate statistics, such as mean and variance, still differ between the ash basis and whole-coal basis, but in predictable and calculated manners. Further, the stability between two different components, a bivariate measure, is identical, regardless of the reporting basis. The application of ilr transformations addresses both the erroneous results of Euclidean-based measurements on compositional data as well as the inconsistencies observed on coal geochemical data

Predictors of Arrhythmic Events Detected by Implantable Loop Recorders in Renal Transplant Candidates

Energy Technology Data Exchange (ETDEWEB)

Silva, Rodrigo Tavares; Martinelli Filho, Martino, E-mail: martino@cardiol.br; Peixoto, Giselle de Lima; Lima, José Jayme Galvão de; Siqueira, Sérgio Freitas de; Costa, Roberto; Gowdak, Luís Henrique Wolff [Instituto do Coração do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo, São Paulo, SP (Brazil); Paula, Flávio Jota de [Unidade de Transplante Renal - Divisão de Urologia do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo, São Paulo, SP (Brazil); Kalil Filho, Roberto; Ramires, José Antônio Franchini [Instituto do Coração do Hospital das Clínicas da Faculdade de Medicina da Universidade de São Paulo, São Paulo, SP (Brazil)

2015-11-15

The recording of arrhythmic events (AE) in renal transplant candidates (RTCs) undergoing dialysis is limited by conventional electrocardiography. However, continuous cardiac rhythm monitoring seems to be more appropriate due to automatic detection of arrhythmia, but this method has not been used. We aimed to investigate the incidence and predictors of AE in RTCs using an implantable loop recorder (ILR). A prospective observational study conducted from June 2009 to January 2011 included 100 consecutive ambulatory RTCs who underwent ILR and were followed-up for at least 1 year. Multivariate logistic regression was applied to define predictors of AE. During a mean follow-up of 424 ± 127 days, AE could be detected in 98% of patients, and 92% had more than one type of arrhythmia, with most considered potentially not serious. Sustained atrial tachycardia and atrial fibrillation occurred in 7% and 13% of patients, respectively, and bradyarrhythmia and non-sustained or sustained ventricular tachycardia (VT) occurred in 25% and 57%, respectively. There were 18 deaths, of which 7 were sudden cardiac events: 3 bradyarrhythmias, 1 ventricular fibrillation, 1 myocardial infarction, and 2 undetermined. The presence of a long QTc (odds ratio [OR] = 7.28; 95% confidence interval [CI], 2.01–26.35; p = 0.002), and the duration of the PR interval (OR = 1.05; 95% CI, 1.02–1.08; p < 0.001) were independently associated with bradyarrhythmias. Left ventricular dilatation (LVD) was independently associated with non-sustained VT (OR = 2.83; 95% CI, 1.01–7.96; p = 0.041). In medium-term follow-up of RTCs, ILR helped detect a high incidence of AE, most of which did not have clinical relevance. The PR interval and presence of long QTc were predictive of bradyarrhythmias, whereas LVD was predictive of non-sustained VT.

Predictors of Arrhythmic Events Detected by Implantable Loop Recorders in Renal Transplant Candidates

Directory of Open Access Journals (Sweden)

Rodrigo Tavares Silva

2015-11-01

Full Text Available AbstractBackground:The recording of arrhythmic events (AE in renal transplant candidates (RTCs undergoing dialysis is limited by conventional electrocardiography. However, continuous cardiac rhythm monitoring seems to be more appropriate due to automatic detection of arrhythmia, but this method has not been used.Objective:We aimed to investigate the incidence and predictors of AE in RTCs using an implantable loop recorder (ILR.Methods:A prospective observational study conducted from June 2009 to January 2011 included 100 consecutive ambulatory RTCs who underwent ILR and were followed-up for at least 1 year. Multivariate logistic regression was applied to define predictors of AE.Results:During a mean follow-up of 424 ± 127 days, AE could be detected in 98% of patients, and 92% had more than one type of arrhythmia, with most considered potentially not serious. Sustained atrial tachycardia and atrial fibrillation occurred in 7% and 13% of patients, respectively, and bradyarrhythmia and non-sustained or sustained ventricular tachycardia (VT occurred in 25% and 57%, respectively. There were 18 deaths, of which 7 were sudden cardiac events: 3 bradyarrhythmias, 1 ventricular fibrillation, 1 myocardial infarction, and 2 undetermined. The presence of a long QTc (odds ratio [OR] = 7.28; 95% confidence interval [CI], 2.01–26.35; p = 0.002, and the duration of the PR interval (OR = 1.05; 95% CI, 1.02–1.08; p < 0.001 were independently associated with bradyarrhythmias. Left ventricular dilatation (LVD was independently associated with non-sustained VT (OR = 2.83; 95% CI, 1.01–7.96; p = 0.041.Conclusions:In medium-term follow-up of RTCs, ILR helped detect a high incidence of AE, most of which did not have clinical relevance. The PR interval and presence of long QTc were predictive of bradyarrhythmias, whereas LVD was predictive of non-sustained VT.

Predictors of Arrhythmic Events Detected by Implantable Loop Recorders in Renal Transplant Candidates

Science.gov (United States)

Silva, Rodrigo Tavares; Martinelli Filho, Martino; Peixoto, Giselle de Lima; de Lima, José Jayme Galvão; de Siqueira, Sérgio Freitas; Costa, Roberto; Gowdak, Luís Henrique Wolff; de Paula, Flávio Jota; Kalil Filho, Roberto; Ramires, José Antônio Franchini

2015-01-01

Background The recording of arrhythmic events (AE) in renal transplant candidates (RTCs) undergoing dialysis is limited by conventional electrocardiography. However, continuous cardiac rhythm monitoring seems to be more appropriate due to automatic detection of arrhythmia, but this method has not been used. Objective We aimed to investigate the incidence and predictors of AE in RTCs using an implantable loop recorder (ILR). Methods A prospective observational study conducted from June 2009 to January 2011 included 100 consecutive ambulatory RTCs who underwent ILR and were followed-up for at least 1 year. Multivariate logistic regression was applied to define predictors of AE. Results During a mean follow-up of 424 ± 127 days, AE could be detected in 98% of patients, and 92% had more than one type of arrhythmia, with most considered potentially not serious. Sustained atrial tachycardia and atrial fibrillation occurred in 7% and 13% of patients, respectively, and bradyarrhythmia and non-sustained or sustained ventricular tachycardia (VT) occurred in 25% and 57%, respectively. There were 18 deaths, of which 7 were sudden cardiac events: 3 bradyarrhythmias, 1 ventricular fibrillation, 1 myocardial infarction, and 2 undetermined. The presence of a long QTc (odds ratio [OR] = 7.28; 95% confidence interval [CI], 2.01–26.35; p = 0.002), and the duration of the PR interval (OR = 1.05; 95% CI, 1.02–1.08; p < 0.001) were independently associated with bradyarrhythmias. Left ventricular dilatation (LVD) was independently associated with non-sustained VT (OR = 2.83; 95% CI, 1.01–7.96; p = 0.041). Conclusions In medium-term follow-up of RTCs, ILR helped detect a high incidence of AE, most of which did not have clinical relevance. The PR interval and presence of long QTc were predictive of bradyarrhythmias, whereas LVD was predictive of non-sustained VT. PMID:26351983

26 CFR 1.167(l)-4 - Public utility property; election to use asset depreciation range system.

Science.gov (United States)

2010-04-01

... depreciation range system. 1.167(l)-4 Section 1.167(l)-4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Individuals and Corporations § 1.167(l)-4 Public utility property; election to use asset depreciation range system. (a) Application of section 167(l) to certain property subject to asset depreciation range system...

Personal genomics services: whose genomes?

Science.gov (United States)

Gurwitz, David; Bregman-Eschet, Yael

2009-07-01

New companies offering personal whole-genome information services over the internet are dynamic and highly visible players in the personal genomics field. For fees currently ranging from US$399 to US$2500 and a vial of saliva, individuals can now purchase online access to their individual genetic information regarding susceptibility to a range of chronic diseases and phenotypic traits based on a genome-wide SNP scan. Most of the companies offering such services are based in the United States, but their clients may come from nearly anywhere in the world. Although the scientific validity, clinical utility and potential future implications of such services are being hotly debated, several ethical and regulatory questions related to direct-to-consumer (DTC) marketing strategies of genetic tests have not yet received sufficient attention. For example, how can we minimize the risk of unauthorized third parties from submitting other people's DNA for testing? Another pressing question concerns the ownership of (genotypic and phenotypic) information, as well as the unclear legal status of customers regarding their own personal information. Current legislation in the US and Europe falls short of providing clear answers to these questions. Until the regulation of personal genomics services catches up with the technology, we call upon commercial providers to self-regulate and coordinate their activities to minimize potential risks to individual privacy. We also point out some specific steps, along the trustee model, that providers of DTC personal genomics services as well as regulators and policy makers could consider for addressing some of the concerns raised below.

The Service Pledge for Breast Cancer – Improving services through patient involvement

International Nuclear Information System (INIS)

Freeman, Shauna; Kester, Ross; Greenbrook, Sally; O’Connor, Ruairi; Rawlings, Sarah

2012-01-01

A guiding principle for today’s National Health Service is for services to reflect the needs and choices of patients and carers. There is evidence that meaningful patient involvement and engagement of people in their own care supports relationships with NHS professionals, and improves the quality and experience of healthcare. This paper reviews the Service Pledge for Breast Cancer, developed by the charity Breakthrough Breast Cancer as a tried and tested route to delivering effective patient involvement and examines some implications for radiotherapy services. The Service Pledge, which has benefitted an estimated 19,000 patients across the UK, is a tool that enables healthcare professionals and patients to work in partnership to improve local breast cancer services. Based on the results of a patient survey and in depth interviews to determine to what extent standards of care are being met at each participating hospital, improvement goals are identified helping turn the patient voice into constructive action. Improvement goals resulting from the Service Pledge range from small changes that make a real difference to patients, through to much larger changes to local breast services. To date, there has been limited involvement of radiotherapy staff in the Service Pledge, yet radiographers play an important role in the treatment of breast cancer as most patients will be offered radiotherapy. However, radiotherapy services have been criticised for not being patient -centred and for not providing enough information, psychological and emotional support before, during and after treatment. It is contended that radiographers are ideally placed to address many of these concerns and engage further with patients through projects such as the Service Pledge, empowering their patients to voice what is most important to them and driving the quality improvements that emerge.

THE DYNAMICAL RELATIONSHIP BETWEEN THE BAR AND SPIRAL PATTERNS OF NGC 1365

International Nuclear Information System (INIS)

Speights, Jason C.; Rooke, Paul C.

2016-01-01

Theories that attempt to explain the dynamical relationship between bar and spiral patterns in galactic disks make different predictions about the radial profile of the pattern speed. These are tested for the H-alpha bar and spiral patterns of NGC 1365. The radial profile of the pattern speed is measured by fitting mathematical models that are based on the Tremaine–Weinberg method. The results show convincing evidence for the bar rotating at a faster rate than the spiral pattern, inconsistent with a global wave mode or a manifold. There is evidence for mode coupling of the bar and spiral patterns at the overlap of corotation and inner Lindblad resonances (ILRs), but the evidence is unreliable and inconsistent. The results are the most consistent with the bar and spiral patterns being dynamically distinct features. The pattern speed of the bar begins near an ILR and ends near the corotation resonance (CR). The radial profile of the pattern speed beyond the bar most closely resembles what is expected for coupled spiral modes and tidal interactions.

Synthesis and biological activity of amino acid conjugates of abscisic acid.

Science.gov (United States)

Todoroki, Yasushi; Narita, Kenta; Muramatsu, Taku; Shimomura, Hajime; Ohnishi, Toshiyuki; Mizutani, Masaharu; Ueno, Kotomi; Hirai, Nobuhiro

2011-03-01

We prepared 19 amino acid conjugates of the plant hormone abscisic acid (ABA) and investigated their biological activity, enzymatic hydrolysis by a recombinant Arabidopsis amidohydrolases GST-ILR1 and GST-IAR3, and metabolic fate in rice seedlings. Different sets of ABA-amino acids induced ABA-like responses in different plants. Some ABA-amino acids, including some that were active in bioassays, were hydrolyzed by recombinant Arabidopsis GST-IAR3, although GST-ILR1 did not show hydrolysis activity for any of the ABA-amino acids. ABA-L-Ala, which was active in all the bioassays, an Arabidopsis seed germination, spinach seed germination, and rice seedling elongation assays, except in a lettuce seed germination assay and was hydrolyzed by GST-IAR3, was hydrolyzed to free ABA in rice seedlings. These findings suggest that some plant amidohydrolases hydrolyze some ABA-amino acid conjugates. Because our study indicates the possibility that different plants have hydrolyzing activity toward different ABA-amino acids, an ABA-amino acid may function as a species-selective pro-hormone of ABA. Copyright © 2011 Elsevier Ltd. All rights reserved.

Application of range-test in multiple linear regression analysis in ...

African Journals Online (AJOL)

Application of range-test in multiple linear regression analysis in the presence of outliers is studied in this paper. First, the plot of the explanatory variables (i.e. Administration, Social/Commercial, Economic services and Transfer) on the dependent variable (i.e. GDP) was done to identify the statistical trend over the years.

Experimental forests and ranges : 100 years of research success stories

Science.gov (United States)

Gail Wells; Deborah Hayes; Katrina Krause; Ann Bartuska; Susan LeVan-Green; Jim Anderson; Tivoli Gough; Mary Adams; Thomas Schuler; Randy Kolka; Steve Sebestyen; Laura Kenefic; John Brissette; Susan Stout; Keith Kanoti; Fred Swanson; Sarah Greene; Margaret Herring; Martin Ritchie; Carl Skinner; Tom Lisle; Elizabeth Keppeler; Leslie Reid; Peter Wohlegemuth; Stanley Kitchen; Ward McCaughey; Jim Guldin; Don Bragg; Michael Shelton; David Loftis; Cathryn Greenberg; Julia Murphy

2009-01-01

In 2008, Forest Service Research and Development celebrated the Centennial Anniversary of these Experimental Forests and Ranges. This publication celebrates the many scientists who over the course of decades conducted the long-term studies that began and are continuing to shed light on important natural resource issues. Story suggestions were solicited from the...

Effect of changing from the National Health and Nutritional Examination Survey III spirometry reference range to that of the Global Lung Initiative 2012 at Gold Coast Hospital and Health Service.

Science.gov (United States)

Embling, Laura A K; Zagami, Debbie; Sriram, Krishna Bajee; Gordon, Robert J; Sivakumaran, Pathmanathan

2016-12-01

The categorisation of lung disease into obstructive ventilatory defect (OVD) and tendency to a restrictive ventilatory defect (TRVD) patterns using spirometry is used to guide both prognostication and treatment. The effectiveness of categorisation depends upon having reference ranges that accurately represent the population they describe. The Global Lung Initiative 2012 (GLI 2012) has spirometry reference ranges drawn from the largest sample size to date. This study aimed to determine whether using spirometry reference ranges from the new GLI 2012 dataset, compared to the previously used National Health and Nutritional Examination Survey III (NHANES III) dataset, resulted in a change in diagnosis between OVD, TRVD and normal ventilatory pattern (NVP). Spirometry data were collected from 301 patients, aged 18-80 years, undergoing investigation at the Gold Coast Hospital and Health Service (GCHHS) throughout February and March 2014. OVD was defined as a forced expiratory volume in 1 second (FEV 1 ) divided by forced vital capacity (FVC) less than lower limit of normal (LLN). TRVD was defined as FEV 1 /FVC ≥ LLN, FEV 1 reference range resulted in a change in diagnosis of lung disease in 5.9% of the individuals included in this study. This variance in diagnosis when changing reference ranges should be taken into account by clinicians as it may affect patient management.

A network of experimental forests and ranges: Providing soil solutions for a changing world

Science.gov (United States)

Mary Beth. Adams

2010-01-01

The network of experimental forests and ranges of the USDA Forest Service represents significant opportunities to provide soil solutions to critical issues of a changing world. This network of 81 experimental forests and ranges encompasses broad geographic, biological, climatic and physical scales, and includes long-term data sets, and long-term experimental...

Service Quality Management in the ITS Telecommunications Systems

Directory of Open Access Journals (Sweden)

Tomas Zelinka

2013-12-01

Full Text Available Guaranteed selected quality of telecommunication service and wide area coverage are typical requirements of the ITS (Intelligent Transport Systems applications. Extensive range of wireless data services with reasonable coverage is provided by public wireless services operators, however, mostly no guaranteed relevant range of quality and security is available. ITS services require cost-effectively solution which can be resolved by combination of the "core" public solution with the other public as well as private services where and when it is needed. Such approach requires implementation of the relevant flexible system architecture supported by the efficient decision processes. ITS specific service security requirements would not underestimated, as well. Special situation is identified in case of the C2I (Car to Infrastructure and C2C (Car to Car communication namely if the vehicle on board unit is interconnected with the vehicle CAN (Controlled Area Network based network. Such configurations significantly increase potential of dangerous intruders´ attacks. Probability of the critical hazards appearances grows if the ITS data are accessible in the wide area networks. That is also the main reason why relevant telecommunications security support is understood as one of the crucial part of the ITS telecommunications solution.

A Review on Broker Based Cloud Service Model

Directory of Open Access Journals (Sweden)

Nagarajan Rajganesh

2016-09-01

Full Text Available Cloud computing emerged as a utility oriented computing that facilitates resource sharing under pay-as-you-go model. Nowadays, cloud offerings are not limited to range of services and anything can be shared as a service through the Internet. In this work, a detailed literature survey with respect to cloud service discovery and composition has been accounted. A proposed architecture with the inclusion of cloud broker is presented in our work. It focuses the importance of suitable service selection and its ranking towards fulfilling the customer’s service requirements. The proposed cloud broker advocates techniques such as reasoning and decision making capabilities for the improved cloud service selection and composition.

Quality of Security Service: Adaptive Security

National Research Council Canada - National Science Library

Levin, Timothy E; Irvine, Cynthia E; Spyropoulou, Evdoxia

2004-01-01

.... In this approach, the "level of service" must be within an acceptable range, and can indicate degrees of security with respect to various aspects of assurance, mechanistic strength, administrative diligence, etc...

Probing the nuclear and circumnuclear activity of NGC 1365 in the infrared

Science.gov (United States)

Alonso-Herrero, A.; Sánchez-Portal, M.; Ramos Almeida, C.; Pereira-Santaella, M.; Esquej, P.; García-Burillo, S.; Castillo, M.; González-Martín, O.; Levenson, N.; Hatziminaoglou, E.; Acosta-Pulido, J. A.; González-Serrano, J. I.; Pović, M.; Packham, C.; Pérez-García, A. M.

2012-09-01

We present new far-infrared (70-500 μm) Herschel Photodetector Array Camera and Spectrometer (PACS) and Spectral and Photometric Imaging Receiver (SPIRE) imaging observations as well as new mid-IR Gemini/Thermal-Region Camera Spectrograph imaging (8.7 and 18.3 μm) and spectroscopy of the inner Lindblad resonance (ILR) region (R Linares Senior Research Fellow.

Measuring the Adoption of DDoS Protection Services

NARCIS (Netherlands)

Jonker, Mattijs; Sperotto, Anna; van Rijswijk, Roland M.; Sadre, R.; Pras, Aiko

2016-01-01

Distributed Denial-of-Service (DDoS) attacks have steadily gained in popularity over the last decade, their intensity ranging from mere nuisance to severe. The increased number of attacks, combined with the loss of revenue for the targets, has given rise to a market for DDoS Protection Service (DPS)

Benefits of co-design in service design projects

NARCIS (Netherlands)

Steen, M.; Manschot, M.A.J.; De Koning, N.

2011-01-01

In many service design projects, co-design is seen as critical to success and a range of benefits are attributed to co-design. In this paper, we present an overview of benefits of co-design in service design projects, in order to help the people involved to articulate more precisely and

Benefits of Co-design in Service Design Projects

NARCIS (Netherlands)

Steen, M.G.D.; Manschot, M.; Koning, N. de

2011-01-01

In many service design projects, co-design is seen as critical to success and a range of benefits are attributed to co-design. In this paper, we present an overview of benefits of co-design in service design projects, in order to help the people involved to articulate more precisely and

A "client perspective" helps improve services.

Science.gov (United States)

1998-01-01

Egypt's Ministry of Health launched a campaign in 1992 to improve client satisfaction with family planning clinic services in the country. In the program, family planning clinic supervisors are being trained to use a checklist of 101 indicators to evaluate services, ranging from the availability of contraceptive commodities to the condition of facilities. Television messages and posters disseminated throughout communities instruct potential clients to look for gold stars on the doors of family planning clinics across the country, indicators of a clinic which meets quality service standards. This program is currently used by almost 4000 clinics nationwide. Family planning services worldwide have long focused upon increasing levels of contraceptive use. More recently, however, they are also focusing upon the quality of services provided. Frameworks for improving services tend to emphasize better ways to interact with clients, and often address how to approach specific management concerns, such as maintaining adequate contraceptive supplies. Client interaction, management concerns, and how quality makes a difference are discussed.

Critical services in the LHC computing

International Nuclear Information System (INIS)

Sciaba, A

2010-01-01

The LHC experiments (ALICE, ATLAS, CMS and LHCb) rely for the data acquisition, processing, distribution, analysis and simulation on complex computing systems, running using a variety of services, provided by the experiments, the Worldwide LHC Computing Grid and the different computing centres. These services range from the most basic (network, batch systems, file systems) to the mass storage services or the Grid information system, up to the different workload management systems, data catalogues and data transfer tools, often internally developed in the collaborations. In this contribution we review the status of the services most critical to the experiments by quantitatively measuring their readiness with respect to the start of the LHC operations. Shortcomings are identified and common recommendations are offered.

Empirical PPGIS/PGIS mapping of ecosystem services

DEFF Research Database (Denmark)

Brown, Gregory G; Fagerholm, Nora

2015-01-01

demonstrate high potential for the identification of ecosystem services, especially cultural services, there has been no review to evaluate the methods to identify best practice. Through examination of peer-reviewed, empirical PPGIS/PGIS studies, we describe the types of ecosystem services mapped, the spatial...... of experimental design and long-term case studies where the influence of mapped ecosystem services on land use decisions can be assessed....... mapping methods, the sampling approaches and range of participants, the types of spatial analyses performed, and the methodological trade-offs associated with each PPGIS/PGIS mapping approach. We found that multiple methods were implemented in nearly 30 case studies worldwide with the mapping of cultural...

The beginning of a new era - OTC's satellite business services

Science.gov (United States)

Bachmann, Erik

OTC has developed a new range of digital services which will provide business organizations in Australia with high quality private international telecommunications. This range will be known as Satnet and the paper deals with Satnet 2 which is the service offerings using medium-size earth stations (nominally 5- and 7-meter antenna apertures), installed at customers' premises. These services will rely on the Intelsat 6/4 GHz space segment. Operation will be totally digital and will be integrated with no distinction between individual applications such as voice, data, video, etc. Carrier capacities between 64 kb/s and 8.448 Mb/s can be provided and ISDN performance requirements can be supported. The paper describes key service features, systems design and transmission analysis. Consideration is also given to operation, installation and frequency coordination aspects.

Reduced pollinator service and elevated pollen limitation at the geographic range limit of an annual plant.

Science.gov (United States)

Moeller, David A; Geber, Monica A; Eckhart, Vincent M; Tiffin, Peter

2012-05-01

Mutualisms are well known to influence individual fitness and the population dynamics of partner species, but little is known about whether they influence species distributions and the location of geographic range limits. Here, we examine the contribution of plant-pollinator interactions to the geographic range limit of the California endemic plant Clarkia xantiana ssp. xantiana. We show that pollinator availability declined from the center to the margin of the geographic range consistently across four years of study. This decline in pollinator availability was caused to a greater extent by variation in the abundance of generalist rather than specialist bee pollinators. Climate data suggest that patterns of precipitation in the current and previous year drove variation in bee abundance because of its effects on cues for bee emergence in the current year and the abundance of floral resources in the previous year. Experimental floral manipulations showed that marginal populations had greater outcross pollen limitation of reproduction, in parallel with the decline in pollinator abundance. Although plants are self-compatible, we found no evidence that autonomous selfing contributes to reproduction, and thus no evidence that it alleviates outcross pollen limitation in marginal populations. Furthermore, we found no association between the distance to the range edge and selfing rate, as estimated from sequence and microsatellite variation, indicating that the mating system has not evolved in response to the pollination environment at the range periphery. Overall, our results suggest that dependence on pollinators for reproduction may be an important constraint limiting range expansion in this system.

Conceptualizing urban household energy use: Climbing the 'Energy Services Ladder'

Energy Technology Data Exchange (ETDEWEB)

Sovacool, Benjamin K., E-mail: bsovacool@nus.edu.s [Centre on Asia and Globalisation, Lee Kuan Yew School of Public Policy, National University of Singapore, 469C Bukit Timah Road, Singapore 259772 (Singapore)

2011-03-15

This article begins by defining energy services and identifying how they differ according to sector, urban and rural areas, and direct and indirect uses. It then investigates household energy services divided into three classes: lower income, middle income, and upper income. It finds that the primary energy technologies involved with low-income households involve a greater number of fuels and carriers, ranging from dung and fuelwood to liquefied petroleum gas and charcoal, but a fewer number of services. Middle-income households throughout the world tend to rely on electricity and natural gas, followed by coal, liquefied petroleum gas, and kerosene. These homes utilize energy to produce a much broader range services. The upper class or rich have access to the same energy fuels, carriers, and technologies as middle-income homes and families, but consume more energy (and more high luxury items). The study highlights how focusing on energy services reorients the direction of energy policy interventions, that energy services are neither uniform nor innate, and by noting exciting areas of potential research. - Research highlights: {yields} The primary energy technologies involved with low-income households involve a greater number of fuels and carriers, ranging from dung and fuelwood to liquefied petroleum gas and charcoal, but a fewer number of services. {yields} Middle-income households throughout the world tend to rely on electricity and natural gas, followed by coal, liquefied petroleum gas, and kerosene. These homes utilize energy to produce a much broader range services. {yields} The upper class or rich have access to the same energy fuels, carriers, and technologies as middle-income homes and families, but consume more energy (and more high luxury items).

Outdoor Long-Range WLANs : A Lesson for IEEE 802.11ah

NARCIS (Netherlands)

Aust, Stefan; Venkatesha Prasad, R.; Niemegeers, Ignas G M M

2015-01-01

Several service applications have been reported by many who proposed the use of wireless LANs (WLANs) over a wide variety of outdoor deployments. In particular, the upcoming IEEE 802.11ah WLAN protocol will enable a longer transmission range between WLAN access points (APs) and stations (STAs) up to

Foreword of Special Issue on “Nomadic Services and Applications”

OpenAIRE

Jason C. Hung

2011-01-01

Nomadic Service has emerged rapidly as an exciting new paradigm that offers a challenging model of cyber-physical services and poses fascinating problems regarding distributed resource management, ranging from information sharing to cooperative computing. This special issue is intended to foster state-of-the-art research in the area of nomadic services and related applications, cloud computing technologies and services, including the topics of collaboration environment, implementation and exe...

From NHS Choices to the integrated customer service platform.

Science.gov (United States)

Gann, Bob; Grant, Maria J

2013-03-01

In 2013 the NHS Commissioning Board launches its new integrated customer service platform. The new service utilises the full range of channels (web, telephone, apps etc) to provide access to information to support transparency, participation and transactions. Digital health services have proven benefits in informed choice, shared decision making and patient participation. © 2013 The authors. Health Information and Libraries Journal © 2013 Health Libraries Group.

The Economic Value of the Pollination Service, a Review Across Scales

NARCIS (Netherlands)

Hein, L.G.

2009-01-01

Pollination is an ecosystem service that is essential to support the production of a wide range of crops. The service is increasingly under threat, as a consequence of among others habitat loss of pollinators and increasing use of pesticides. In order to support maintaining the pollination service

Using EMBL-EBI Services via Web Interface and Programmatically via Web Services.

Science.gov (United States)

Lopez, Rodrigo; Cowley, Andrew; Li, Weizhong; McWilliam, Hamish

2014-12-12

The European Bioinformatics Institute (EMBL-EBI) provides access to a wide range of databases and analysis tools that are of key importance in bioinformatics. As well as providing Web interfaces to these resources, Web Services are available using SOAP and REST protocols that enable programmatic access to our resources and allow their integration into other applications and analytical workflows. This unit describes the various options available to a typical researcher or bioinformatician who wishes to use our resources via Web interface or programmatically via a range of programming languages. Copyright © 2014 John Wiley & Sons, Inc.

Introduction of Service Systems Implementation

Science.gov (United States)

Demirkan, Haluk; Spohrer, James C.; Krishna, Vikas

Services systems can range from an individual to a firm to an entire nation. They can also be nested and composed of other service systems. They are configurations of people, information, technology and organizations to co-create value between a service customer and a provider (Maglio et al. 2006; Spohrer et al. 2007). While these configurations can take many, potentially infinite, forms, they can be optimized for the subject service to eliminate unnecessary costs in the forms of redundancies, over allocation, etc. So what is an ideal configuration that a provider and a customer might strive to achieve? As much as it would be nice to have a formula for such configurations, experiences that are result of engagement, are very different for each value co-creation configurations. The variances and dynamism of customer provider engagements result in potentially infinite types and numbers of configurations in today's global economy.

Strategies for Designing and Developing Services for Manufacturing Firms

DEFF Research Database (Denmark)

Tan, Adrian Ronald; Matzen, Detlef; McAloone, Tim C.

2010-01-01

Product/service-systems (PSS) are in effect an approach to designing integrated products and services with a focus on both customer- and product life cycleactivities . Literature offers a range of service-oriented design strategies from product-oriented DfX approaches to more customer...... manufacturing companies may align their product and service development activities with their business strategies.......-oriented approaches such as integrated solutions and service design. These design strategies are mapped out in relation to how applicable they are to different types of services. Case studies from two industrial companies are used to confront the existing literature in order to improve understanding of how...

It takes two to tango? Understanding the co-production of public services by integrating the services management and public administration perspectives

OpenAIRE

S.P. Osborne; K. Strokosch

2013-01-01

We propose an important theoretical development for our understanding of the co-production of public services. It combines the insights from both public administration and services management theory to produce a novel typology of co-production. This clarifies its role at the operational and strategic levels, as well as its potential for transformational change in public services. Understanding co-production in this way provides a basis through which to explore a whole range of dimensions of c...

Customer exposure to gasoline vapors during refueling at service stations.

Science.gov (United States)

Hakkola, M A; Saarinen, L H

2000-09-01

Gasoline is a volatile complex mixture of hydrocarbon compounds that is easily vaporized during handling under normal conditions. Modern reformulated gasoline also contains oxygenates to enhance octane number and reduce ambient pollution. This study measured the difference in the exposure of customers to gasoline and oxygenate vapors during refueling in service stations with and without vapor recovery systems. Field measurements were carried out at two self-service stations. One was equipped with Stage I and the other with Stage II vapor recovery systems. At Stage I stations there is vapor recovery only during delivery from road tanker, and at Stage II stations additional vapor recovery during refueling. The exposure of 20 customers was measured at both stations by collecting air samples from their breathing zone into charcoal tubes during refueling with 95-octane reformulated gasoline. Each sample represented two consecutive refuelings. The samples were analyzed in the laboratory by gas chromatography using mass-selective detection for vapor components. The Raid vapor pressure of gasoline was 70 kPa and an oxygen content 2 wt%. Oxygenated gasoline contained 7 percent methyl tert-butyl ether (MtBE) and 5 percent methyl tert-amyl ether (MtAE). The geometric mean concentrations of hydrocarbons (C3-C11) in the customers' breathing zone was 85 mg/m3 (range 2.5-531 mg/m3) at the Stage I service station and 18 mg/m3 (range service station. The geometric mean of the exposure of customers to MtBE during refueling at the Stage I service station was 15.3 mg/m3 (range 1.8-74 mg/m3), and at the Stage II service station 3.4 mg/m3 (range 0.2-16 mg/m3). The differences in exposure were statistically significant (p station. The measurements were done on consecutive days at the various service stations. The temperature ranged from 10 to 17 degrees C, and wind velocity was 2-4 m/s. The climatic conditions were very similar on the measurement days. Based on this study it was found

Customer service in libraries best practices

CERN Document Server

Harmon, Charles

2013-01-01

In this book, nine librarians from across the country describe their libraries' best practices in this key area. Their contributions range from all-encompassing customer service policies and models any library can both adapt and be proud of to micro-approaches that emphasize offering excellent user-focused technology planning, picture book arrangement with patrons in mind, Web 2.0 tools to connect users with the library, establishing good service delivery chains, and making your library fantastic for homeschoolers.

Family inclusion in mental health services: Reality or rhetoric?

Science.gov (United States)

Martin, Robyn M; Ridley, Sophie C; Gillieatt, Sue J

2017-09-01

Contemporary mental health policies require family inclusion in the design, implementation and evaluation of services. This scoping review considers the factors in mental health practice which either mediate or promote family inclusion. A wide range of factors are reported to obstruct family inclusion, while a smaller number of studies report that meaningful family inclusion rests on a partnership approach which values the input of families and services users. When it comes to family inclusion, there is a gap between policy and service delivery practice. Changes in service delivery attitudes, values and culture are necessary to meaningfully and systematically include families and service users.

Thermo-optical vacuum testing of IRNSS laser retroreflector array qualification model

Science.gov (United States)

Porcelli, L.; Boni, A.; Ciocci, E.; Contessa, S.; Dell'Agnello, S.; Delle Monache, G.; Intaglietta, N.; Martini, M.; Mondaini, C.; Patrizi, G.; Salvatori, L.; Tibuzzi, M.; Lops, C.; Cantone, C.; Tuscano, P.; Maiello, M.; Venkateswaran, R.; Chakraborty, P.; Ramana Reddy, C. V.; Sriram, K. V.

2017-09-01

We describe the activities performed by SCF_Lab (Satellite/lunar/GNSS laser ranging/altimetry and cube/microsat Characterization Facilities Laboratory) of INFN-LNF for the thermo-optical vacuum testing activity of a IRNSS (Indian Regional Navigation Satellite System) LRA (Laser Retroreflector Array), under contract for ISRO-LEOS. To our knowledge, this is the first publication on the characterization of the optical performance of an LRA operating at about 36,000 km altitude (typical of regional GNSS segments, namely QZSS, COMPASS-G) executed in fully representative, carefully lab-simulated space conditions. In particular, this is the only such publication concerning IRNSS. Since laser ranging to its altitude is more challenging than to GNSS altitudes (from about 19,100 km for GLONASS to about 23,200 km for Galileo), comparative measurements were long awaited by ILRS (International Laser Ranging Service) and we present measurements of the absolute laser return to ground stations of the ILRS in terms of lidar OCS (Optical Cross Section) at the IRNSS relevant value of velocity aberration, in turn derived from measurements of the full FFDP (Far Field Diffraction Pattern) over a very large range of velocity aberrations. These measurements were acquired: (i) on a full-size qualification model of a IRNSS CCR (Cube Corner Retroreflector) LRA that ISRO-LEOS provided to INFN-LNF; (ii) during the lab-simulation of a 1/4 orbit segment, in which the LRA CCRs are exposed to the perturbation of the sun heat at varying angles, from grazing incidence (90° with respect to the direction perpendicular to the plane of array), up to the perpendicular to the LRA, with a same time variation consistent with the actual space orbit. In this 1/4 orbit condition, the LRA experiences potentially large thermal degradations of the OCS, depending on the detailed thermal and mechanical design of the LRA. Since all GNSS constellations have different LRA designs or configurations, this is another

Reliable Multicast MAC Protocol for IEEE 802.11 Wireless LANs with Extended Service Range

Science.gov (United States)

Choi, Woo-Yong

2011-11-01

In this paper, we propose the efficient reliable multicast MAC protocol by which the AP (Access Point) can transmit reliably its multicast data frames to the recipients in the AP's one-hop or two-hop transmission range. The AP uses the STAs (Stations) that are directly associated with itself as the relays for the data delivery to the remote recipients that cannot be reached directly from itself. Based on the connectivity information among the recipients, the reliable multicast MAC protocol optimizes the number of the RAK (Request for ACK) frame transmissions in a reasonable computational time. Numerical examples show that our proposed MAC protocol significantly enhances the MAC performance compared with the BMMM (Batch Mode Multicast MAC) protocol that is extended to support the recipients that are in the AP's one-hop or two-hop transmission range in IEEE 802.11 wireless LANs.

Education Technology Services at Indiana University: A Case Study.

Science.gov (United States)

Bichelmeyer, B. A.; Hara, Noriko; Yi, Jessi; Dennen, Vanessa; Avers, Dale; Tzeng, Jeng-Yi

1998-01-01

This paper, based on a qualitative research study, describes the technology resources available in the Indiana University School of Education, explains the range of services provided by Education Technology Services (ETS), documents the organizational structure of ETS, and describes the key processes and culture of ETS. (Author/AEF)

Pediatric Oncology Branch - Support Services | Center for Cancer Research

Science.gov (United States)

Support Services As part of the comprehensive care provided at the NCI Pediatric Oncology Branch, we provide a wide range of services to address the social, psychological, emotional, and practical facets of pediatric cancer and to support patients and families while they are enrolled in clinical research protocols.

Serving the food nation: Exploring Body Mass Index in food service workers.

Science.gov (United States)

Woodhall-Melnik, Julia; Cooke, Martin; Bigelow, Philip L

2015-01-01

Obesity is a public health concern in North America. Consumption of food prepared outside of the home is often discussed as a contributing factor. To determine whether or not Canadian food service workers are more likely to have high Body Mass Indices (BMIs) as compared with the general population, and to examine factors that contribute to BMI in this population. Analyses of secondary survey data from Cycle 5.1 of the Canadian Community Health Survey were performed. Descriptive statistics were generated to examine food service workers' risk of having above normal BMI compared to other Canadians. Logistic regression analysis was used to identify factors contributing to variation in BMI among food service workers. Analyses were stratified by age. Canadian food service workers are less likely to have BMIs in the overweight and obese ranges than the general population. Stratification by age demonstrated that this decreased risk can be attributed to the fact that food service workers tend to be younger than the general population. As age increases among food service workers, the odds of having a BMI in the overweight and obese ranges increases. Food service workers in general were not at higher risk for high BMI, but those between the ages of 41 and 64 are at higher risk of having a BMI in the overweight or obese ranges. The findings suggest that proximity to food service outlets may not be the most salient factor in explaining BMI.

An agency theory perspective on the purchase of marketing services

NARCIS (Netherlands)

Tate, W.L.; Ellram, L.M.; Bals, L.; Hartmann, E.; Valk, van der W.

2010-01-01

The purchase of business services has become an important part of organizations' acquisition of external resources, and is therefore receiving growing scholarly attention. The supply management function is increasingly supporting more complex service purchases, including a wide range of marketing

A century of avian research on USFS Experimental Forests and Ranges: Introduction to the special section on long-term avian research on Experimental Forests and Ranges

Science.gov (United States)

Monica Tomosy; Scott H. Stoleson; David I. King

2011-01-01

In August of 2009 a symposium was convened at the 127th Stated Meeting of the American Ornithologist's Union in Philadelphia, Pennsylvania to commemorate the 100th anniversary of the nationwide system of Experimental Forests and Ranges (EFRs) established by the US Forest Service in 1909. Fifteen scientists from across the United States and the Caribbean gathered...

QoS Predictability of Internet Services

Science.gov (United States)

Bilski, Tomasz

The paper presents problems of QoS (Quality of Service) predictability of network services (mainly in WAN environment). In the first part we present general remarks on QoS predictability problem, mentioning some research projects and available resources. The main part of the paper deals with QoS predictability in long-term as well as short-term viewpoints. We will try to answer a question: is it possible to predict network QoS/performance level with a use of statistical data from the past? The term quality of service has many meanings ranging from the user's qualitative perception of the service to a set of quantitative connection parameters (RTT (Round Trip Time), throughput, loss packet rate) necessary to achieve particular service quality. In the paper we will mostly use the second meaning of the term based on RFC 2386 [1]. Analyzed, statistical data on Internet performance are taken from the IEPM (Internet End-to-end Performance Measurement) database.

Maternity Care Services Provided by Family Physicians in Rural Hospitals.

Science.gov (United States)

Young, Richard A

The purpose of this study was to describe how many rural family physicians (FPs) and other types of providers currently provide maternity care services, and the requirements to obtain privileges. Chief executive officers of rural hospitals were purposively sampled in 15 geographically diverse states with significant rural areas in 2013 to 2014. Questions were asked about the provision of maternity care services, the physicians who perform them, and qualifications required to obtain maternity care privileges. Analysis used descriptive statistics, with comparisons between the states, community rurality, and hospital size. The overall response rate was 51.2% (437/854). Among all identified hospitals, 44.9% provided maternity care services, which varied considerably by state (range, 17-83%; P maternity care, a mean of 271 babies were delivered per year, 27% by cesarean delivery. A mean of 7.0 FPs had privileges in these hospitals, of which 2.8 provided maternity care and 1.8 performed cesarean deliveries. The percentage of FPs who provide maternity care (mean, 48%; range, 10-69%; P maternity care who are FPs (mean, 63%; range, 10-88%; P maternity care services in US rural hospitals, including cesarean deliveries. Some family medicine residencies should continue to train their residents to provide these services to keep replenishing this valuable workforce. © Copyright 2017 by the American Board of Family Medicine.

Quinolinemethanol Antimalarials.

Science.gov (United States)

1974-12-01

Yield of pure iaterinl froto a mi’xt of 5c and Se. *Yield froin the acid 7d. ,Yield front life ester 8d. r Anal, were wit hin ± t. fojr C, 11, N Ilr...DA-49-193-MD-2955 F 9. PERFORMING ORGANIZATION NAME AND ADDRESS 10. PROGRAM ELEMENT. PROJECT, TASK Uiversity of Virginia, Chemistry Dept. AREA & WORK

76 FR 50425 - Service Rules and Policies for the Broadcasting Satellite Service (BSS)

Science.gov (United States)

2011-08-15

... video-on-demand, to consumers in the United States and promote increased competition among satellite and... innovative services, including video, audio, data, and video-on-demand, to consumers in the United States and... variation is 26.3 km. Thus, the measurement range of 30[deg] from the X axis in the X-Z plane proposed by...

The Climate Services Partnership (CSP): Working Together to Improve Climate Services Worldwide

Science.gov (United States)

Zebiak, S.; Brasseur, G.; Members of the CSP Coordinating Group

2012-04-01

Throughout the world, climate services are required to address urgent needs for climate-informed decision-making, policy and planning. These needs were explored in detail at the first International Conference on Climate Services (ICCS), held in New York in October 2011. After lengthy discussions of needs and capabilities, the conference culminated in the creation of the Climate Services Partnership (CSP). The CSP is an informal interdisciplinary network of climate information users, providers, donors and researchers interested in improving the provision and development of climate services worldwide. Members of the Climate Services Partnership work together to share knowledge, accelerate learning, develop new capacities, and establish good practices. These collaborative efforts will inform and support the evolution and implementation of the Global Framework for Climate Services. The Climate Services Partnership focuses its efforts on three levels. These include: 1. encouraging and sustaining connections between climate information providers, users, donors, and researchers 2. gathering, synthesizing and disseminating current knowledge on climate services by way of an online knowledge management platform 3. generating new knowledge on critical topics in climate service development and provision, through the creation of focused working groups on specific topics To date, the Climate Services Partnership has made progress on all three fronts. Connections have been fostered through outreach at major international conferences and professional societies. The CSP also maintains a website and a monthly newsletter, which serves as a resource for those interested in climate services. The second International Conference on Climate Services (ICCS2) will be held in Berlin in September. The CSP has also created a knowledge capture system that gathers and disseminates a wide range of information related to the development and provision of climate services. This includes an online

Property and Business Services. Industry Training Monograph No. 12.

Science.gov (United States)

Dumbrell, Tom

Australia's property and business services industry is its third largest industry and has been the fastest growing industry over the last 10 years. The industry is composed of a diverse range of activities, including real estate sales, legal and accountancy practices, employment placement services, labor and equipment hire, scientific and market…

A multipurpose radiation service center

International Nuclear Information System (INIS)

Hofmann, E.-G.

1977-01-01

In Germany, AEG-Telefunken has been working as a supplier of irradiation equipment for more than ten years. There is a close cooperation with Radiation Dynamics Inc., Westbury, N.Y. Radiation sources are available for most industrial applications. As a special service AEG is establishing a multipurpose radiation service center in Hamburg-Wedel, Germany. This center will be used by a host of companies to investigate the effects of radiation on a broad range of materials, to develop special processing equipment, to process customer supplied products and to perform R and D work and contracts. Initially this service center will be equipped with one research type High-Power X-ray Unit (200 kV/32 mA) and one industrial type Dynamitron accelerator (1500 kV/37.5 kW). (author)

Australian clinical dosimetry service at ARPANSA

International Nuclear Information System (INIS)

McDonald, Abel; Williams, Ivan

2010-01-01

Full text: Earlier this year, the Australian Health Ministers' Advisory Council accepted the Federal Government's offer to fund the establishment and operation for 3 years of an Australian Clinical Dosimetry Service (ACDS). The service will be located within the Australian Radiation Protection and Nuclear Safety Agency in Yallambie, Victoria and will commence operation at the beginning of 20II. The purpose of the ACDS is to make available independent checks and auditing services to all Australian radiotherapy services. These services will range form postal audits to site visits, and include treatment dose assessments using phantoms (Level III audits). There will be a Clinical Advisory Group to oversee the development of the service, so the ACPSEM and other professional groups will playa key role in developing the ACDS. In consultation with radiotherapy facilities, the ACDS will establish an Audit Panel which will be made up of local staff to assist with on site work and minimise travel costs. The results of all measurements made by the ACDS will be confi dential: only de-identified data would be publicly reported. The service will be free to participating facilities in the first 3 years. An independent review will be conducted in the third year to determine the ongoing arrangements for the service.

Strategies for Designing and Developing Services for Manufacturing Firms

DEFF Research Database (Denmark)

Tan, Adrian; Matzen, Detlef; McAloone, Tim C.

2009-01-01

Product/service-systems (PSS) are in effect an approach to designing integrated products and services with a focus on both customer activities and product life cycle considerations. Literature offers a range of serviceoriented design strategies from product-oriented DfX approaches to more customer......-oriented approaches such as integrated solutions and service design. These design strategies are mapped out in relation to how applicable they are to different types of services. Case studies from two industrial companies are used to confront the existing literature in order to begin to understand how manufacturing...... companies may align their business strategies with their product and service development activities....

CITY HOTSPOT: LINKAGES BETWEEN ECOSYSTEM SERVICES AND BIODIVERSITY OF URBAN GREEN AREAS

Directory of Open Access Journals (Sweden)

Špela Železnikar

2017-01-01

Full Text Available Green areas in cities and their ecosystem services (ES offer residents various benefits. The range of services depends on biodiversity of a green space. The aim was to determine the relationship between biodiversity in different categories of green areas in the city and the ecosystem services, which appear in it. We made 108 relevés in the autumn and spring time, within nine categories of green areas in the Municipality of Ljubljana. In each category the range of ES was assessed based on field analysis and compared with literature assessed ecosystem services. Results showed that the category of forests differ from others. Other categories were similar to each other, in particular grassland categories. Also, a positive relationship linkage was found - more plant species mean more assessed ecosystem services in a specific green infrastructure category.

Governing Forests for Provisioning Services: The Example of Honey Production in Southwest Ethiopia

NARCIS (Netherlands)

Wiersum, F.; Endalamaw, T.B.

2013-01-01

Provisioning services are major environmental services provided by forests. Especially in tropical countries, the livelihoods of local people often partly depend on a range of timber and non-timber forest products. The governance arrangements concerning such locally valued environmental services are

NASA policy on pricing shuttle launch services

Science.gov (United States)

Smith, J. M.

1977-01-01

The paper explains the rationale behind key elements of the pricing policy for STS, the major features of the non-government user policy, and some of the stimulating features of the policy which will open space to a wide range of new users. Attention is given to such major policy features as payment schedule, cost and standard services, the two phase pricing structure, optional services, shared flights, cancellation and postponement, and earnest money.

Sharing Service Resource Information for Application Integration in a Virtual Enterprise - Modeling the Communication Protocol for Exchanging Service Resource Information

Science.gov (United States)

Yamada, Hiroshi; Kawaguchi, Akira

Grid computing and web service technologies enable us to use networked resources in a coordinated manner. An integrated service is made of individual services running on coordinated resources. In order to achieve such coordinated services autonomously, the initiator of a coordinated service needs to know detailed service resource information. This information ranges from static attributes like the IP address of the application server to highly dynamic ones like the CPU load. The most famous wide-area service discovery mechanism based on names is DNS. Its hierarchical tree organization and caching methods take advantage of the static information managed. However, in order to integrate business applications in a virtual enterprise, we need a discovery mechanism to search for the optimal resources based on the given a set of criteria (search keys). In this paper, we propose a communication protocol for exchanging service resource information among wide-area systems. We introduce the concept of the service domain that consists of service providers managed under the same management policy. This concept of the service domain is similar to that for autonomous systems (ASs). In each service domain, the service information provider manages the service resource information of service providers that exist in this service domain. The service resource information provider exchanges this information with other service resource information providers that belong to the different service domains. We also verified the protocol's behavior and effectiveness using a simulation model developed for proposed protocol.

A novel x-ray circularly polarized ranging method

Science.gov (United States)

Song, Shi-Bin; Xu, Lu-Ping; Zhang, Hua; Gao, Na; Shen, Yang-He

2015-05-01

Range measurement has found multiple applications in deep space missions. With more and further deep space exploration activities happening now and in the future, the requirement for range measurement has risen. In view of the future ranging requirement, a novel x-ray polarized ranging method based on the circular polarization modulation is proposed, termed as x-ray circularly polarized ranging (XCPolR). XCPolR utilizes the circular polarization modulation to process x-ray signals and the ranging information is conveyed by the circular polarization states. As the circular polarization states present good stability in space propagation and x-ray detectors have light weight and low power consumption, XCPolR shows great potential in the long-distance range measurement and provides an option for future deep space ranging. In this paper, we present a detailed illustration of XCPolR. Firstly, the structure of the polarized ranging system is described and the signal models in the ranging process are established mathematically. Then, the main factors that affect the ranging accuracy, including the Doppler effect, the differential demodulation, and the correlation error, are analyzed theoretically. Finally, numerical simulation is carried out to evaluate the performance of XCPolR. Projects supported by the National Natural Science Foundation of China (Grant Nos. 61172138 and 61401340), the Natural Science Basic Research Plan in Shaanxi Province of China (Grant No. 2013JQ8040), the Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20130203120004), the Open Research Fund of the Academy of Satellite Application, China (Grant No. 2014 CXJJ-DH 12), the Xi’an Science and Technology Plan, China (Grant No. CXY1350(4)), the Fundamental Research Funds for the Central Universities, China (Grant Nos. 201413B, 201412B, and JB141303), and the Open Fund of Key Laboratory of Precision Navigation and Timing Technology, National Time Service Center, Chinese

Radiographer managers and service development: A Delphi study to determine an MRI service portfolio for year 2020

International Nuclear Information System (INIS)

Castillo, J.; Caruana, C.J.; Morgan, P.S.; Westbrook, C.

2015-01-01

Purpose: As high quality CPD courses become increasingly expensive and time off for radiographers progressively limited, it is important that CPD content be aligned to forecasted service portfolio development. When such a portfolio has not been developed locally the CPD planner should carry out an own forecasting exercise. The purpose of the study was to develop a 2020 MRI service portfolio using a Delphi study. Methods and materials: MRI stakeholder experts participated in a first Delphi round based on semi-structured interviews. The interviews were analysed thematically leading to a series of statements for a second Delphi round. Level of agreement was assessed as the median value on a 6 point Likert scale ranging from 1 (complete disagreement) to 6 (complete agreement), the level of consensus was assessed using the interquartile range (IQR). Consensus was defined as IQR ≤ 1. Results: Very strong agreement and consensus (median 6, IQR ≤ 1) was obtained for maintaining current service catalogue and introduction of breast biopsies, cardiac studies, ISO standards, referral guidelines, and departmental policies aligned to EU regulations. Strong agreement and consensus (median 5, IQR ≤ 1) was obtained for introduction of tumour assessment, tractography, elastography, enterography. The level of consensus was low (IQR ≥ 1) regarding research, 3T MRI, outsourcing, prostate screening and certification for MRI referral privileges. Conclusion: The multi stakeholder approach adopted ensured that the proposed service portfolio would be suitable for local healthcare needs. Although the methodology has been applied to MRI it could easily be adapted to any imaging modality. - Highlights: • A Delphi study was successfully used to forecast MRI service portfolio for year 2020. • The service portfolio determines the competences required by radiographers. • The service portfolio has helped in decision making to introduce waiting list initiatives. • Protocols

Ranging behavior relates to welfare indicators pre- and post-range access in commercial free-range broilers.

Science.gov (United States)

Taylor, Peta S; Hemsworth, Paul H; Groves, Peter J; Gebhardt-Henrich, Sabine G; Rault, Jean-Loup

2018-06-01

Little is known about the effect of accessing an outdoor range on chicken welfare. We tracked individual ranging behavior of 538 mixed-sex Ross 308 chickens on a commercial farm across 4 flocks in winter and summer. Before range access, at 17 to 19 d of age, and post-range access, at 30 to 33 and 42 to 46 d of age in winter and summer flocks respectively, welfare indicators were measured on chickens (pre-range: winter N = 292; summer N = 280; post-range: winter N = 131; summer N = 140), including weight, gait score, dermatitis and plumage condition. Post-ranging autopsies were performed (winter: N = 170; summer: N = 60) to assess breast burn, leg health, and ascites. Fewer chickens accessed the range in winter flocks (32.5%) than summer flocks (82.1%). Few relationships between welfare and ranging were identified in winter, likely due to minimal ranging and the earlier age of post-ranging data collection compared to summer flocks. In summer flocks prior to range access, chickens that accessed the range weighed 4.9% less (P = 0.03) than chickens that did not access the range. Pre-ranging weight, gait score, and overall plumage cover predicted the amount of range use by ranging chickens in summer flocks (P ranging behavior. In summer flocks post-range access, ranging chickens weighed 12.8% less than non-ranging chickens (P range visits were associated with lower weight (P range was associated with lower weight (P range in summer is partly related to changes in broiler chicken welfare. Further investigations are required to determine causation.

Tennessee Army National Guard (TNARNG) Range Expansion at Arnold Air Force Base, Tennessee. Environmental Assessment

Science.gov (United States)

2012-11-01

Ecological Services Field Office for the U.S. Fish and Wildlife Service (USFWS). The Tennessee Historical Commission, State Historic Preservation Office...Alternate) 12 SEAVAN sites Prefabricated – no new construction required CACTF (Primary) Road network 0 1,800 n/a n/a Gravel pads for pre-fab...management to prevent undesirable ecosystem changes. Recognizing the ecological NOVEMBER 2012 | EA_2013_TNARNG_Range_Expansion Page 3-6 and economic

Final Environmental Assessment for Proposed Multi-Purpose Machine Gun Range at Joint Base McGuire-Dix-Lakehurst (JB MDL), New Jersey

Science.gov (United States)

2015-09-01

the Preferred Alternative location. Sanitary services would be provided through the use of portable, contractor-serviced toilets. Under the Preferred... Sanitary services would be provided through the use of portable, contractor-serviced toilets. Under the Competing Build Alternative, the existing MPMGR...February 2013. MDEP 2009 MDEP. 2009. Assessment of Ecological Risk Associated with Lead Shot at Trap, Skeet, & Sporting Clay Ranges. Massachusetts

The parental attitudes toward psychological services inventory: adaptation and development of an attitude scale.

Science.gov (United States)

Turner, Erlanger A

2012-08-01

The purpose of this paper is to provide psychometric data on the Parental Attitudes Toward Psychological Services Inventory (PATPSI), which is a revised measure to assess parents' attitudes toward outpatient mental health services. Using a sample of adults (N = 250), Study 1 supported a 3-factor structure (RMSEA = .05, NNFI = .94, and CFI = .94), adequate internal consistency (ranging from .72 to .92), and test-retest reliability (ranging from .66 to .84). Additionally, results indicated that individuals with previous use of mental health services reported more positive views toward child mental health services. Study 2 provided confirming evidence of the 3-factor structure (NNFI = .94, RMSEA = .08, and the CFI = .95) and adequate reliability (ranging from .70 to .90) using a parent-sample (N = 260). Additionally, discriminate validity of the PATPSI was supported. Implications for research and clinical practice are discussed.

Taking family planning services to hard-to-reach populations.

Science.gov (United States)

Donovan, P

1996-01-01

Interviews were conducted in 1995 among 100 US family planning program personnel who serve hard-to-reach populations, such as drug abusers, prisoners, the disabled, homeless persons, and non-English speaking minorities. Findings indicate that a range of services is available for hard-to-reach groups. Most family planning agencies focus on drug abusers because of the severity of HIV infections and the availability of funding. This article describes the activities of various agencies in Michigan, Pennsylvania, and Massachusetts that serve substance abuse centers with family planning services. One recommendation for a service provider is to present services in an environment where it is safe to talk about a person's needs. One other program offered personal greetings upon arrival and the continuity of having a familiar face to oversee all reproductive and health needs. Programs for prisoners ranged from basic sex education classes to comprehensive reproductive health care. Some prisons offered individual counseling. Some programs were presented in juvenile offender facilities. Outreach to the homeless involved services at homeless shelters, outreach workers who recruited women into traditional family planning clinics, and establishment of nontraditional sites for the homeless and other hard-to-reach persons. One provider's suggestion was to offer services where high-risk women already go for other services. Most services to the disabled target the developmentally disabled rather than the physically disabled. Experience has shown that many professionals working with the disabled do not recognize their clients' sexual needs. Other hard-to-reach groups include women in housing projects and shelters for battered women, welfare applicants, and sex workers. Key to service provision is creating trust, overcoming language and cultural differences, and subsidizing the cost of care.

Promotion of family planning services in practice leaflets.

Science.gov (United States)

Marshall, M N; Gray, D J; Pearson, V; Phillips, D R; Owen, M

1994-10-08

Providing 75% of family planning services in the United Kingdom, general practitioners are required to produce leaflets which describe the contraceptive services they provide. The authors analyzed information about family planning provided to clients through practice leaflets. 88% of practice leaflets from the 198 practices in Devon were available from the Devon Family Health Services Authority for analysis. It was determined that the leaflets are not being best used to advertise the range and potential of family planning services. Although all practices in Devon offer contraceptive services, only 90% of leaflets mentioned that the services are available. Reference to postcoital contraception and information about services outside the practice for people who might not want to see their family doctor are also sorely lacking. A clear need exists to provide patients with more information. Finally, the authors found that group practices and those with female partners are most likely to give high priority to family planning issues in their leaflets.

Innovation in Services: From Service Concepts to Service Experiences

OpenAIRE

Fynes, Brian; Lally, Anne Marie

2008-01-01

ABSTRACT Identifying the nature of service experiences is recognised As being of primary importance in the shaping of an enhanced competitive position for industry; however service managers often have difficulty articulating the true nature of their service concept. The definition of service concept is a fundamental part of the strategic advantage seeking Processes of service design, service development and service innovation. In response to the competitive Imperative for improved product/...

FY 1991--FY 1995 Information Technology Resources Long-Range Plan

Energy Technology Data Exchange (ETDEWEB)

1989-12-01

The Department of Energy has consolidated its plans for Information Systems, Computing Resources, and Telecommunications into a single document, the Information Technology Resources Long-Range Plan. The consolidation was done as a joint effort by the Office of ADP Management and the Office of Computer Services and Telecommunications Management under the Deputy Assistant Secretary for Administration, Information, and Facilities Management. This Plan is the product of a long-range planning process used to project both future information technology requirements and the resources necessary to meet those requirements. It encompasses the plans of the various organizational components within the Department and its management and operating contractors over the next 5 fiscal years, 1991 through 1995.

A short-range weather prediction system for South Africa based on a ...

African Journals Online (AJOL)

The accurate prediction of rainfall events, in terms of their timing, location and rainfall depth, is important to a wide range of social and economic applications. At many operational weather prediction centres, as is also the case at the South African Weather Service, forecasters use deterministic model outputs as guidance to ...

E-BANKING SERVICES – FEATURES, CHALLENGES AND BENEFITS

Directory of Open Access Journals (Sweden)

IMOLA DRIGĂ

2014-10-01

Full Text Available Today traditional banking services, based on lending and deposittaking operations, are only part of banking activities. Due to the emergence of a knowledgebased economy and society as information and communication technology advanced, banking services have undergone profound changes during the past decades. In order to improve the quality of customer service delivery and reduce transaction cost, banks have invested to a great extent in ICT and have adopted ICT networks for delivering a wide range of banking products and services. Banks all over the world have embraced innovative banking technologies and e-banking services in recent years. In this context, the paper aims to provide an overview of the electronic banking service highlighting various aspects of e-banking. Although e-banking offers many advantages both to corporate and individual clients, electronic banking is not without certain challenges and issues in terms of security and interest of customers.

Climate Prediction - NOAA's National Weather Service

Science.gov (United States)

Statistical Models... MOS Prod GFS-LAMP Prod Climate Past Weather Predictions Weather Safety Weather Radio National Weather Service on FaceBook NWS on Facebook NWS Director Home > Climate > Predictions Climate Prediction Long range forecasts across the U.S. Climate Prediction Web Sites Climate Prediction

GESCOM: system for commercial management of radiological protection services

International Nuclear Information System (INIS)

Alonso Abad, Dolores; Simon Rodriguez, Carmen; Proenza Suarez, Emma

2008-01-01

A wide range of Radiological protection services of national reach are offered by the Center for Radiation Protection and Hygiene (CPHR). The software developed enlarges the possibilities of the commercial management of these services. It contains all information generated in the interaction as much with the client as with the specialists during the process of realization of these services, impregnating them an added value and contributing to increase the quality and the efficiency of the commercial management of the organization. GESCOM has a wide group of reports which offer clear and precise information. It contains general modules such as entities, services request and services contract. It has specific modules for the most complex services: external dosimetry, calibration and/or verification of dose equipment, internal contamination and measurement of samples. (author)

RoboCup@Home Scientific Competition and Benchmarking for Domestic Service Robots

NARCIS (Netherlands)

Wisspeintner, Thomas; van der Zant, Tijn; Iocchi, Luca; Schiffer, Stefan

2009-01-01

Being part of the RoboCup initiative, the ROBOCUP@HOME league targets the development and deployment of autonomous service and assistive robot technology being essential for future personal domestic applications. The domain of domestic service and assistive robotics implicates a wide range of

Robust planning of sanitation services in urban informal settlements: An analytical framework.

Science.gov (United States)

Schmitt, Rafael J P; Morgenroth, Eberhard; Larsen, Tove A

2017-03-01

New types of sanitation services are emerging to tackle the sanitation crisis in informal settlements. These services link toilet facilities to semi-decentralized treatment plants via frequent, road-based transport of excreta. However, information for the planning of such sanitation services is scarce, and their future operating conditions are highly uncertain. The key questions of this paper are therefore: a) what are the drivers behind success or failure of a service-based sanitation system in informal settlements and b) on what scales and under which conditions can such a system operate successfully? To answer these questions, already at an early stage of the planning process, we introduce a stochastic model to analyze a wide range of system designs under varying technical designs, socio-economic factors, and spatial condition. Based on these initial results, we design a sanitation service and use the numeric model to study its reliability and costs over a wide range of scales, i.e., system capacities, from very few to many hundred users per semi-decentralized treatment unit. Key findings are that such a system can only operate within a narrow, but realistic range of conditions. Key requirements are toilet facilities, which can be serviced rapidly, and a flexible workforce. A high density of facilities will also lower the costs. Under these premises, we develop a road-based sanitation service and model its functionality in different settings and under many scenarios. Results show that the developed sanitation system using a single vehicle is scalable (100-700 users), can provide reliable service, and can be cheap (settlements and presents a quantitative framework for designing such systems. Copyright © 2016 Elsevier Ltd. All rights reserved.

Integrated centralized utility services to a chemical complex on Jurong Island, Singapore.

Science.gov (United States)

Yan, Y G; Wong, P C Y; Tan, C G; Tang, K F

2003-01-01

SUT pioneered centralized utility services for the chemical industry on Jurong Island, which are cost-effective due to economies of scale, reliable due to inter-connection of satellite operations, and customer tailored for special requirements. The utility services range from the supply of steam and water, wastewater treatment, incineration, terminalling, service corridor to fire fighting. Among the services, water management achieves the complete cycle from wastewater treatment to effluent recycling.

Ecosystem Service Supply and Vulnerability to Global Change in Europe

NARCIS (Netherlands)

Schröter, D.; Cramer, W.; Leemans, R.; Prentice, I.C.; Araujo, M.B.; Arnell, N.W.; Bondeau, A.; Brugmann, H.; Carter, T.R.; Gracia, C.A.; Vega-Leinert, de la A.C.; Erhard, M.; Ewert, F.; Glendining, M.; House, J.I.; Kankaanpää, S.; Klein, R.J.T.; Lavorel, S.; Lindner, M.; Metzger, M.J.; Meyer, J.; Mitchell, T.; Reginster, I.; Rounsevell, M.; Sabate, S.; Stich, S.; Smith, B.; Smith, J.; Smith, P.; Sykes, M.T.; Thonicke, K.; Thuiller, W.; Tuck, G.; Zaehle, S.; Zierl, B.

2005-01-01

Global change will alter the supply of ecosystem services that are vital for human well-being. To investigate ecosystem service supply during the 21st century, we used a range of ecosystem models and scenarios of climate and land-use change to conduct a Europe-wide assessment. Large changes in

Cognitive, emotional, and behavioral reactions to service failures

OpenAIRE

Natália Araújo Pacheco

2016-01-01

Given the pervasive nature of service failures and their harmful consequences, it is important to understand how customers react to them. This doctoral dissertation addresses some of the customers’ cognitive, emotional, and behavioral reactions to service failures. More specifically, it investigates customers’ causal attributions, appraisals, and perceived control as cognitive reactions, as well as a wide range of emotional (e.g., regret, anger, disappointment, etc.) and behavioral reactions ...

Remote controlled ultrasonic pre-service and in-service inspections of reactor pressure vessels

International Nuclear Information System (INIS)

Mueller, G.

1990-01-01

The first mechanised in-service inspection of the reactor pressure vessel on unit one of Eskom's Koeberg nuclear power station has been carried out. Since 1968 a whole range of manipulators to carry out remote controlled ultrasonic inspections of nuclear power station equipment has been developed. The inspection of a reactor pressure vessel using a central mast manipulator is described. 3 figs., 1 ill

Comparative Demonstration and Evaluation of Classification Technologies: Closed Castner Range, Fort Bliss, Texas

Science.gov (United States)

2017-01-23

reflecting the official policy or position of the Department of Defense. Reference herein to any specific commercial product, process, or service by...Former Camp Ellis Military Range (CEMR), which is a site known to contain evidence of 2.36-inch practice rockets , hand grenades, and rifle grenades

75 FR 27286 - McKelvie Geographic Area Range Allotment Management Planning on the Samuel R. McKelvie National...

Science.gov (United States)

2010-05-14

... range allotment management planning on the McKelvie Geographic Area, Samuel R. McKelvie National Forest... DEPARTMENT OF AGRICULTURE Forest Service McKelvie Geographic Area Range Allotment Management Planning on the Samuel R. McKelvie National Forest, Bessey Ranger District in Nebraska AGENCY: Forest...

Ranging Behaviour of Commercial Free-Range Laying Hens.

Science.gov (United States)

Chielo, Leonard Ikenna; Pike, Tom; Cooper, Jonathan

2016-04-26

In this study, the range use and behaviour of laying hens in commercial free-range flocks was explored. Six flocks were each visited on four separate days and data collected from their outdoor area (divided into zones based on distance from shed and available resources). These were: apron (0-10 m from shed normally without cover or other enrichments); enriched belt (10-50 m from shed where resources such as manmade cover, saplings and dust baths were provided); and outer range (beyond 50 m from shed with no cover and mainly grass pasture). Data collection consisted of counting the number of hens in each zone and recording behaviour, feather condition and nearest neighbour distance (NND) of 20 birds per zone on each visit day. In addition, we used techniques derived from ecological surveys to establish four transects perpendicular to the shed, running through the apron, enriched belt and outer range. Number of hens in each 10 m × 10 m quadrat was recorded four times per day as was the temperature and relative humidity of the outer range. On average, 12.5% of hens were found outside. Of these, 5.4% were found in the apron; 4.3% in the enriched zone; and 2.8% were in the outer range. This pattern was supported by data from quadrats, where the density of hens sharply dropped with increasing distance from shed. Consequently, NND was greatest in the outer range, least in the apron and intermediate in the enriched belt. Hens sampled in outer range and enriched belts had better feather condition than those from the apron. Standing, ground pecking, walking and foraging were the most commonly recorded activities with standing and pecking most likely to occur in the apron, and walking and foraging more common in the outer range. Use of the outer range declined with lower temperatures and increasing relative humidity, though use of apron and enriched belt was not affected by variation in these measures. These data support previous findings that outer range areas tend to be

A human-oriented framework for developing assistive service robots.

Science.gov (United States)

McGinn, Conor; Cullinan, Michael F; Culleton, Mark; Kelly, Kevin

2018-04-01

Multipurpose robots that can perform a range of useful tasks have the potential to increase the quality of life for many people living with disabilities. Owing to factors such as high system complexity, as-yet unresolved research questions and current technology limitations, there is a need for effective strategies to coordinate the development process. Integrating established methodologies based on human-centred design and universal design, a framework was formulated to coordinate the robot design process over successive iterations of prototype development. An account is given of how the framework was practically applied to the problem of developing a personal service robot. Application of the framework led to the formation of several design goals which addressed a wide range of identified user needs. The resultant prototype solution, which consisted of several component elements, succeeded in demonstrating the performance stipulated by all of the proposed metrics. Application of the framework resulted in the development of a complex prototype that addressed many aspects of the functional and usability requirements of a personal service robot. Following the process led to several important insights which directly benefit the development of subsequent prototypes. Implications for Rehabilitation This research shows how universal design might be used to formulate usability requirements for assistive service robots. A framework is presented that guides the process of designing service robots in a human-centred way. Through practical application of the framework, a prototype robot system that addressed a range of identified user needs was developed.

ENUSA activity in refuelling services

International Nuclear Information System (INIS)

Rodriguez Aycar, M.; Alvarez Rodriguez, P.

2010-01-01

This service includes the handling of fresh and irradiated fuel, the combination of various inspection techniques for detection of failed rods, ultrasonic surface cleaning, the repair of damaged assemblies, visual inspections and a wide range of of tests and inspections related to the reliability of mechanical components of fuel assemblies and to the programs to monitor its performance. (Author)

A Model-Driven, Science Data Product Registration Service

Science.gov (United States)

Hardman, S.; Ramirez, P.; Hughes, J. S.; Joyner, R.; Cayanan, M.; Lee, H.; Crichton, D. J.

2011-12-01

The Planetary Data System (PDS) has undertaken an effort to overhaul the PDS data architecture (including the data model, data structures, data dictionary, etc.) and to deploy an upgraded software system (including data services, distributed data catalog, etc.) that fully embraces the PDS federation as an integrated system while taking advantage of modern innovations in information technology (including networking capabilities, processing speeds, and software breakthroughs). A core component of this new system is the Registry Service that will provide functionality for tracking, auditing, locating, and maintaining artifacts within the system. These artifacts can range from data files and label files, schemas, dictionary definitions for objects and elements, documents, services, etc. This service offers a single reference implementation of the registry capabilities detailed in the Consultative Committee for Space Data Systems (CCSDS) Registry Reference Model White Book. The CCSDS Reference Model in turn relies heavily on the Electronic Business using eXtensible Markup Language (ebXML) standards for registry services and the registry information model, managed by the OASIS consortium. Registries are pervasive components in most information systems. For example, data dictionaries, service registries, LDAP directory services, and even databases provide registry-like services. These all include an account of informational items that are used in large-scale information systems ranging from data values such as names and codes, to vocabularies, services and software components. The problem is that many of these registry-like services were designed with their own data models associated with the specific type of artifact they track. Additionally these services each have their own specific interface for interacting with the service. This Registry Service implements the data model specified in the ebXML Registry Information Model (RIM) specification that supports the various

An Explanatory Model of Self-Service on the Internet

Science.gov (United States)

Oliver, Dave; Livermore, Celia Romm; Farag, Neveen Awad

This chapter describes research that identifies and classifies the dimensions of self-service activity enabled through the Internet. Self-service is effected by organizations providing ways and means whereby customers perform tasks related to the procurement of goods and services. We describe how an instrument used to measure Internet-based self-service was developed, validated and applied. The results from applying the instrument to a large number of Web sites, covering a range of industries, countries and cultures, are analyzed and discussed. The study presents a model in which type of industry, level of technological development, income and cultural factors are proposed as explanatory variables for Web-based self-service. We conclude with an assessment of this program of research’s achievements so far.

OntoGene web services for biomedical text mining.

Science.gov (United States)

Rinaldi, Fabio; Clematide, Simon; Marques, Hernani; Ellendorff, Tilia; Romacker, Martin; Rodriguez-Esteban, Raul

2014-01-01

Text mining services are rapidly becoming a crucial component of various knowledge management pipelines, for example in the process of database curation, or for exploration and enrichment of biomedical data within the pharmaceutical industry. Traditional architectures, based on monolithic applications, do not offer sufficient flexibility for a wide range of use case scenarios, and therefore open architectures, as provided by web services, are attracting increased interest. We present an approach towards providing advanced text mining capabilities through web services, using a recently proposed standard for textual data interchange (BioC). The web services leverage a state-of-the-art platform for text mining (OntoGene) which has been tested in several community-organized evaluation challenges,with top ranked results in several of them.

Mobile bone densitometry service in rural South Australia

International Nuclear Information System (INIS)

Tucker, K.N.; Schultz, C.G.; Chatterton, B.E.

1997-01-01

Full text: Twenty per cent of South Australia's population live rurally, with limited access to modern medical services. The Mobile Bone Densitometry Unit was established to address this problem. The Unit began in 1994 with cooperation from private industry. In fostering the service, many issues were addressed, including choice of appropriate sites; selection of a liaison person at each site; towing of the Unit; transportation and accommodation of staff; education of local health professionals and community members; promotion of the service to the community: and timely reporting of results to referring doctors. The scanner is an Hologic ODR-1000+ densitometer, housed in a 5.9 1.8 metre, 2200 kg caravan. It is necessary to reduce vibration and motion during travel, control the internal environment, and have an electrically clean power supply. Addressing these parameters result in the critical value for quality control being 2500 patients, averaging 13 patients/working day. The mean age of the patients was 64 y (range 30-90 y), with 93 % of patients being >50 y. Results show a normally distributed Z score, suggesting that non-selected 'normal' population is being studied and the Hologic normal range matches that of the South Australian rural community. Local communities have utilised the service to full capacity resulting in future visits being extended. In conclusion, it is possible to provide a high quality, reliable bone densitometry service to rural communities

Ranging Behaviour of Commercial Free-Range Laying Hens

Directory of Open Access Journals (Sweden)

Leonard Ikenna Chielo

2016-04-01

Full Text Available In this study, the range use and behaviour of laying hens in commercial free-range flocks was explored. Six flocks were each visited on four separate days and data collected from their outdoor area (divided into zones based on distance from shed and available resources. These were: apron (0–10 m from shed normally without cover or other enrichments; enriched belt (10–50 m from shed where resources such as manmade cover, saplings and dust baths were provided; and outer range (beyond 50 m from shed with no cover and mainly grass pasture. Data collection consisted of counting the number of hens in each zone and recording behaviour, feather condition and nearest neighbour distance (NND of 20 birds per zone on each visit day. In addition, we used techniques derived from ecological surveys to establish four transects perpendicular to the shed, running through the apron, enriched belt and outer range. Number of hens in each 10 m × 10 m quadrat was recorded four times per day as was the temperature and relative humidity of the outer range. On average, 12.5% of hens were found outside. Of these, 5.4% were found in the apron; 4.3% in the enriched zone; and 2.8% were in the outer range. This pattern was supported by data from quadrats, where the density of hens sharply dropped with increasing distance from shed. Consequently, NND was greatest in the outer range, least in the apron and intermediate in the enriched belt. Hens sampled in outer range and enriched belts had better feather condition than those from the apron. Standing, ground pecking, walking and foraging were the most commonly recorded activities with standing and pecking most likely to occur in the apron, and walking and foraging more common in the outer range. Use of the outer range declined with lower temperatures and increasing relative humidity, though use of apron and enriched belt was not affected by variation in these measures. These data support previous findings that outer range

One service, many voices: enhancing consumer participation in a primary health service for multicultural women.

Science.gov (United States)

Lee, Susan K; Thompson, Sandra C; Amorin-Woods, Deisy

2009-01-01

Consumer participation in primary health care is important in providing quality consumer-focused care, but challenging when working with disadvantaged groups of diverse cultural and linguistic backgrounds. Women's Health Services (WHS) works with women from over 60 different nationalities, including many newly arrived migrants and refugees. New arrivals access a wide range of WHS programmes including medical services, counselling, information, community talks and workshops, referral, and outreach, but few ethnic women attended the alcohol and other drug (AOD) services offered by the organisation. To establish an active consumer reference group to assist understanding and reducing the barriers to AOD services for a heterogeneous disadvantaged group that includes individuals from different cultural, language and educational backgrounds. Leaning heavily on experiences from the mental health field, WHS overcame many practical and philosophical considerations which included: agreeing upon the purpose of the group and how it would operate within the structure of the organisation; the level of English language required by participants for the group to function; issues of resourcing the group; and ensuring an appropriate, workable demographic mix in terms of age, language, and migration experiences. The process and the outcome of establishing a consumer reference group (CRG) in a primary healthcare setting has been valuable for consumers' and health service providers within the organisation.

A sustainable business model for public service organizations?

OpenAIRE

S.P. Osborne; Z. Radnor; I. Vidal; T. Kinder

2014-01-01

The current global economic recession presents significant challenges to public service organizations (PSOs) that deliver public services to local communities – irrespective of whether these organizations are situated in the public, private, or third sectors. Governments around the world have responded to this recession by a range of strategies intended to reduce public spending and generate growth. This is not the place to debate such strategies – this task has been undertaken...

The biodiversity-dependent ecosystem service debt.

Science.gov (United States)

Isbell, Forest; Tilman, David; Polasky, Stephen; Loreau, Michel

2015-02-01

Habitat destruction is driving biodiversity loss in remaining ecosystems, and ecosystem functioning and services often directly depend on biodiversity. Thus, biodiversity loss is likely creating an ecosystem service debt: a gradual loss of biodiversity-dependent benefits that people obtain from remaining fragments of natural ecosystems. Here, we develop an approach for quantifying ecosystem service debts, and illustrate its use to estimate how one anthropogenic driver, habitat destruction, could indirectly diminish one ecosystem service, carbon storage, by creating an extinction debt. We estimate that c. 2-21 Pg C could be gradually emitted globally in remaining ecosystem fragments because of plant species loss caused by nearby habitat destruction. The wide range for this estimate reflects substantial uncertainties in how many plant species will be lost, how much species loss will impact ecosystem functioning and whether plant species loss will decrease soil carbon. Our exploratory analysis suggests that biodiversity-dependent ecosystem service debts can be globally substantial, even when locally small, if they occur diffusely across vast areas of remaining ecosystems. There is substantial value in conserving not only the quantity (area), but also the quality (biodiversity) of natural ecosystems for the sustainable provision of ecosystem services. © 2014 John Wiley & Sons Ltd/CNRS.

Super-ranging. A new ranging strategy in European badgers.

Directory of Open Access Journals (Sweden)

Aoibheann Gaughran

Full Text Available We monitored the ranging of a wild European badger (Meles meles population over 7 years using GPS tracking collars. Badger range sizes varied seasonally and reached their maximum in June, July and August. We analysed the summer ranging behaviour, using 83 home range estimates from 48 individuals over 6974 collar-nights. We found that while most adult badgers (males and females remained within their own traditional social group boundaries, several male badgers (on average 22% regularly ranged beyond these traditional boundaries. These adult males frequently ranged throughout two (or more social group's traditional territories and had extremely large home ranges. We therefore refer to them as super-rangers. While ranging across traditional boundaries has been recorded over short periods of time for extraterritorial mating and foraging forays, or for pre-dispersal exploration, the animals in this study maintained their super-ranges from 2 to 36 months. This study represents the first time such long-term extra-territorial ranging has been described for European badgers. Holding a super-range may confer an advantage in access to breeding females, but could also affect local interaction networks. In Ireland & the UK, badgers act as a wildlife reservoir for bovine tuberculosis (TB. Super-ranging may facilitate the spread of disease by increasing both direct interactions between conspecifics, particularly across social groups, and indirect interactions with cattle in their shared environment. Understanding super-ranging behaviour may both improve our understanding of tuberculosis epidemiology and inform future control strategies.

DOE's foreign research reactor transportation services contract: Perspective and experience

International Nuclear Information System (INIS)

Patterson, John

1997-01-01

DOE committed to low- and moderate-income countries participating in the foreign research reactor spent fuel returns program that the United States government would provide for the transportation of the spent fuel. In fulfillment of that commitment, DOE entered into transportation services contracts with qualified, private-sector firms. NAC will discuss its experience as a transportation services provider, including range of services available to the foreign reactors, advantages to DOE and to the foreign research reactors, access to contract services by high income countries and potential advantages, and experience with initial tasks performed under the contract. (author)

APPLICATIONS OF CLOUD COMPUTING SERVICES IN EDUCATION – CASE STUDY

Directory of Open Access Journals (Sweden)

Tomasz Cieplak

2014-11-01

Full Text Available Applications of Cloud Computing in enterprises are very wide-ranging. In opposition, educational applications of Cloud Computing in Poland are someway limited. On the other hand, young people use services of Cloud Computing frequently. Utilization of Facebook, Google or other services in Poland by young people is almost the same as in Western Europe or in the USA. Taking into account those considerations, few years ago authors have started process of popularization and usage of Cloud Computing educational services in their professional work. This article briefly summarizes authors’ experience with selected and most popular Cloud Computing services.

Research evaluation support services in biomedical libraries.

Science.gov (United States)

Gutzman, Karen Elizabeth; Bales, Michael E; Belter, Christopher W; Chambers, Thane; Chan, Liza; Holmes, Kristi L; Lu, Ya-Ling; Palmer, Lisa A; Reznik-Zellen, Rebecca C; Sarli, Cathy C; Suiter, Amy M; Wheeler, Terrie R

2018-01-01

The paper provides a review of current practices related to evaluation support services reported by seven biomedical and research libraries. A group of seven libraries from the United States and Canada described their experiences with establishing evaluation support services at their libraries. A questionnaire was distributed among the libraries to elicit information as to program development, service and staffing models, campus partnerships, training, products such as tools and reports, and resources used for evaluation support services. The libraries also reported interesting projects, lessons learned, and future plans. The seven libraries profiled in this paper report a variety of service models in providing evaluation support services to meet the needs of campus stakeholders. The service models range from research center cores, partnerships with research groups, and library programs with staff dedicated to evaluation support services. A variety of products and services were described such as an automated tool to develop rank-based metrics, consultation on appropriate metrics to use for evaluation, customized publication and citation reports, resource guides, classes and training, and others. Implementing these services has allowed the libraries to expand their roles on campus and to contribute more directly to the research missions of their institutions. Libraries can leverage a variety of evaluation support services as an opportunity to successfully meet an array of challenges confronting the biomedical research community, including robust efforts to report and demonstrate tangible and meaningful outcomes of biomedical research and clinical care. These services represent a transformative direction that can be emulated by other biomedical and research libraries.

Use of Cybercafe's Services by Households in Delta State, Nigeria ...

African Journals Online (AJOL)

Cyber cafés' provide important public services. They provide access to wide range of information through the internet via the computer. The study is centered on the use of cyber cafés by households in Delta State. Services provided by the cyber café's were identified. The study revealed that Household with children under ...

76 FR 64376 - Long Range Transportation Plan for Fish and Wildlife Service Lands in Hawai`i, Idaho, Northern...

Science.gov (United States)

2011-10-18

... the Draft LRTP. You may request a copy or submit comments by any of the following methods. E-mail: [email protected] . U.S. mail: Jeff Holm, Regional Transportation Coordinator, U.S. Fish and Wildlife... delivery, operations, and maintenance. Objective 2: Reduce the Service's carbon footprint by improving...

Costing and pricing electric power reserve services. Final report

International Nuclear Information System (INIS)

Kirsch, L.D.; Rajaraman, R.; Clark, C.

1997-12-01

In the competitive electric power markets of the imminent future, reserves will be the second largest generation service in terms of their revenues and profits. Because reserves will be more widely traded than at present, they will be provided by the cheapest available sources regardless of the ownership of those sources. Price will determine the willingness of generators and consumers to provide reserve services; and it may also determine the willingness of reserve users to purchase reserve services. This report presents a methodology by which generation firms and merchant firms can profitably cost and price the reserve services that they offer. The methodology is generally applicable to a wide range of market structures that such firms might face

Service Recovery Paradox In Indian Banking Industry: An Empirical Investigation

Directory of Open Access Journals (Sweden)

Arunesh Garg

2013-10-01

Full Text Available The present study examines existence of service recovery paradox in Indian banking industry. The study is taken up in the tri-city of Chandigarh, Panchkula and Mohali. The respondents are catego- rized into failure and no-failure groups on the basis of their service experience. Failure group consti- tutes those respondents who have experienced service recovery, and has been further divided into five sub-groups ranging from service recovery++ (service recovery better than expected to service recovery- - (service recovery worse than expected. Service recovery paradox is examined by com- paring service recovery++ group with no-failure group. The study shows evidence for existence of service recovery paradox in relation to satisfaction. It has been concluded that for service recovery paradox to exist, recovery effort has to be exceptionally good and much better than expectation level of the customer. The study suggests that service managers should take service failure as an opportunity to appease customers by providing a much better than expected recovery experience. However, organizations should not plan to create service failure situations because if they falter on imparting the recovery, customer satisfaction may be influenced negatively.

HIGH SERVE - service for nuclear technology. Buyers' guide

International Nuclear Information System (INIS)

1986-01-01

The Deutsches Atomforum e.V. (German Atomic Forum) has organised a specialist conference with the title 'HIGH SERVE - service for nuclear technology' for October 1986. In parallel with the conference, an exhibition will make it possible for interested firms to present their service and product ranges. The experience gained in the preparation of this exhibition has been used to produce the 'HIGH SERVE - buyers guide'. The intention is to make the market more comprehensible. (orig./HP) [de

Incorporating elements of social franchising in government health services improves the quality of infant and young child feeding counselling services at commune health centres in Vietnam.

Science.gov (United States)

Nguyen, Phuong H; Kim, Sunny S; Keithly, Sarah C; Hajeebhoy, Nemat; Tran, Lan M; Ruel, Marie T; Rawat, Rahul; Menon, Purnima

2014-12-01

Although social franchising has been shown to enhance the quality of reproductive health services in developing countries, its effect on nutrition services remains unexamined. This study assessed the effects of incorporating elements of social franchising on shaping the quality of infant and young child feeding (IYCF) counselling facilities and services in Vietnam. Process-related data collected 12 months after the launch of the first franchises were used to compare randomly assigned Alive & Thrive-supported health facilities (AT-F, n = 20) with standard facilities (SF, n = 12) across three dimensions of service quality: 'structure', 'process' and 'outcome' that capture the quality of facilities, service delivery, and client perceptions and use, respectively. Data collection included facility assessments (n = 32), staff surveys (n = 96), counselling observations (n = 137), client exit interviews (n = 137) and in-depth interviews with mothers (n = 48). Structure: AT-F were more likely to have an unshared, well-equipped room for nutrition counselling than SF (65.0% vs 10.0%). Compared with SF providers, AT-F staff had better IYCF knowledge (mean score 9.9 vs 8.8, range 0-11 for breastfeeding; mean score 3.6 vs 3.2, range 0-4 for complementary feeding). AT-F providers also demonstrated significantly better interpersonal communication skills (score 9.6 vs 5.1, range 0-13) and offered more comprehensive counselling sessions. Overall utilization of franchises was low (10%). A higher proportion of pregnant women utilized franchise services (48.9%), compared with mothers with children 6-23.9 months (1.4%). There was no quantitative difference in client satisfaction with counselling services between AT-F and SF, but franchise users praised the AT-F for problem solving related to child feeding. Incorporating elements of social franchising significantly enhances the quality of IYCF counselling services within government primary healthcare facilities, particularly their

A fair range of choice: justifying maximum patient choice in the British National Health Service.

Science.gov (United States)

Wilmot, Stephen

2007-06-01

In this paper I put forward an ethical argument for the provision of extensive patient choice by the British National Health Service. I base this argument on traditional liberal rights to freedom of choice, on a welfare right to health care, and on a view of health as values-based. I argue that choice, to be ethically sustainable on this basis, must be values-based and rational. I also consider whether the British taxpayer may be persuadable with regard to the moral acceptability of patient choice, making use of Rawls' theory of political liberalism in this context. I identify issues that present problems in terms of public acceptance of choice, and also identify a boundary issue with regard to public health choices as against individual choices.

Assessing the Value Dimensions of Outsourced Maintenance Services

DEFF Research Database (Denmark)

Toossi, Amir; Lockett, Helen Louise; Raja, Jawwad

2013-01-01

Purpose – The purpose of this paper is to investigate the diverse nature of tangible and intangible value dimensions that contribute to customers’ perception of value from outsourced maintenance services. Design/methodology/approach – A multiple case study approach has been adopted. Repertory grid......, an in-depth structured interviewing technique, has been used in order to draw out the respondents’ hidden constructs in evaluating outsourced maintenance services. Data have been collected from four customer organizations of outsourced maintenance services, and a total of 33 interviews have been...... undertaken. Findings – The paper has identified a range of tangible and intangible value dimensions that are of importance in maintenance outsourcing decision making. The most important value dimensions for maintenance outsourcing were found to be specialist knowledge, accessibility (of the service provider...

IT Service Management Foundation Practice Questions For ITIL Foundation Exam candidates

CERN Document Server

Mann, Steve; Mann, Steve; Mear, Nigel

2012-01-01

The most authoritative guide to preparing for the ITIL® Foundation Certificate in IT Service Management. This new edition is compatible with the 2011 update to ITIL®. It includes an extensive range of practice questions and utilises the experience of three independent service management consultants and lecturers. An ITIL® licensed product.

Introduction to the special section: Designing a better user experience for self-service systems

NARCIS (Netherlands)

van der Geest, Thea; Ramey, J.; Rosenbaum, S.; van Velsen, Lex Stefan

2013-01-01

June 2013 issue of IEEE Transactions on Professional Communication features a special section on 'Designing a Better User Experience for Self-Service Systems'. Self-service systems offers the users the benefit of 24/7 access to an ever-growing range of services and perhaps also a strong sense of

A Generic Framework for Location-Based Services (LBS Provisioning

Directory of Open Access Journals (Sweden)

Ioannis Priggouris

2006-01-01

Full Text Available Location Based Services can be considered as one of the most rapidly expanding fields of the mobile communications sector, with an impressively large application range. The proliferation of mobile/wireless Internet and mobile computing, and the constantly increasing use of handheld, mobile devices and position tracking technologies prepared the grounds for the introduction of this new type of services. The combination of position fixing mechanisms with location-dependent, geographical information, can offer truly customized personal communication services through the mobile phone or other type of devices. Prompted by the avalanche of technology advances in the aforementioned areas in this paper we present an integrated platform for delivering Location Based Services (LBS. The platform covers the full life cycle of a LBS starting from the specification of the service, covering issues like the deployment and maintenance of services, the service invocation and the final delivery of the produced results to the invoking user. A prototype implementation of the discussed platform was developed and used to perform a series of trial services, with the purpose of demonstrating the pursued functionality.

Service Modeling for Service Engineering

Science.gov (United States)

Shimomura, Yoshiki; Tomiyama, Tetsuo

Intensification of service and knowledge contents within product life cycles is considered crucial for dematerialization, in particular, to design optimal product-service systems from the viewpoint of environmentally conscious design and manufacturing in advanced post industrial societies. In addition to the environmental limitations, we are facing social limitations which include limitations of markets to accept increasing numbers of mass-produced artifacts and such environmental and social limitations are restraining economic growth. To attack and remove these problems, we need to reconsider the current mass production paradigm and to make products have more added values largely from knowledge and service contents to compensate volume reduction under the concept of dematerialization. Namely, dematerialization of products needs to enrich service contents. However, service was mainly discussed within marketing and has been mostly neglected within traditional engineering. Therefore, we need new engineering methods to look at services, rather than just functions, called "Service Engineering." To establish service engineering, this paper proposes a modeling technique of service.

The Economics of Air Force Medical Service Readiness.

Science.gov (United States)

Graser, John C; Blum, Daniel; Brancato, Kevin; Burks, James J; Chan, Edward W; Nicosia, Nancy; Neumann, Michael J; Ritschard, Hans V; Mundell, Benjamin F

2012-01-01

The prime mission of the Air Force Medical Service (AFMS), like those of the medical departments of its sister services, is to provide medical care during wartime. AFMS currently runs three successful in-theater hospitals that treat severely injured or wounded U.S. personnel from all four services. But this wartime mission depends on capabilities built at home, as critical-care specialists maintain their technical proficiency, as much as peacetime opportunities allow, by meeting health-care needs of Department of Defense beneficiaries at home. These patients have ranged from young, healthy active-duty personnel to aging retirees, historically presenting a broad range of injuries and illnesses for treatment. However, between the demands of deployments creating gaps in staff at home and changes in care plans, some beneficiaries now seek care in the civilian sector. In addition, several AFMS hospitals stateside have been closed, converted to clinics, or combined with those of other services for various reasons. All is problematic for two reasons: First, inpatient workloads in particular represent the best opportunities for critical care providers to prepare for their wartime missions. AFMS will need to increase these opportunities, perhaps working with other services, the Department of Veterans Affairs, or civilian hospitals. Second, AFMS's funding depends, in part, on the workload performed, but current measurement methods do not necessarily do a good job of accounting for the work AFMS practitioners accomplish outside their home stations. Some imminent changes may help resolve this situation, but AFMS should pursue opportunities to create additional workload for its medical personnel and to increase its budgets.

Service employees give as they get: internal service as a moderator of the service climate-service outcomes link.

Science.gov (United States)

Ehrhart, Karen Holcombe; Witt, L A; Schneider, Benjamin; Perry, Sara Jansen

2011-03-01

We lend theoretical insight to the service climate literature by exploring the joint effects of branch service climate and the internal service provided to the branch (the service received from corporate units to support external service delivery) on customer-rated service quality. We hypothesized that service climate is related to service quality most strongly when the internal service quality received is high, providing front-line employees with the capability to deliver what the service climate motivates them to do. We studied 619 employees and 1,973 customers in 36 retail branches of a bank. We aggregated employee perceptions of the internal service quality received from corporate units and the local service climate and external customer perceptions of service quality to the branch level of analysis. Findings were consistent with the hypothesis that high-quality internal service is necessary for branch service climate to yield superior external customer service quality. PsycINFO Database Record (c) 2011 APA, all rights reserved.

INTERNET BANKING SERVICES - A BUSINESS NECESSITY IN THE THIRD MILLENNIUM

Directory of Open Access Journals (Sweden)

CLAUDIA ISAC

2015-12-01

Full Text Available In this paper, we have presented several theoretical aspects of internet banking, based on the place of this type of services in the range of electronic services within the banking system and further on we have revealed the obvious benefits that these services have for individuals and legal entities, as well as their security features. The second part of the paper highlights some statistical aspects of online banking penetration in EU countries and in Romania by comparison. Based on the statistical data presented by Romanian banking institutions, we have made a comparison of the number of individuals and legal entities who access internet banking services.

Community/hospital indicators in South African public sector mental health services.

Science.gov (United States)

Lund, Crick; Flisher, Alan J

2003-12-01

The need to balance resources between community and hospital-based mental health services in the post-deinstitutionalisation era has been well-documented. However, few indicators have been developed to monitor the relationship between community and hospital services, in either developed or developing countries. There is a particular need for such indicators in the South African context, with its history of inequitable services based in custodial institutions under apartheid, and a new policy that proposes the development of more equitable community-based care. Indicators are needed to measure the distribution of resources and the relative utilisation of community and hospital-based services during the reform process. These indicators are potentially useful for assessing the implementation of policy objectives over time. To develop and document community/hospital indicators in public sector mental health services in South Africa. A questionnaire was distributed to provincial mental health coordinators requesting numbers of full-time equivalent (FTE) staff who provide mental health care at all service levels, annual patient admissions to hospitals and annual patient attendances at ambulatory care facilities. The information was supplemented by consultations with mental health coordinators in each of the 9 provinces. Population data were obtained from preliminary findings of the 1996 census. The community/hospital indicator measuring staff distribution was defined as the ratio of staff employed in community settings to all staff, expressed as a percentage. The community/hospital indicator measuring patient service utilisation was defined as the ratio of the annual ambulatory care attendance rate per 100,000 population to the sum of this rate and the annual hospital admission rate per 100,000 population, expressed as a percentage. Of psychiatric public sector staff, 25% are located in community settings in South Africa (provincial range: 11-70%). If hospital outpatient

Production experience with the ATLAS Event Service

Science.gov (United States)

Benjamin, D.; Calafiura, P.; Childers, T.; De, K.; Guan, W.; Maeno, T.; Nilsson, P.; Tsulaia, V.; Van Gemmeren, P.; Wenaus, T.; ATLAS Collaboration

2017-10-01

The ATLAS Event Service (AES) has been designed and implemented for efficient running of ATLAS production workflows on a variety of computing platforms, ranging from conventional Grid sites to opportunistic, often short-lived resources, such as spot market commercial clouds, supercomputers and volunteer computing. The Event Service architecture allows real time delivery of fine grained workloads to running payload applications which process dispatched events or event ranges and immediately stream the outputs to highly scalable Object Stores. Thanks to its agile and flexible architecture the AES is currently being used by grid sites for assigning low priority workloads to otherwise idle computing resources; similarly harvesting HPC resources in an efficient back-fill mode; and massively scaling out to the 50-100k concurrent core level on the Amazon spot market to efficiently utilize those transient resources for peak production needs. Platform ports in development include ATLAS@Home (BOINC) and the Google Compute Engine, and a growing number of HPC platforms. After briefly reviewing the concept and the architecture of the Event Service, we will report the status and experience gained in AES commissioning and production operations on supercomputers, and our plans for extending ES application beyond Geant4 simulation to other workflows, such as reconstruction and data analysis.

The taming of the Grid : virtual application services

International Nuclear Information System (INIS)

Keahey, K; Motawi, K.

2004-01-01

In this report we develop a view of the Grid based on the application service provider (ASP) model. This view enables the user to see the Grid as a collection of application services that can be published, discovered, and accessed in a relatively straightforward manner, hiding much of the complexity involved in using computational Grids and thus making it simpler and more accessible to a wider range of users. However, in order to satisfy the requirements of real-time scientific application clients, we combine the ASP model with representation of quality of service about the execution of services and the results they produce. Specifically, we focus on real-time, deadline-bound execution as the quality of service derived by a client. We describe an architecture implementing these ideas and the role of client and server in the context of the functionality we develop. We also describe preliminary experiments using an equilibrium fitting application for magnetic fusion in our architecture

Identifying barriers to receiving preventive dental services: expanding access to preventive dental hygiene services through affiliated practice.

Science.gov (United States)

Gross-Panico, Michelle L; Freeman, Wilbur K

2012-01-01

Minority children and children from lower income families are more likely to experience the burden of oral disease. Since oral disease reduces quality of life, it is a priority to utilize preventive dental services. The research questions ask if affiliated practice increases utilization of preventive dental services by underserved children from birth to 18 years of age, and what the barriers to receiving preventive dental services are and their level of importance. A survey was administered to parents/guardians of patients from birth to 18 years of age who received preventive dental services from Catholic Healthcare West East Valley Children's Dental Clinic, an affiliated practice dental clinic in Chandler, Arizona. Thirty-four surveys were completed: 21 completed in English and 13 completed in Spanish. The data was analyzed to provide descriptive statistics and non-parametrically analyzed using the Friedman's, Kendall's W and Wilcoxon Signed Ranks Tests. The cost of preventive dental services is more important to this population than both convenience of appointment time and distance traveled. As the cost increases for preventive dental services, this population will utilize preventive dental services less frequently. The study indicated that the increase of self-reported utilization of preventive dental services by underserved children, ranging in age from birth to 18 years old, in Arizona affiliated practice dental clinics, was primarily impacted by perceived reduced costs of receiving care. Funding efforts, reimbursement mechanisms and legislative policies should support this dental care delivery model to provide care to underserved children, adults and seniors throughout the U.S.

Teleconferencing using multimedia messaging service (MMS) for long-range consultation of patients with neurosurgical problems in an acute situation.

Science.gov (United States)

Waran, Vicknes; Selladurai, Benedict M; Bahuri, Nor Faizal Ahmad; George, George John K Thomas; Lim, Grace P S; Khine, Myo

2008-02-01

: We present our initial experience using a simple and relatively cost effective system using existing mobile phone network services and conventional handphones with built in cameras to capture carefully selected images from hard copies of scan images and transferring these images from a hospital without neurosurgical services to a university hospital with tertiary neurosurgical service for consultation and management plan. : A total of 14 patients with acute neurosurgical problems admitted to a general hospital in a 6 months period had their images photographed and transferred in JPEG format to a university neurosurgical unit. This was accompanied by a phone conference to discuss the scan and the patients' condition between the neurosurgeon and the referring physician. All images were also reviewed by a second independent neurosurgeon on a separate occasion to asses the agreement on the diagnosis and the management plan. : There were nine patients with acute head injury and five patients with acute nontraumatic neurosurgical problems. In all cases both neurosurgeons were in agreement that a diagnosis could be made on the basis of the images that were transferred. With respect to the management advice there were differences in opinion on three of the patients but these were considered to be minor. : Accurate diagnosis can be made on images of acute neurosurgical problems transferred using a conventional camera phone and meaningful decisions can be made on these images. This method of consultation also proved to be highly convenient and cost effective.

Adoption of Broadband Services

DEFF Research Database (Denmark)

Falch, Morten

2008-01-01

Broadband is seen as a key infrastructure for developing the information society. For this reason many Governments are actively engaged in stimulating investments in broadband infrastructures and use of broadband services. This chapter compares a wide range of broadband strategies in the most suc....... Many countries have provided active support for stimulating diffusion of broadband and national variants of this type of policies in different countries are important for an explanation of national differences in adoption of broadband....

Identifying service quality dimensions as antecedents to customer satisfaction in retail banking

Directory of Open Access Journals (Sweden)

Iča Rojšek

2010-06-01

Full Text Available This paper explores service quality in a retail bank setting in Slovenia and its influence on customer satisfaction. In previous studies both SERVQUAL and SERVPERF scales have been used for measuring service quality. Based on SERVPERF a 28-item scale has been developed for this study. Through factor analysis four dimensions of service quality have been obtained. The results from regression analysis suggest that all four dimensions of service quality as well as service range influence customer satisfaction. The information provided by this research can be used when designing marketing strategies to improve customer satisfaction in retail banking.

Using fee-for-service testing to generate revenue for the 21st century public health laboratory.

Science.gov (United States)

Loring, Carol; Neil, R Brock; Gillim-Ross, Laura; Bashore, Matthew; Shah, Sandip

2013-01-01

The decrease in appropriations for state public health laboratories (SPHLs) has become a major concern as tax revenues and, subsequently, state and federal funding, have decreased. These reductions have forced SPHLs to pursue revenue-generating opportunities to support their work. We describe the current state of funding in a sampling of SPHLs and the challenges these laboratories face as they implement or expand fee-for-service testing. We conducted surveys of SPHLs to collect data concerning laboratory funding sources, test menus, fee-for-service testing, and challenges to implementing fee-for-service testing. Most SPHLS receive funding through three revenue sources: state appropriation, federal funding, and fee-for-service testing (cash funds). Among SPHLs, state appropriations ranged from $0 to more than $6 per capita, federal funding ranged from $0.10 to $5 per capita, and revenue from fee-for-service testing ranged from $0 to $4 per capita. The tests commonly performed on a fee-for-service basis included assays for sexually transmitted diseases, mycobacterial cultures, newborn screening, and water testing. We found that restrictive legislation, staffing shortages, inadequate software for billing fee-for-service testing, and regulations on how SPHLs use their generated revenue are impediments to implementing fee-for-service testing. Some SPHLs are considering implementing or expanding fee-for-service testing as a way to recapture funds lost as a result of state and federal budget cuts. This analysis revealed many of the obstacles to implementing fee-for-service testing in SPHLs and the potential impact on SPHLs of continued decreases in funding.

The Role of Herbivory in Structuring Tropical Seagrass Ecosystem Service Delivery

Science.gov (United States)

Scott, Abigail L.; York, Paul H.; Duncan, Clare; Macreadie, Peter I.; Connolly, Rod M.; Ellis, Megan T.; Jarvis, Jessie C.; Jinks, Kristin I.; Marsh, Helene; Rasheed, Michael A.

2018-01-01

Seagrass meadows support key ecosystem services, via provision of food directly for herbivores, and indirectly to their predators. The importance of herbivores in seagrass meadows has been well-documented, but the links between food webs and ecosystem services in seagrass meadows have not previously been made explicit. Herbivores interact with ecosystem services – including carbon sequestration, cultural values, and coastal protection. Interactions can be positive or negative and depend on a range of factors including the herbivore identity and the grazing type and intensity. There can be unintended consequences from management actions based on a poor understanding of trade-offs that occur with complex seagrass-herbivore interactions. Tropical seagrass meadows support a diversity of grazers spanning the meso-, macro-, and megaherbivore scales. We present a conceptual model to describe how multiple ecosystem services are influenced by herbivore pressure in tropical seagrass meadows. Our model suggests that a balanced ecosystem, incorporating both seagrass and herbivore diversity, is likely to sustain the broadest range of ecosystem services. Our framework suggests the pathway to achieve desired ecosystem services outcomes requires knowledge on four key areas: (1) how size classes of herbivores interact to structure seagrass; (2) desired community and management values; (3) seagrass responses to top–down and bottom–up controls; (4) the pathway from intermediate to final ecosystem services and human benefits. We suggest research should be directed to these areas. Herbivory is a major structuring influence in tropical seagrass systems and needs to be considered for effective management of these critical habitats and their services. PMID:29487606

The garden of the self-service store

DEFF Research Database (Denmark)

Bech-Larsen, Tino; Esbjerg, Lars

2006-01-01

As a result of the increased competition between self-service chains, retail managers to an increasing degree try to strengthen store identity and customer loyalty. Based on a broad range of consumer choice and environmental psychology theories, this article discusses a number of reasons why the ...

Dynamic services for open ambient intelligence systems

NARCIS (Netherlands)

Acampora, G.; Loia, V.; Ma, Z.

2006-01-01

Ambient intelligence (AmI) [1] provides a wide-ranging vision on how the Information Society will evolve, since the goal is to conceive platforms for seamless delivery of services and applications making them effectively invisible to the user. This is possible by gathering best practices from

Shaping the offer of hotel services for internet sales

Directory of Open Access Journals (Sweden)

Adlešič Tatjana

2015-01-01

Full Text Available This paper deals with the consumer's preferences in booking hotel services over the internet. A conjoint analysis was used in establishing whether the price is the most important factor in deciding on a hotel service and which elements of the service can be used as a competitive advantage. Although the price does play a pivotal role in the consumer's decision, within an acceptable price range he will take into account the bonuses offered by the hotel. Among the bonuses, free parking and free internet access play an important role, while free access to pornographic films and free wine with dinner are not an important factor. Room colour does not play a role in the consumer's decision making process regarding hotel services.

Pharmaceutical services cost analysis using time-driven activity-based costing: A contribution to improve community pharmacies' management.

Science.gov (United States)

Gregório, João; Russo, Giuliano; Lapão, Luís Velez

2016-01-01

The current financial crisis is pressing health systems to reduce costs while looking to improve service standards. In this context, the necessity to optimize health care systems management has become an imperative. However, little research has been conducted on health care and pharmaceutical services cost management. Pharmaceutical services optimization requires a comprehensive understanding of resources usage and its costs. This study explores the development of a time-driven activity-based costing (TDABC) model, with the objective of calculating the cost of pharmaceutical services to help inform policy-making. Pharmaceutical services supply patterns were studied in three pharmacies during a weekday through an observational study. Details of each activity's execution were recorded, including time spent per activity performed by pharmacists. Data on pharmacy costs was obtained through pharmacies' accounting records. The calculated cost of a dispensing service in these pharmacies ranged from €3.16 to €4.29. The cost of a counseling service when no medicine was supplied ranged from €1.24 to €1.46. The cost of health screening services ranged from €2.86 to €4.55. The presented TDABC model gives us new insights on management and costs of community pharmacies. This study shows the importance of cost analysis for health care services, specifically on pharmaceutical services, in order to better inform pharmacies' management and the elaboration of pharmaceutical policies. Copyright © 2016 Elsevier Inc. All rights reserved.

Production experience with the ATLAS Event Service

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00066086; The ATLAS collaboration; Calafiura, Paolo; Childers, John Taylor; De, Kaushik; Guan, Wen; Maeno, Tadashi; Nilsson, Paul; Tsulaia, Vakhtang; van Gemmeren, Peter; Wenaus, Torre

2017-01-01

The ATLAS Event Service (AES) has been designed and implemented for efficient running of ATLAS production workflows on a variety of computing platforms, ranging from conventional Grid sites to opportunistic, often short-lived resources, such as spot market commercial clouds, supercomputers and volunteer computing. The Event Service architecture allows real time delivery of fine grained workloads to running payload applications which process dispatched events or event ranges and immediately stream the outputs to highly scalable Object Stores. Thanks to its agile and flexible architecture the AES is currently being used by grid sites for assigning low priority workloads to otherwise idle computing resources; similarly harvesting HPC resources in an efficient back-fill mode; and massively scaling out to the 50-100k concurrent core level on the Amazon spot market to efficiently utilize those transient resources for peak production needs. Platform ports in development include ATLAS@Home (BOINC) and the Google Comp...

Production Experience with the ATLAS Event Service

CERN Document Server

Benjamin, Douglas; The ATLAS collaboration

2016-01-01

The ATLAS Event Service (ES) has been designed and implemented for efficient running of ATLAS production workflows on a variety of computing platforms, ranging from conventional Grid sites to opportunistic, often short-lived resources, such as spot market commercial clouds, supercomputers and volunteer computing. The Event Service architecture allows real time delivery of fine grained workloads to running payload applications which process dispatched events or event ranges and immediately stream the outputs to highly scalable Object Stores. Thanks to its agile and flexible architecture the ES is currently being used by grid sites for assigning low priority workloads to otherwise idle computing resources; similarly harvesting HPC resources in an efficient back-fill mode; and massively scaling out to the 50-100k concurrent core level on the Amazon spot market to efficiently utilize those transient resources for peak production needs. Platform ports in development include ATLAS@Home (BOINC) and the Goggle Comput...

Knowledge Transfer Services

Directory of Open Access Journals (Sweden)

Albert Simard

2009-03-01

include independence from content, an organizational focus, scalability, two drivers, and two levels of resolution. The model is based on a value chain in which value is embedded, advanced, or extracted. A knowledge services system comprises nine stages: generate, transform, manage, use internally, transfer, add value, use professionally, use personally, and evaluate. Knowledge services are delivered through a delivery spectrum ranging from rich to reach. Each region of the delivery spectrum has a set of attributes that influence how services should be delivered.

Inferring Internet Denial-of-Service Activity

National Research Council Canada - National Science Library

Moore, David

2001-01-01

.... During this period, we observe more than 2,000 attacks against more than 5,000 distinct targets, ranging from well known e-commerce companies such as Amazon and Hotmail to small foreign ISPs and dial-up connections. We believe that our work is the only publically available data quantifying denial-of-service activity in the Internet.

Revenue Potential for Inpatient IR Consultation Services: A Financial Model.

Science.gov (United States)

Misono, Alexander S; Mueller, Peter R; Hirsch, Joshua A; Sheridan, Robert M; Siddiqi, Assad U; Liu, Raymond W

2016-05-01

Interventional radiology (IR) has historically failed to fully capture the value of evaluation and management services in the inpatient setting. Understanding financial benefits of a formally incorporated billing discipline may yield meaningful insights for interventional practices. A revenue modeling tool was created deploying standard financial modeling techniques, including sensitivity and scenario analyses. Sensitivity analysis calculates revenue fluctuation related to dynamic adjustment of discrete variables. In scenario analysis, possible future scenarios as well as revenue potential of different-size clinical practices are modeled. Assuming a hypothetical inpatient IR consultation service with a daily patient census of 35 patients and two new consults per day, the model estimates annual charges of $2.3 million and collected revenue of $390,000. Revenues are most sensitive to provider billing documentation rates and patient volume. A range of realistic scenarios-from cautious to optimistic-results in a range of annual charges of $1.8 million to $2.7 million and a collected revenue range of $241,000 to $601,000. Even a small practice with a daily patient census of 5 and 0.20 new consults per day may expect annual charges of $320,000 and collected revenue of $55,000. A financial revenue modeling tool is a powerful adjunct in understanding economics of an inpatient IR consultation service. Sensitivity and scenario analyses demonstrate a wide range of revenue potential and uncover levers for financial optimization. Copyright © 2016 SIR. Published by Elsevier Inc. All rights reserved.

Designing pharmacy services based on grocery store patron preferences.

Science.gov (United States)

Lindstrom, Nicolette S Raya; Casper, Kristin A; Green, Tara R; Pedersen, Craig A

2007-01-01

To assess preferences of grocery store patrons concerning pharmacy services and identify study participant characteristics that may predict the success of pharmacy services in the community setting. Self-administered survey. Central Ohio from December 16, 2005, to January 12, 2006. 163 grocery store patrons. Eight grocery store survey events. Responses to survey items about (1) perceived importance of 28 pharmacy services, (2) identification of the 3 most important services, (3) frequency of grocery store and pharmacy use, (4) preferred methods of advertising pharmacy services, and (5) socioeconomic demographics. Preferred services delineated by various demographics also were analyzed. A total of 163 surveys were returned from study participants. Nine services appeared in both the top 12 overall preferred services and the 12 highest-ranked services. Statistically significant differences were observed among services ranked as important or very important by age, race, employment, income, caregiver status, and prescription drug coverage status. The three advertising tools selected most frequently included: weekly grocery store ads (68.6%), in-store signs (51.0%), and flyers attached to prescription bags (36.0%). Grocery store patrons would like a wide range of nontraditional pharmacy services that could be implemented into community pharmacies. Pharmacies in grocery stores need to provide both traditional and expanded pharmacy services to meet the desires and expectations of current and potential patients, and expanded marketing methods should be considered.

Policy Directions for U. S. Agriculture; Long-Range Choices in Farming and Rural Living.

Science.gov (United States)

Clawson, Marion

A comprehensive view of agriculture is presented in this volume written to aid critical re-examination of long-range agricultural policy. Farm people, rural institutions and services, rural towns, the spatial organization of agriculture, and its capital structure, in addition to the usual subjects of agricultural output, demand, trade, price, and…

Ranging Behaviour of Commercial Free-Range Broiler Chickens 2: Individual Variation.

Science.gov (United States)

Taylor, Peta S; Hemsworth, Paul H; Groves, Peter J; Gebhardt-Henrich, Sabine G; Rault, Jean-Loup

2017-07-20

Little is known about broiler chicken ranging behaviour. Previous studies have monitored ranging behaviour at flock level but whether individual ranging behaviour varies within a flock is unknown. Using Radio Frequency Identification technology, we tracked 1200 individual ROSS 308 broiler chickens across four mixed sex flocks in two seasons on one commercial farm. Ranging behaviour was tracked from first day of range access (21 days of age) until 35 days of age in winter flocks and 44 days of age in summer flocks. We identified groups of chickens that differed in frequency of range visits: chickens that never accessed the range (13 to 67% of tagged chickens), low ranging chickens (15 to 44% of tagged chickens) that accounted for range visits and included chickens that used the range only once (6 to 12% of tagged chickens), and high ranging chickens (3 to 9% of tagged chickens) that accounted for 33 to 50% of all range visits. Males spent longer on the range than females in winter ( p ranging behaviour may help optimise ranging opportunities in free-range systems and is important to elucidate the potential welfare implications of ranging.

Broadband Internet Based Service to Passengers and Crew On-board Aircraft

Science.gov (United States)

Azzarelli, Tony

2003-07-01

The Connexion by BoeingSM (CbB) global network will provide broadband information services to aircraft passengers and crews. Through this Ku-band (14 GHz (uplink) and 11/12 GHz (downlink)) satellite-based system, aircraft passengers and crew will no longer be limited to pre-packaged services, but instead will be able to access the full range of broadband services from their seats using their laptop, PDA or the on-board IFE console.The kind of services offered to passengers are based on the internet/intranet access via their own laptops and PDA (using Ethernet wired cable, or wireless 802.11b access), while those offered to the crew can range between various crew application (such as weather updates and travel information) and aircraft health monitoring.The CbB system is divided into four basic layers of infrastructure:(1) an airborne segment, i.e. the Aircraft Earth Station (AES) consisting of proprietary high gain antenna, transceivers and other on-board subsystems providing a nominal return link data rate of 1 Mbps and a forward link data rates up to 20 Mbps;(2) a space segment consisting of leased satellite transponders on existing in-orbit Geostationary satellites;(3) a ground segment consisting of one or more leased satellite land earth stations (LESs) and redundant interconnection facilities; and;(4) a network operations centre (NOC) segment.During 2003, trials with Lufthansa (DLH) and British Airways (BA) have proved very successful. This has resulted in the recent signing of an agreement with Lufthansa which calls for the Connexion by BoeingSM service to be installed on Lufthansa's fleet of approximately 80 long-haul aircraft, including Boeing 747-400 and Airbus A330 and A340 aircraft, beginning in early 2004. BA is expected to follow soon. In addition to the successful recent service demonstrations, both Japan Airlines (JAL) and Scandinavian Airlines System (SAS) have announced their intent to install the revolutionary service on their long-range aircraft.

Integration of TB and ART services fails to improve TB treatment ...

African Journals Online (AJOL)

The median CD4+ count of HIV-positive patients was 152 cells/μl (interquartile range (IQR) 71 - 277) for integrated facilities and 148 cells/μl (IQR 67 - 260) for single-service facilities. There was no statistical difference in the TB treatment outcome profile between integrated and single-service facilities for all TB patients (p=0.

Religious institutions and the politics of access to basic services in displacement contexts

DEFF Research Database (Denmark)

Lauterbach, Karen

This paper provides a study of religious institutions as service providers in contexts of crises and displacement. Religious institutions, as well as other non-state institutions, provide access to a vast range of resources and services (such as food, housing, clothes, counseling, money, and access...... to networks). In contexts of displacement access to basic services is formally regulated by one’s status (e.g. as refugee or national citizen) and by physical location (e.g. in settlements/camps or urban areas). The paper discusses what role religious institutions play when access to services provided...... by the state or the international humanitarian system is limited or non-existent and what kind of relations of exchange that is at stake. Empirically the project deals with Congolese churches in Kampala, Uganda of which many pastors and members have refugee status. The paper analyses the range and categories...

Improving service quality in NHS Trust hospitals: lessons from the hotel sector.

Science.gov (United States)

Desombre, T; Eccles, G

1998-01-01

This article looks to review recent practice undertaken within the UK hotel sector to improve customer service, and suggests ideals that could be implemented within National Health (NHS) Trust hospitals. At a time of increasing competition, hotel firms are using service enhancement as a means to gain competitive advantage, and therefore developing a range of techniques to measure levels of service quality improvement. With continued change in the health service, where greater focus now lies with patient satisfaction, so there is a requirement for managers to adapt techniques presently being offered in other service industries to improve levels of customer service and ensure patients are targeted to define their levels of satisfaction.

Using Service Scenarios to Model Business Services

DEFF Research Database (Denmark)

Bækgaard, Lars

The purpose of the paper is to present and evaluate the notion of service scenarios. A service is work done by a service executor in interaction with a service consumer. A service scenario is a model of a service system and the roles that are played by the actors participating and interacting...... during the execution of a service. The model represents the roles and the interactions between the participants. Service scenarios can be used to model specific services and roles played by human beings and IT systems in the execution of services. The use of service scenarios is demonstrated by means...... of a case study in a public library. The case study indicates that service systems should be understood as socio-technical systems in which service executors and service consumers co-create value in mutual interaction with each other and with a set of shared resources....

Global fund financing of tuberculosis services delivery in prisons.

Science.gov (United States)

Lee, Donna; Lal, S S; Komatsu, Ryuichi; Zumla, Alimuddin; Atun, Rifat

2012-05-15

Despite concerted efforts to scale up tuberculosis control with large amounts of international financing in the last 2 decades, tuberculosis continues to be a social issue affecting the world's most marginalized and disadvantaged communities. This includes prisoners, estimated at about 10 million globally, for whom tuberculosis is a leading cause of mortality and morbidity. The Global Fund to Fight AIDS, Tuberculosis and Malaria has emerged as the single largest international donor for tuberculosis control, including funding support in delivering tuberculosis treatment for the confined population. The Global Fund grants database, with an aggregate approved investment of $21.7 billion in 150 countries by the end of 2010, was reviewed to identify tuberculosis and human immunodeficiency virus/tuberculosis grants and activities that monitored the delivery of tuberculosis treatment and support activities in penitentiary settings. The distribution and trend of number of countries with tuberculosis prison support was mapped by year, geographic region, tuberculosis or multidrug-resistant tuberculosis burden, and prison population rate. We examined the types of grant recipients managing program delivery, their performance, and the nature and range of services provided. Fifty-three of the 105 countries (50%) with Global Fund-supported tuberculosis programs delivered services within prison settings. Thirty-two percent (73 of 228) of tuberculosis grants, representing $558 million of all disbursements of Global Fund tuberculosis support by the end of 2010, included output indicators related to tuberculosis services delivered in prisons. Nearly two-thirds (64%) of these grants were implemented by governments, with the remaining by civil society and other partners. In terms of services, half (36 of 73) of grants provided diagnosis and treatment and an additional 27% provided screening and monitoring of tuberculosis for prisoners. The range of services tracked was limited in scope

Forensic Service Supply by Audit Firms: Classification, Market, Methods, and Prior Research

OpenAIRE

Quick, Reiner

2017-01-01

Provision of non-audit services is of increasing economic importance for audit firms Especially provision to non-audit clients Wide range of offered services From detection to prevention, from bribery to fraud to violation of code of conduct Small, but growing market with Big 4 as clear leaders Wide variety of backgrounds of forensic services professionals Consequently, diverse portfolio of methods Most research focuses on fraud with some high-quality publications Miss...

Forest-land conversion, ecosystem services, and economic issues for policy: a review

Science.gov (United States)

Robert A. Smail; David J. Lewis

2009-01-01

The continued conversion and development of forest land pose a serious threat to the ecosystem services derived from forested landscapes. We argue that developing an understanding of the full range of consequences from forest conversion requires understanding the effects of such conversion on both components of ecosystem services: products and processes....

Evaluation of services of the integrative health clinic in Hong Kong.

Science.gov (United States)

Chung, Joanne W Y; Chung, Louisa M Y; Kwok, Nedra W L; Wong, Thomas K S

2008-10-01

(i) To provide a profile of the clients who have used the Integrative Health Clinic's services, (ii) to determine the clients' extent of satisfaction with the services received and (iii) to assess whether integrative therapies can/should be recommended to other clinics. Based on the integration of various health paradigms and the use of health promotion strategies, our Integrative Health Clinic in Hong Kong provides a range of different therapies for integrated symptom management. The integrative therapies are derived from conventional, complementary and alternative medicine. Design. Postal survey, followed by routine data analysis. Hong Kong Chinese clients attending a residential community health clinic were surveyed about health status and satisfaction towards the services received. A total of 489 clients (30.8% were male and 69.2% female) were registered with the clinic during the study period. The mean age (SD) was 47.8 (15.4) years. The customer satisfaction survey found that traditional Chinese medicine consultation was the most frequently used modality of the Integrative Health Clinic, followed by pain management. Out of the 489 clients, those who attended the Integrative Health Clinic only once in the study period for an annual health assessment and those who died during the period were excluded from the survey, giving a total of 276 eligible clients. Out of the 276 clients, 52.5% (128) responded to the survey that asked them to evaluate their satisfaction with the services received at the clinic and the performance of the clinic's practitioners who interacted with them. For practitioner performance, the percentage of respondents who gave a rating of satisfaction was found to range between 86.3-64.3%, while the percentage of respondents who gave a rating of dissatisfaction ranged from 13.7-35.7%. Overall, the survey found that most aspects of the Integrative Health Clinic's services were rated as satisfactory. The overwhelming satisfaction of clients with

Traumatic Brain Injury service (TBI) Service

Data.gov (United States)

Department of Veterans Affairs — This Service provides access to Tramatic Brain injury patient data consult notes. The service also provides one write service method writeNote. The Service supports...

Service Offering at Electrical Equipment Manufacturers

Directory of Open Access Journals (Sweden)

Lucie Kaňovská

2015-09-01

Full Text Available Purpose of the article: The aim of the paper is to uncover ways of managing service offering provided by electrical equipment manufactures in the Czech Republic. The segment is extremely important for Czech industry nowadays, especially because of many companies being subcontractors for the car industry and mechanical engineering. The producers of electric equipment comply with the Czech industry classification CZ-NACE 27. Methodology/methods: The questionnaire in the form of the Likert scale was prepared to gather information about customer services. The respondents were usually directors or managers, e.g. employees with high competencies of knowing customer services in this particular market. The total of 22 companies were included in the survey. Research was focused on the following industries classifications belonging to CZ-NACE 27: CZ-NACE 27, CZ-NACE 271 and CZ-NACE 273. According to Czech Statistical Office the total number of companies belonging to these 3 segments is 136. It means 16,2% companies belonging to CZ-NACE 27 participated in our research. Basic statistical methods were used to analyse the complete database. Scientific aim: The paper deals with the problem of service offering provided by today’s manufacturers. Global understanding of services that manufacturers really develop, sell, deliver and manage is still limited. Findings: Managing service offering provided by today‘s manufacturers shows that 1 Manufacturers not offer only tangible products, but also wide range of services and even information and support. 2 New products are not designed only according to company technicians, but also according to their customers. Their products and services are developed, tested and improved according to their needs. 3 Services provide complex customer care from time product selection to its end. Conclusions: Manufacturers of tangible products need to enlarge their product offering to be able to satisfy customers. Therefore

Analysis of tangible and intangible hotel service quality components

Directory of Open Access Journals (Sweden)

Marić Dražen

2016-01-01

Full Text Available The issue of service quality is one of the essential areas of marketing theory and practice, as high quality can lead to customer satisfaction and loyalty, i.e. successful business results. It is vital for any company, especially in services sector, to understand and grasp the consumers' expectations and perceptions pertaining to the broad range of factors affecting consumers' evaluation of services, their satisfaction and loyalty. Hospitality is a service sector where the significance of these elements grows exponentially. The aim of this study is to identify the significance of individual quality components in hospitality industry. The questionnaire used for gathering data comprised 19 tangible and 14 intangible attributes of service quality, which the respondents rated on a five-degree scale. The analysis also identified the factorial structure of the tangible and intangible elements of hotel service. The paper aims to contribute to the existing literature by pointing to the significance of tangible and intangible components of service quality. A very small number of studies conducted in hospitality and hotel management identify the sub-factors within these two dimensions of service quality. The paper also provides useful managerial implications. The obtained results help managers in hospitality to establish the service offers that consumers find the most important when choosing a given hotel.

Controlling outsourced service delivery : Managing service quality in business service triads

NARCIS (Netherlands)

van Iwaarden, J.; van der Valk, W.

2013-01-01

Organisations are increasingly sourcing services that become part of their value proposition to their (business) customers from external providers. Often, these services are directly delivered by the service provider to the customer. The buying organisation, service provider and customer operate in

The architecture of the Cassini division

Science.gov (United States)

Hedman, M.M.; Nicholson, P.D.; Baines, K.H.; Buratti, B.J.; Sotin, Christophe; Clark, R.N.; Brown, R.H.; French, R.G.; Marouf, E.A.

2010-01-01

The Cassini Division in Saturn's rings contains a series of eight named gaps, three of which contain dense ringlets. Observations of stellar occultations by the Visual and Infrared Mapping Spectrometer onboard the Cassini spacecraft have yielded 40 accurate and precise measurements of the radial position of the edges of all of these gaps and ringlets. These data reveal suggestive patterns in the shapes of many of the gap edges: the outer edges of the five gaps without ringlets are circular to within 1 km, while the inner edges of six of the gaps are eccentric, with apsidal precession rates consistent with those expected for eccentric orbits near each edge. Intriguingly, the pattern speeds of these eccentric inner gap edges, together with that of the eccentric Huygens Ringlet, form a series with a characteristic spacing of 006 day-1. The two gaps with non-eccentric inner edges lie near first-order inner Lindblad resonances (ILRs) with moons. One such edge is close to the 5:4 ILR with Prometheus, and the radial excursions of this edge do appear to have an m = 5 component aligned with that moon. The other resonantly confined edge is the outer edge of the B ring, which lies near the 2:1 Mimas ILR. Detailed investigation of the B-ring-edge data confirm the presence of an m = 2 perturbation on the B-ring edge, but also show that during the course of the Cassini Mission, this pattern has drifted backward relative to Mimas. Comparisons with earlier occultation measurements going back to Voyager suggest the possibility that the m = 2 pattern is actually librating relative to Mimas with a libration frequency L 006 day-1 (or possibly 012 day -1). In addition to the m = 2 pattern, the B-ring edge also has an m = 1 component that rotates around the planet at a rate close to the expected apsidal precession rate (?? ?? ?? B ??? 5.??06 day -1). Thus, the pattern speeds of the eccentric edges in the Cassini Division can be generated from various combinations of the pattern speeds

Bluetooth enables in-door mobile location services

DEFF Research Database (Denmark)

Thongthammachart, Saowanee; Olesen, Henning

2003-01-01

Several technologies can be applied to enable mobile location services, but most of them suffer from limited accuracy and availability. GPS can solve the problem of determining the location of users in most outdoor situations, but an end-user position inside a building cannot be pinpointed. Other...... mobile location techniques can also provide the user's position, but the accuracy is rather low. In order to improve the accuracy and make location-based services really attractive, existing approaches must be supplemented by new technologies. Wireless short-range technologies like Bluetooth could...... be candidates for solving these problems. This paper shows that Bluetooth can act as a key enabler of mobile location services in an in-door environment. The advantage of Bluetooth technology is, that it can provide rather precise location data inside a building or hotspot area, while the Bluetooth terminal...

Forms, functions, and foibles of humor used in AIDS service organizations.

Science.gov (United States)

Kosenko, Kami A; Rintamaki, Lance S

2010-01-01

Research has indicated that HIV service providers commonly use humor to cope with work-related stress; however, little is known about the forms and functions of humor used by these professionals. In this study, 25 HIV service providers from five AIDS service organizations were interviewed about their use of humor. Participants described five primary types of humor as prevalent within AIDS service organizations and noted that humor served a variety of functions, which were either adaptive or maladaptive. Adaptive functions included boosting morale and reducing tension, whereas maladaptive functions ranged from masking emotions to alienating certain groups. Results emphasized the importance of context in the study of humor use and the need for continued investigations of the stress and coping of HIV service providers.

8th International KES Conference on Intelligent Interactive Multimedia : Systems and Services

CERN Document Server

Howlett, Robert; Jain, Lakhmi; Gallo, Luigi; Pietro, Giuseppe

2015-01-01

Intelligent interactive multimedia systems and services will be ever more important in computer systems. Nowadays, computers are widespread and computer users range from highly qualified scientists to non-computer expert professionals. Therefore, designing dynamic personalization and adaptivity methods to store, process, transmit and retrieve information is critical for matching the technological progress with the consumer needs. This book contains the contributions presented at the eighth international KES conference on Intelligent Interactive Multimedia: Systems and Services, which took place in Sorrento, Italy, June 17-19, 2015. It contains 33 peer-reviewed scientific contributions that focus on issues ranging from intelligent image or video storage, retrieval, transmission and analysis to knowledge-based technologies, from advanced information technology architectures for video processing and transmission to advanced functionalities of information and knowledge-based services. We believe that this book w...

Contracting for Public Services

DEFF Research Database (Denmark)

Greve, Carsten

strategic purchasing understanding markets communicating the contracting decision designing and drafting the contract the role of the consumer the regulation of service provision Illustrated throughout with practitioner case-studies from a range of OECD countries, this book presents an important new......Insightful and comprehensive and covering new subjects like globalization and IT, this text, international in its approach, provides a thorough introduction to the key phases of the contracting process and the skills required by managers in its implementation. These include: policy for contracting...

Moving beyond the exchange value in the nonmarket valuation of ecosystem services

Science.gov (United States)

Karen E. Allen; Rebecca Moore

2016-01-01

There has been much discussion across the ecosystem services literature as to the role of economic valuation in identifying ecosystem service values and shaping policy. This article demonstrates a non-typical use of a nonmarket valuation technique known as the stated choice experiment (CE) for understanding a range of public preferences for stream-related...

Financing family planning services: is categorical legislation still needed?

Science.gov (United States)

Mcfarlane, D R; Meier, K J

1991-01-01

Federal and state funds have provided for family planning services in American since the 1960s. Since 1976, services have been funded principally through federal statutes Title X of the Public Health Service Act and Titles V, XIX, and XX of the Social Security Act as well as various state appropriations. While these statutes aim to ensure that women of lower socioeconomic status enjoy access to reproductive health care services, levels of public expenditure in this area vary widely among states. In 1987, public family planning expenditures/woman at risk ranged from $60.16 in Wisconsin to $9.41 in Florida. Within this range of expenditures, the relative importance of each funding source per state varies widely. States with the most robust Title XIX programs, Medicaid, however, have highest per woman family planning expenditures. Upon reviewing the complement of public funding sources and how they are spent at the state level, the authors argue that categorical legislation is still needed to protect access to contraceptive services in America. In particular, of funds from supporting statues, Medicaid is distributed most equitable across the country. These funds paid for 36% of all public outlays for family planning in 1987. Without categorical legislation, however, Medicaid is insufficient to maintain the national family planning effort; the 1987 contribution of $10.49/woman at risk of unwanted pregnancy was insufficient to provide minimum services. Title X requires grantees to follow regulations which ensure state uniformity of quality and service distribution; submission of annual 5-year plans to Congress on how family planning goals will be achieved; and also authorizes monies for training and research. Despite political attacks, family planning funding must remain separate from maternal and child health programs. Such independence will keep these services politically visible; allow use of the more extensive family planning delivery system; catalyze states to

Supporting good practice in the provision of services to people with comorbid mental health and alcohol and other drug problems in Australia: describing key elements of good service models

Directory of Open Access Journals (Sweden)

Canaway Rachel

2010-12-01

Full Text Available Abstract Background The co-occurrence of mental illness and substance use problems (referred to as "comorbidity" in this paper is common, and is often reported by service providers as the expectation rather than the exception. Despite this, many different treatment service models are being used in the alcohol and other drugs (AOD and mental health (MH sectors to treat this complex client group. While there is abundant literature in the area of comorbidity treatment, no agreed overarching framework to describe the range of service delivery models is apparent internationally or at the national level. The aims of the current research were to identify and describe elements of good practice in current service models of treatment of comorbidity in Australia. The focus of the research was on models of service delivery. The research did not aim to measure the client outcomes achieved by individual treatment services, but sought to identify elements of good practice in services. Methods Australian treatment services were identified to take part in the study through a process of expert consultation. The intent was to look for similarities in the delivery models being implemented across a diverse set of services that were perceived to be providing good quality treatment for people with comorbidity problems. Results A survey was designed based on a concept map of service delivery devised from a literature review. Seventeen Australian treatment services participated in the survey, which explored the context in which services operate, inputs such as organisational philosophy and service structure, policies and procedures that guide the way in which treatment is delivered by the service, practices that reflect the way treatment is provided to clients, and client impacts. Conclusions The treatment of people with comorbidity of mental health and substance use disorders presents complex problems that require strong but flexible service models. While the treatment

Costs along the service cascades for HIV testing and counselling and prevention of mother-to-child transmission

Science.gov (United States)

Bautista-Arredondo, Sergio; Sosa-Rubí, Sandra G.; Opuni, Marjorie; Contreras-Loya, David; Kwan, Ada; Chaumont, Claire; Chompolola, Abson; Condo, Jeanine; Galárraga, Omar; Martinson, Neil; Masiye, Felix; Nsanzimana, Sabin; Ochoa-Moreno, Ivan; Wamai, Richard; Wang’ombe, Joseph

2016-01-01

Objective: We estimate facility-level average annual costs per client along the HIV testing and counselling (HTC) and prevention of mother-to-child transmission (PMTCT) service cascades. Design: Data collected covered the period 2011–2012 in 230 HTC and 212 PMTCT facilities in Kenya, Rwanda, South Africa, and Zambia. Methods: Input quantities and unit prices were collected, as were output data. Annual economic costs were estimated from the service providers’ perspective using micro-costing. Average annual costs per client in 2013 United States dollars (US$) were estimated along the service cascades. Results: For HTC, average cost per client tested ranged from US$5 (SD US$7) in Rwanda to US$31 (SD US$24) in South Africa, whereas average cost per client diagnosed as HIV-positive ranged from US$122 (SD US$119) in Zambia to US$1367 (SD US$2093) in Rwanda. For PMTCT, average cost per client tested ranged from US$18 (SD US$20) in Rwanda to US$89 (SD US$56) in South Africa; average cost per client diagnosed as HIV-positive ranged from US$567 (SD US$417) in Zambia to US$2021 (SD US$3210) in Rwanda; average cost per client on antiretroviral prophylaxis ranged from US$704 (SD US$610) in South Africa to US$2314 (SD US$3204) in Rwanda; and average cost per infant on nevirapine ranged from US$888 (SD US$884) in South Africa to US$2359 (SD US$3257) in Rwanda. Conclusion: We found important differences in unit costs along the HTC and PMTCT service cascades within and between countries suggesting that more efficient delivery of these services is possible. PMID:27753679

Green infrastructure and ecosystem services – is the devil in the detail?

Science.gov (United States)

Cameron, Ross W. F.; Blanuša, Tijana

2016-01-01

Background Green infrastructure is a strategic network of green spaces designed to deliver ecosystem services to human communities. Green infrastructure is a convenient concept for urban policy makers, but the term is used too generically and with limited understanding of the relative values or benefits of different types of green space and how these complement one another. At a finer scale/more practical level, little consideration is given to the composition of the plant communities, yet this is what ultimately defines the extent of service provision. This paper calls for greater attention to be paid to urban plantings with respect to ecosystem service delivery and for plant science to engage more fully in identifying those plants that promote various services. Scope Many urban plantings are designed based on aesthetics alone, with limited thought on how plant choice/composition provides other ecosystem services. Research is beginning to demonstrate, however, that landscape plants provide a range of important services, such as helping mitigate floods and alleviating heat islands, but that not all species are equally effective. The paper reviews a number of important services and demonstrates how genotype choice radically affects service delivery. Conclusions Although research is in its infancy, data are being generated that relate plant traits to specific services, thereby helping identify genotypes that optimize service delivery. The urban environment, however, will become exceedingly bland if future planting is simply restricted to monocultures of a few ‘functional’ genotypes. Therefore, further information is required on how to design plant communities where the plants identified (1) provide more than a single benefit (multifunctionality), (B) complement each other in maximizing the range of benefits that can be delivered in one location, and (3) continue to maintain public acceptance through diversity. The identification/development of functional

The Dilemma of Service Productivity and Service Innovation: An Empirical Exploration in Financial Services.

Science.gov (United States)

Aspara, Jaakko; Klein, Jan F; Luo, Xueming; Tikkanen, Henrikki

2018-05-01

We conduct a systematic exploratory investigation of the effects of firms' existing service productivity on the success of their new service innovations. Although previous research extensively addresses service productivity and service innovation, this is the first empirical study that bridges the gap between these two research streams and examines the links between the two concepts. Based on a comprehensive data set of new service introductions in a financial services market over a 14-year period, we empirically explore the relationship between a firm's existing service productivity and the firm's success in introducing new services to the market. The results unveil a fundamental service productivity-service innovation dilemma: Being productive in existing services increases a firm's willingness to innovate new services proactively but decreases the firm's capabilities of bringing these services to the market successfully. We provide specific insights into the mechanism underlying the complex relationship between a firm's productivity in existing services, its innovation proactivity, and its service innovation success. For managers, we not only unpack and elucidate this dilemma but also demonstrate that a focused customer scope and growth market conditions may enable firms to mitigate the dilemma and successfully pursue service productivity and service innovation simultaneously.

Academic Service Climate as a Source of Competitive Advantage: Leverage for University Administrators

Science.gov (United States)

Martin, Angela; Kennedy, Barbara; Stocks, Belinda

2006-01-01

The psychological climate literature examines links between facets of climate, such as service orientation and a range of individual and organisational outcomes including work attitudes and performance. This study investigated the relationship between the service climate of an Australian university and outcomes important to its key stakeholders. A…

Women as managers in the health services

Directory of Open Access Journals (Sweden)

Jocelyne Kane Berman

1989-09-01

Full Text Available Despite their numerical superiority women do not occupy positions o f power and authority in the health services generally. This is perceived as being due to a variety of factors which prevent women from realising their ful l potential as managers. In other parts of the world, as well as in South Africa, middle class white males have dominated health services, since medicine became a form al science, usurping the traditional role of women healers. Some research indicates that women are inclined to practice “feminine " management styles. It is suggested that the femine I masculine dichotomy is artificial and that qualities which ensure effective management should not be regarded as genderlinked. Leaders in the health services should strive for interdisciplinary, mixed-gender education and training at all levels. Identification and development of management potential in women health-care professionals, role-modelling and sponsor-mentor relationships should be encouraged to allow women to acquire the full range of management skills and to achieve positions of power and authority in the health services.

Equity and financing for sexual and reproductive health service delivery: current innovations.

Science.gov (United States)

Montagu, Dominic; Graff, Maura

2009-07-01

National and international decisions on financing for sexual and reproductive health (SRH) services have profound effects on the type, unit costs and distribution of SRH commodities and services produced, and on their availability and consumption. Much international and national funding is politically driven and is doing little for equity and quality improvement. Financing remains a significant challenge in most developing countries and demands creative responses. While no "one-size-fits-all" solution exists, there are numerous ongoing examples of successful innovations, many of which are focusing on resource pooling and on purchasing or subsidising SRH services. In this article we have used interviews, grey literature and presentations made at a range of recent public fora to identify new and innovative ways of financing SRH services so as to increase equity in developing countries. Because SRH services are often of low value as a personal good but high value as a public good, we summarise the issues from a societal perspective, highlighting the importance of financing and policy decisions for SRH services. We provide a structured overview of what novel approaches to financing appear to have positive effects in a range of developing countries. Targeting, government payment mechanisms, subsidy delivery and co-financing for sustainability are highlighted as showing particular promise. Examples are used throughout the article to illustrate innovative strategies.

Applying Lean and Six Sigma in financial service

NARCIS (Netherlands)

Does, R.J.M.M.; de Koning, H.; Anthony, J.; Kumar, M.

2006-01-01

Abstract Lean and Six Sigma have gone through parallel developments in recent years. Originally applied to a small range of industries, both approaches are now also used widely in healthcare, administration and service. A recent development is the integration of the two approaches. In this paper we

Utilization of Agro-meteorological Services among Arable Crop ...

African Journals Online (AJOL)

Thomas Kehinde Adesina

The study assessed arable crop farmers' utilization of agro-meteorological services in ... The Intergovernmental Panel on Climate Change, IPCC's Fourth ... the patterns of impact of climate change on agriculture can be classified into ... temperature rise causing fish to inhabit in different ranges. ..... Journal of Human Ecology.

FACTORS OF LOGISTICS AND FORWARDING SERVICE FORMATION AND DEVELOPMENT

Directory of Open Access Journals (Sweden)

Galina Kucheruk

2016-06-01

Full Text Available Purpose: Forwarding service is a key part of the system of goods movement and as such it provides realization of numerous services. Providing of new additional and unconventional services to cargo owners by haulers will extend the range of their clients, increase profits from sales, facilitate and accelerate the introduction of new transport technologies, increase stability and strength of relations in the transport market. Methods: We formulated requirements to be met by modern forwarding service. Carriage management should be based on logistics concept and its methods; comprehensive resource optimization of haulers and owners of cargo and other supply chain participants (insurance, financial ones, etc.. Optimization of the space-time chain, even involving freight forwarders (transport intermediaries, is a complex scientific and practical task. Results: We offer directions for development of forwarding additional and non-conventional service for forwarding system of cargo haulage service, which would also provide an opportunity to reduce transport time and increase service level. Discussion: A general scheme of products delivery to consumers contains a significant number of units-particular entities. It is important to analyze not only the position of economic entities in the market, but the features and capabilities of their interaction in major systemic tasks of forwarding service, quality and effective promotion of freight flows

Ontology for customer centric digital services and analytics

Science.gov (United States)

Keat, Ng Wai; Shahrir, Mohammad Shazri

2017-11-01

In computer science research, ontologies are commonly utilised to create a unified abstract across many rich and different fields. In this paper, we apply the concept to the customer centric domain of digital services analytics and present an analytics solution ontology. The essence is based from traditional Entity Relationship Diagram (ERD), which then was abstracted out to cover wider areas on customer centric digital services. The ontology we developed covers both static aspects (customer identifiers) and dynamic aspects (customer's temporal interactions). The structure of the customer scape is modeled with classes that represent different types of customer touch points, ranging from digital and digital-stamps which represent physical analogies. The dynamic aspects of customer centric digital service are modeled with a set of classes, with the importance is represented in different associations involving establishment and termination of the target interaction. The realized ontology can be used in development of frameworks for customer centric applications, and for specification of common data format used by cooperating digital service applications.

Analysis and algorithms for service parts supply chains

CERN Document Server

Muckstadt, John A

2005-01-01

Services requiring parts has become a $1.5 trillion business annually worldwide, creating a tremendous incentive to manage the logistics of these parts efficiently by making planning and operational decisions in a rational and rigorous manner. This book provides a broad overview of modeling approaches and solution methodologies for addressing service parts inventory problems found in high-powered technology and aerospace applications. The focus in this work is on the management of high cost, low demand rate service parts found in multi-echelon settings. This unique book, with its breadth of topics and mathematical treatment, begins by first demonstrating the optimality of an order-up-to policy [or (s-1,s)] in certain environments. This policy is used in the real world and studied throughout the text. The fundamental mathematical building blocks for modeling and solving applications of stochastic process and optimization techniques to service parts management problems are summarized extensively. A wide range o...

A Universal Design Approach to Government Service Delivery: The Case of ChileAtiende.

Science.gov (United States)

Sandoval, Leonardo

2016-01-01

A common challenge for government administrations that aim to improve the delivery of information and services to citizens is to go beyond a government-centred approach. By focusing on citizens and the needs of a wide range of citizens, Universal Design (UD) can help to increase the effectiveness, efficiency and satisfaction of government services. This paper examines the case of an internationally recognised Chilean government service delivery programme inspired by UD principles known as ChileAtiende ("ChileService"). A brief account of its creation and current status is provided.

IMPROVING LOGISTICS SERVICES THROUGH THE TECHNOLOGY USED IN FLEET MANAGEMENT

Directory of Open Access Journals (Sweden)

Mauro Vivaldini

2012-12-01

Full Text Available Outsourcing logistics has established itself in the area of the LSP (Logistics Service Provider, which offers a range of services to its customers. In this line, transportation is characterized as one of the most important services, and therefore efficient fleet management is essential for establishing a high level of customer service. With advances in technology and vehicle tracking systems, this approach of management has gained new possibilities for the improvement of logistics services. By studying the specific case of an LSP, this paper investigates the use of these technologies in the management of their business and services. The results indicate that the LSP seeks to increase its services and to streamline information in order to respond to customer needs in real time. It is also evident in this case under study that the combination of the technology available together with the fleet management system has become a distinguishing feature for this LSP, one which increases their skills and important information for both customers and business.

Marketing strategy for the BC oil and gas service sector

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-10-29

The British Columbia (BC) oil and gas service sector is collaborating with the BC Ministry of Energy and Mines (MEM) to enhance the competitiveness of oil and gas service providers in Northeast BC. The MEM agreed to provide one-time funding to develop this marketing strategy for the oil and gas sector, particularly for small to medium-sized companies with limited resources. This document is also a resource tool for suppliers in the sector that have developed and are implementing their own marketing plans and wish to enhance elements of their own plans. The strategy also outlines the potential role of associations in Northeast BC that represent the service sector. It links their marketing activities with the activities of individual service providers. Local service providers (LSP) include companies in a wide range of businesses such as drilling support, transportation, health and safety services, and construction. Six issues that directly impact the competitiveness of LSPs were also presented along with recommendations for participants in the service sector, associations and individual companies. tabs., figs., 11 appendices.

Marketing strategy for the BC oil and gas service sector

International Nuclear Information System (INIS)

2004-01-01

The British Columbia (BC) oil and gas service sector is collaborating with the BC Ministry of Energy and Mines (MEM) to enhance the competitiveness of oil and gas service providers in Northeast BC. The MEM agreed to provide one-time funding to develop this marketing strategy for the oil and gas sector, particularly for small to medium-sized companies with limited resources. This document is also a resource tool for suppliers in the sector that have developed and are implementing their own marketing plans and wish to enhance elements of their own plans. The strategy also outlines the potential role of associations in Northeast BC that represent the service sector. It links their marketing activities with the activities of individual service providers. Local service providers (LSP) include companies in a wide range of businesses such as drilling support, transportation, health and safety services, and construction. Six issues that directly impact the competitiveness of LSPs were also presented along with recommendations for participants in the service sector, associations and individual companies. tabs., figs., 11 appendices

First laser measurements to space debris in Poland

Science.gov (United States)

Lejba, Paweł; Suchodolski, Tomasz; Michałek, Piotr; Bartoszak, Jacek; Schillak, Stanisław; Zapaśnik, Stanisław

2018-05-01

The Borowiec Satellite Laser Ranging station (BORL 7811, Borowiec) being a part of the Space Research Centre of the Polish Academy of Sciences (SRC PAS) went through modernization in 2014-2015. One of the main tasks of the modernization was the installation of a high-energy laser module dedicated to space debris tracking. Surelite III by Continuum is a Nd:YAG pulse laser with 10 Hz repetition rate, a pulse width of 3-5 ns and a pulse energy of 450 mJ for green (532 nm). This new laser unit was integrated with the SLR system at Borowiec performing standard satellite tracking. In 2016 BORL 7811 participated actively to the observational campaigns related to the space debris targets from LEO region managed by the Space Debris Study Group (SDSG) of the International Laser Ranging Service (ILRS). Currently, Borowiec station regularly tracks 36 space debris from the LEO regime, including typical rocket bodies (Russian/Chinese) and cooperative targets like the inactive TOPEX/Poseidon, ENVISAT, OICETS and others. In this paper the first results of space debris laser measurements obtained by the Borowiec station in period August 2016 - January 2017 are presented. The results gained by the SRC PAS Borowiec station confirm the rotation of the defunct TOPEX/Poseidon satellite which spins with a period of approximately 10 s. The novelty of this work is the presentation of the sample results of the Chinese CZ-2C R/B target (NORAD catalogue number 31114) which is equipped (probably) with retroreflectors. Laser measurements to space debris is a very desirable topic for the next years, especially in the context of the Space Surveillance and Tracking (SST) activity. Some targets are very easy to track like defunct ENVISAT or TOPEX/Poseidon. On the other hand, there is a big population of different LEO targets with different orbital and physical parameters, which are challenging for laser ranging like small irregular debris and rocket boosters.

Green infrastructure and ecosystem services - is the devil in the detail?

Science.gov (United States)

Cameron, Ross W F; Blanuša, Tijana

2016-09-01

Green infrastructure is a strategic network of green spaces designed to deliver ecosystem services to human communities. Green infrastructure is a convenient concept for urban policy makers, but the term is used too generically and with limited understanding of the relative values or benefits of different types of green space and how these complement one another. At a finer scale/more practical level, little consideration is given to the composition of the plant communities, yet this is what ultimately defines the extent of service provision. This paper calls for greater attention to be paid to urban plantings with respect to ecosystem service delivery and for plant science to engage more fully in identifying those plants that promote various services. Many urban plantings are designed based on aesthetics alone, with limited thought on how plant choice/composition provides other ecosystem services. Research is beginning to demonstrate, however, that landscape plants provide a range of important services, such as helping mitigate floods and alleviating heat islands, but that not all species are equally effective. The paper reviews a number of important services and demonstrates how genotype choice radically affects service delivery. Although research is in its infancy, data are being generated that relate plant traits to specific services, thereby helping identify genotypes that optimize service delivery. The urban environment, however, will become exceedingly bland if future planting is simply restricted to monocultures of a few 'functional' genotypes. Therefore, further information is required on how to design plant communities where the plants identified (1) provide more than a single benefit (multifunctionality), (B) complement each other in maximizing the range of benefits that can be delivered in one location, and (3) continue to maintain public acceptance through diversity. The identification/development of functional landscape plants is an exciting and

Sustainable energy for all? Linking poor communities to modern energy services

Energy Technology Data Exchange (ETDEWEB)

Wilson, Emma; Godfrey Wood, Rachel; Garside, Ben

2012-12-15

This paper explores energy delivery models that provide sustainable and clean energy services to the poor. Four key building blocks are: the implementation process, including finance, resource sourcing, conversion and end use; support services (additional services such as training or micro-finance facilities); the enabling environment of policies, regulations and incentives; and the socio-cultural context including local norms and preferences, decision-making structures and levels of social cohesion. A range of products and services targeted at communities located in diverse socio-cultural and geographical contexts are covered. Useful experiences are shared that can help to replicate or scale up successful models that link the poor to modern energy markets. The case studies were selected to illustrate a range of energy products and services, diverse socio-cultural contexts, various business models and partnerships, and varying degrees of formality in the markets under consideration. All of the case studies reveal the challenges of reaching the very poorest even with pro-poor innovations put in place. The four case studies explored in the paper are: The Project for Renewable Energy in Rural Markets (PERMER), Argentina; Portable solar product companies (Tough Stuff and d.light) in southern Asia and sub-Saharan Africa; The Anagi stove in Sri Lanka; and, Micro-hydro development in Nepal (the Rural Energy Development Programme). Lessons learned are highlighted.

The Impact of a Customer Service Intervention and Facility Design on Firm Performance

OpenAIRE

Joanne M. Sulek; Mary R. Lind; Ann S. Marucheck

1995-01-01

The purpose of this research was to investigate the impact of a customer service intervention and store design on store performance within a regional food retailing chain. A longitudinal study examines the organization's implementation of a customer service intervention which utilized new service standards and customer feedback mechanisms. Moreover, the chain provided a natural experiment, since the forty-six stores in this chain represented three levels of facility design ranging from the tr...

An exploration of clinical interventions provided by pharmacists within a complex asthma service

OpenAIRE

Lemay, Kate S.; Saini, Bandana; Bosnic-Anticevich, Sinthia; Smith, Lorraine; Stewart, Kay; Emmerton, Lynne; Burton, Deborah L.; Krass, Ines; Armour, Carol L.

2015-01-01

Background: Pharmacists in Australia are accessible health care professionals, and their provision of clinical pharmacy interventions in a range of areas has been proven to improve patient outcomes. Individual clinical pharmacy interventions in the area of asthma management have been very successful. An understanding of the nature of these interventions will inform future pharmacy services. What we do not know is when pharmacists provide a complex asthma service, what elements of that service...

A Longitudinal Sociological Monitoring of Customers' Satisfaction with the Quality of Educational Services

Science.gov (United States)

Gaidukova, G. N.

2014-01-01

Research data on levels of satisfaction with educational services in a Russian university show room for improvement in such areas as vocational guidance work; range of opportunities in the choice of specialization and optional disciplines; availability of academic and methodological literature; the quality of food services; and amount of practical…

THE COMPARATIVE ANALYSIS REGARDING THE SERVICES OFFERED BY THE INTERNATIONAL HOTEL CHAINS FROM ROMANIA

OpenAIRE

CRISTINA FLESERIU

2010-01-01

The hotel services are a part from the tourism services, or can be defined as an independent offer. In the second place, the most important thing is the need of accommodation (probably also food and other additional services – conference room, recreational facilities, etc.) from those that are traveling for business or with some other personal problems. As follow, in Romania, all the hospitality business units must offer a range of additional services, with or without pay. Due to the fact tha...

SERVICE QUALITY IN THE PUBLIC SERVICE

OpenAIRE

Prabha Ramseook-Munhurrun; Soolakshna D. Lukea-Bhiwajee; Perunjodi Naidoo

2010-01-01

The purpose of this paper is to obtain a better understanding of the extent to which service quality is delivered within the Mauritian public service by drawing on front-line employees (FLE) and customer perceptions of service quality. The paper investigates how closely customer expectations of service and FLE perceptions of customer expectations match. SERVQUAL is used to measure service quality amongst FLE and customers in a major public sector department in Mauritius. The survey captures c...

Service registry design: an information service approach

NARCIS (Netherlands)

Ferreira Pires, Luis; Wang, J.; van Oostrum, Arjen; Wijnhoven, Alphonsus B.J.M.

2010-01-01

A service registry is a Service-Oriented Architecture (SOA) component that keeps a ‘catalogue’ of available services. It stores service specifications so that these specifications can be found by potential users. Discussions on the design of service registries currently focus on technical issues,

Global Framework for Climate Services (GFCS)

Science.gov (United States)

Lúcio, F.

2012-04-01

Climate information at global, regional and national levels and in timeframes ranging from the past, present and future climate is fundamental for planning, sustainable development and to help organizations, countries and individuals adopt appropriate strategies to adapt to climate variability and change. Based on this recognition, in 2009, the Heads of States and Governments, Ministers and Heads of Delegation representing more than 150 countries, 34 United Nations Organizations and 36 Governmental and non-Governmental international organizations, and more than 2500 experts present at the Third World Climate Conference (WCC - 3) unanimously agreed to develop the Global Framework for Climate Services (GFCS) to strengthen the production, availability, delivery and application of science-based climate prediction and services. They requested that a taskforce of high-level independent advisors be appointed to prepare a report, including recommendations on the proposed elements of the Framework and the next steps for its implementation. The high-level taskforce produced a report which was endorsed by the Sixteeth World Meteorological Congress XVI in May 2011. A process for the development of the implementation plan and the governance structure of the Global Framework for Climate Services (GFCS) is well under way being led by the World Meteorological Organization within the UN system. This process involves consultations that engage a broad range of stakeholders including governments, UN and international agencies, regional organizations and specific communities of practitioners. These consultations are being conducted to facilitate discussions of key issues related to the production, availability, delivery and application of climate services in the four priority sectors of the framework (agriculture, water, health and disaster risk reduction) so that the implementation plan of the Framework is a true reflection of the aspirations of stakeholders. The GFCS is envisaged as

MEMS/MOEMS foundry services at INO

Science.gov (United States)

García-Blanco, Sonia; Ilias, Samir; Williamson, Fraser; Généreux, Francis; Le Noc, Loïc; Poirier, Michel; Proulx, Christian; Tremblay, Bruno; Provençal, Francis; Desroches, Yan; Caron, Jean-Sol; Larouche, Carl; Beaupré, Patrick; Fortin, Benoit; Topart, Patrice; Picard, Francis; Alain, Christine; Pope, Timothy; Jerominek, Hubert

2010-06-01

In the MEMS manufacturing world, the "fabless" model is getting increasing importance in recent years as a way for MEMS manufactures and startups to minimize equipment costs and initial capital investment. In order for this model to be successful, the fabless company needs to work closely with a MEMS foundry service provider. Due to the lack of standardization in MEMS processes, as opposed to CMOS microfabrication, the experience in MEMS development processes and the flexibility of the MEMS foundry are of vital importance. A multidisciplinary team together with a complete microfabrication toolset allows INO to offer unique MEMS foundry services to fabless companies looking for low to mid-volume production. Companies that benefit from their own microfabrication facilities can also be interested in INO's assistance in conducting their research and development work during periods where production runs keep their whole staff busy. Services include design, prototyping, fabrication, packaging, and testing of various MEMS and MOEMS devices on wafers fully compatible with CMOS integration. Wafer diameters ranging typically from 1 inch to 6 inches can be accepted while 8-inch wafers can be processed in some instances. Standard microfabrication techniques such as metal, dielectric, and semiconductor film deposition and etching as well as photolithographic pattern transfer are available. A stepper permits reduction of the critical dimension to around 0.4 μm. Metals deposited by vacuum deposition methods include Au, Ag, Al, Al alloys, Ti, Cr, Cu, Mo, MoCr, Ni, Pt, and V with thickness varying from 5 nm to 2 μm. Electroplating of several materials including Ni, Au and In is also available. In addition, INO has developed and built a gold black deposition facility to answer customer's needs for broadband microbolometric detectors. The gold black deposited presents specular reflectance of less than 10% in the wavelength range from 0.2 μm to 100 μm with thickness ranging from

The research of the availability at cloud service systems

Science.gov (United States)

Demydov, Ivan; Klymash, Mykhailo; Kharkhalis, Zenoviy; Strykhaliuk, Bohdan; Komada, Paweł; Shedreyeva, Indira; Targeusizova, Aliya; Iskakova, Aigul

2017-08-01

This paper is devoted to the numerical investigation of the availability at cloud service systems. In this paper criteria and constraints calculations were performed and obtained results were analyzed for synthesis purposes of distributed service platforms based on the cloud service-oriented architecture such as availability and system performance index variations by defined set of the main parameters. The method of synthesis has been numerically generalized considering the type of service workload in statistical form by Hurst parameter application for each integrated service that requires implementation within the service delivery platform, which is synthesized by structural matching of virtual machines using combination of elementary servicing components up to functionality into a best-of-breed solution. As a result of restrictions from Amdahl's Law the necessity of cloud-networks clustering was shown, which makes it possible to break the complex dynamic network into separate segments that simplifies access to the resources of virtual machines and, in general, to the "clouds" and respectively simplifies complex topological structure, enhancing the overall system performance. In overall, proposed approaches and obtained results numerically justifying and algorithmically describing the process of structural and functional synthesis of efficient distributed service platforms, which under process of their configuring and exploitation provides an opportunity to act on the dynamic environment in terms of comprehensive services range and nomadic users' workload pulsing.

[The Engineering and Technical Services Directorate at the Glenn Research Center

Science.gov (United States)

Moon, James

2004-01-01

My name is James Moon and I am a senior at Tennessee State University where my major is Aeronautical and Industrial Technology with a concentration in industrial electronics. I am currently serving my internship in the Engineering and Technical Services Directorate at the Glenn Research Center (GRC). The Engineering and Technical Service Directorate provides the services and infrastructure for the Glenn Research Center to take research concepts to reality. They provide a full range of integrated services including engineering, advanced prototyping and testing, facility management, and information technology for NASA, industry, and academia. Engineering and Technical Services contains the core knowledge in Information Technology (IT). This includes data systems and analysis, inter and intranet based systems design and data security. Including the design and development of embedded real-time s o h a r e applications for flight and supporting ground systems, Engineering and Technical Services provide a wide range of IT services and products specific to the Glenn Research Center research and engineering community. In the 7000 Directorate I work directly in the 7611 organization. This organization is known as the Aviation Environments Technical Branch. My mentor is Vincent Satterwhite who is also the Branch Chief of the Aviation Environments Technical Branch. In this branch, I serve as the Assistant program manager of the Engineering Technology Program. The Engineering Technology Program (ETP) is one of three components of the High School L.E.R.C.I.P. This is an Agency-sponsored, eight-week research-based apprenticeship program designed to attract traditionally underrepresented high school students that demonstrate an aptitude for and interest in mathematics, science, engineering, and technology.

31 CFR 538.406 - Exportation of services; performance of service contracts; legal services.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exportation of services; performance of service contracts; legal services. 538.406 Section 538.406 Money and Finance: Treasury Regulations... SUDANESE SANCTIONS REGULATIONS Interpretations § 538.406 Exportation of services; performance of service...

The Dilemma of Service Productivity and Service Innovation

Science.gov (United States)

Aspara, Jaakko; Klein, Jan F.; Luo, Xueming; Tikkanen, Henrikki

2017-01-01

We conduct a systematic exploratory investigation of the effects of firms’ existing service productivity on the success of their new service innovations. Although previous research extensively addresses service productivity and service innovation, this is the first empirical study that bridges the gap between these two research streams and examines the links between the two concepts. Based on a comprehensive data set of new service introductions in a financial services market over a 14-year period, we empirically explore the relationship between a firm’s existing service productivity and the firm’s success in introducing new services to the market. The results unveil a fundamental service productivity-service innovation dilemma: Being productive in existing services increases a firm’s willingness to innovate new services proactively but decreases the firm’s capabilities of bringing these services to the market successfully. We provide specific insights into the mechanism underlying the complex relationship between a firm’s productivity in existing services, its innovation proactivity, and its service innovation success. For managers, we not only unpack and elucidate this dilemma but also demonstrate that a focused customer scope and growth market conditions may enable firms to mitigate the dilemma and successfully pursue service productivity and service innovation simultaneously. PMID:29706764

Protein analysis tools and services at IBIVU

Directory of Open Access Journals (Sweden)

Brandt Bernd W.

2011-06-01

Full Text Available During the last years several new tools applicable to protein analysis have made available on the IBIVU web site. Recently, a number of tools, ranging from multiple sequence alignment construction to domain prediction, have been updated and/or extended with services for programmatic access using SOAP. We provide an overview of these tools and their application.

Precise Range Determination Using Laser Ranging Data of LAGEOS

Directory of Open Access Journals (Sweden)

Kwang-Ryul Kim

1993-12-01

Full Text Available Satellite laser ranging observation of LAGEOS ¥± has been performed using the SLR System at Sheshan Laser Ranging Station, Shanghai Observatory. And we obtained 1,838 observational points The observed range data is corrected by means of system delay correction using ground target observation, atmospheric refraction delay correction, offset correction, general relativistic correction and tide correction including solid tide, polar tide and ocean tide. As a result, the determined range delay mean value is 19.12m and the mean internal accuracy by means of polynomial fitting and least square method is ¡¾7cm. Corrected observational points are 1,340 and noise ratio to total observational points is 27.1%

Operational Use of OGC Web Services at the Met Office

Science.gov (United States)

Wright, Bruce

2010-05-01

The Met Office has adopted the Service-Orientated Architecture paradigm to deliver services to a range of customers through Rich Internet Applications (RIAs). The approach uses standard Open Geospatial Consortium (OGC) web services to provide information to web-based applications through a range of generic data services. "Invent", the Met Office beta site, is used to showcase Met Office future plans for presenting web-based weather forecasts, product and information to the public. This currently hosts a freely accessible Weather Map Viewer, written in JavaScript, which accesses a Web Map Service (WMS), to deliver innovative web-based visualizations of weather and its potential impacts to the public. The intention is to engage the public in the development of new web-based services that more accurately meet their needs. As the service is intended for public use within the UK, it has been designed to support a user base of 5 million, the analysed level of UK web traffic reaching the Met Office's public weather information site. The required scalability has been realised through the use of multi-tier tile caching: - WMS requests are made for 256x256 tiles for fixed areas and zoom levels; - a Tile Cache, developed in house, efficiently serves tiles on demand, managing WMS request for the new tiles; - Edge Servers, externally hosted by Akamai, provide a highly scalable (UK-centric) service for pre-cached tiles, passing new requests to the Tile Cache; - the Invent Weather Map Viewer uses the Google Maps API to request tiles from Edge Servers. (We would expect to make use of the Web Map Tiling Service, when it becomes an OGC standard.) The Met Office delivers specialist commercial products to market sectors such as transport, utilities and defence, which exploit a Web Feature Service (WFS) for data relating forecasts and observations to specific geographic features, and a Web Coverage Service (WCS) for sub-selections of gridded data. These are locally rendered as maps or

The service Ouroboros: Designing personas service cycles

DEFF Research Database (Denmark)

Gudiksen, Sune Klok; Brandt, Eva

2014-01-01

Many companies investigate new business opportunities in a turn from product to service design. As service offerings expand over time and space, such notions as ‘customer journey’ or ‘service blueprint’ have been suggested to grasp and design the nature of the emergent services. However, we find ...... various customers’´service cycles....

Conceptual service architecture for adaptive mobile location services

DEFF Research Database (Denmark)

Schou, Saowanee

2008-01-01

This paper presents a conceptual service architecture for adaptive mobile location services designed to be used on the next generation wireless network. The developed service architecture consists of a set of concepts, principles, rules and guidelines for constructing, deploying, and operating...... the mobile location services. The service architecture identifies the components required to build the mobile location services and describes how these components are combined and how they should interact. As a means of exploring the developed conceptual service architecture, an illustrative case study...... of a new-concept tracking service is chosen to demonstrate the applicability of the architecture. Through the case study, the service request and response processes will be illustrated. New possible service functions provided by the developed service architecture will be examined and discussed...

Earth orientation from lunar laser ranging and an error analysis of polar motion services

Science.gov (United States)

Dickey, J. O.; Newhall, X. X.; Williams, J. G.

1985-01-01

Lunar laser ranging (LLR) data are obtained on the basis of the timing of laser pulses travelling from observatories on earth to retroreflectors placed on the moon's surface during the Apollo program. The modeling and analysis of the LLR data can provide valuable insights into earth's dynamics. The feasibility to model accurately the lunar orbit over the full 13-year observation span makes it possible to conduct relatively long-term studies of variations in the earth's rotation. A description is provided of general analysis techniques, and the calculation of universal time (UT1) from LLR is discussed. Attention is also given to a summary of intercomparisons with different techniques, polar motion results and intercomparisons, and a polar motion error analysis.

Investigating the Effects of Consumer Innovativeness, Service Quality and Service Switching Costs on Service Loyalty in the Mobile Phone Service Context

Directory of Open Access Journals (Sweden)

Farzana Quoquab

2016-02-01

Full Text Available The objective of this study is to examine the effects of consumer innovativeness, service quality, service switching costs and service satisfaction on service loyalty among mobile phone service users. A cross sectional survey was employed which yielded 535 responses. Structural equation modelling using the AMOS version 2.0 was utilized to test study the hypotheses. Test results reveal that service satisfaction, service switching costs and service quality are the three antecedents that directly influence service loyalty. However, consumer innovativeness does not have any direct effect on service loyalty. Moreover, service satisfaction is found to be a partial mediator between ‘service quality’ and ‘service loyalty’. Findings from this study will develop insights to enable policy-makers, managers and marketers to better strategize and effectively implement loyalty programs and prevent their customers from switching. This will enhance value creation for both their users and for the industry.

Managing service excellence. Internal customer service training

International Nuclear Information System (INIS)

McAnulty, P.C.

1991-01-01

WHO ARE OUR CUSTOMERS? Electric Users, regulators, vendors, suppliers, or our own employees? The answer is ALL exclamation point They are all customers. Regardless if they are external or internal customers, one must focus on quality of service delivery in order to maintain customer satisfaction. The most successful companies are quickly realizing that managing SERVICE EX NCE is our only future. For the next decade, the issue of service quality will exceed the issue of productivity. It is very easy to see that the business behind a utility is serving our electric consumers. However, internal customer service - service excellence to employees inside a company is the foundation for success. This paper describes a training program that is being implemented across Duke Power for employees on internal customer service. How we provide service to each other within a company impacts service quality to our external customers. This training refocuses behaviors and perceptions so to concentrate on quality service delivery to our internal customers - our employees. We all have positive and negative experiences with obtaining quality service by either external organizations or internal employees. Therefore, we start with a common foundation. Whether it be a supplier, vendor, or a station administrative group, we have experienced either excellent or poor customer service. All of us have potential in managing the delivery of excellent customer service. However, many of us may need new perspectives so to add depth with which we view and manage service excellence to our internal customers

Increase coverage of HIV and AIDS services in Myanmar

Directory of Open Access Journals (Sweden)

Bühler Markus

2008-03-01

Full Text Available Abstract Myanmar is experiencing an HIV epidemic documented since the late 1980s. The National AIDS Programme national surveillance ante-natal clinics had already estimated in 1993 that 1.4% of pregnant women were HIV positive, and UNAIDS estimates that at end 2005 1.3% (range 0.7–2.0% of the adult population was living with HIV. While a HIV surveillance system has been in place since 1992, the programmatic response to the epidemic has been slower to emerge although short- and medium-terms plans have been formulated since 1990. These early plans focused on the health sector, omitted key population groups at risk of HIV transmission and have not been adequately funded. The public health system more generally is severely under-funded. By the beginning of the new decade, a number of organisations had begun working on HIV and AIDS, though not yet in a formally coordinated manner. The Joint Programme on AIDS in Myanmar 2003–2005 was an attempt to deliver HIV services through a planned and agreed strategic framework. Donors established the Fund for HIV/AIDS in Myanmar (FHAM, providing a pooled mechanism for funding and significantly increasing the resources available in Myanmar. By 2006 substantial advances had been made in terms of scope and diversity of service delivery, including outreach to most at risk populations to HIV. More organisations provided more services to an increased number of people. Services ranged from the provision of HIV prevention messages via mass media and through peers from high-risk groups, to the provision of care, treatment and support for people living with HIV. However, the data also show that this scaling up has not been sufficient to reach the vast majority of people in need of HIV and AIDS services. The operating environment constrains activities, but does not, in general, prohibit them. The slow rate of service expansion can be attributed to the burdens imposed by administrative measures, broader constraints on

A Context-Aware S-Health Service System for Drivers

Directory of Open Access Journals (Sweden)

Jingkun Chang

2017-03-01

Full Text Available As a stressful and sensitive task, driving can be disturbed by various factors from the health condition of the driver to the environmental variables of the vehicle. Continuous monitoring of driving hazards and providing the most appropriate business services to meet actual needs can guarantee safe driving and make great use of the existing information resources and business services. However, there is no in-depth research on the perception of a driver’s health status or the provision of customized business services in case of various hazardous situations. In order to constantly monitor the health status of the drivers and react to abnormal situations, this paper proposes a context-aware service system providing a configurable architecture for the design and implementation of the smart health service system for safe driving, which can perceive a driver’s health status and provide helpful services to the driver. With the context-aware technology to construct a smart health services system for safe driving, this is the first time that such a service system has been implemented in practice. Additionally, an assessment model is proposed to mitigate the impact of the acceptable abnormal status and, thus, reduce the unnecessary invocation of the services. With regard to different assessed situations, the business services can be invoked for the driver to adapt to hazardous situations according to the services configuration model, which can take full advantage of the existing information resources and business services. The evaluation results indicate that the alteration of the observed status in a valid time range T can be tolerated and the frequency of the service invocation can be reduced.

Supporting the scientific lifecycle through cloud services

Science.gov (United States)

Gensch, S.; Klump, J. F.; Bertelmann, R.; Braune, C.

2014-12-01

Cloud computing has made resources and applications available for numerous use cases ranging from business processes in the private sector to scientific applications. Developers have created tools for data management, collaborative writing, social networking, data access and visualization, project management and many more; either for free or as paid premium services with additional or extended features. Scientists have begun to incorporate tools that fit their needs into their daily work. To satisfy specialized needs, some cloud applications specifically address the needs of scientists for sharing research data, literature search, laboratory documentation, or data visualization. Cloud services may vary in extent, user coverage, and inter-service integration and are also at risk of being abandonend or changed by the service providers making changes to their business model, or leaving the field entirely.Within the project Academic Enterprise Cloud we examine cloud based services that support the research lifecycle, using feature models to describe key properties in the areas of infrastructure and service provision, compliance to legal regulations, and data curation. Emphasis is put on the term Enterprise as to establish an academic cloud service provider infrastructure that satisfies demands of the research community through continious provision across the whole cloud stack. This could enable the research community to be independent from service providers regarding changes to terms of service and ensuring full control of its extent and usage. This shift towards a self-empowered scientific cloud provider infrastructure and its community raises implications about feasability of provision and overall costs. Legal aspects and licensing issues have to be considered, when moving data into cloud services, especially when personal data is involved.Educating researchers about cloud based tools is important to help in the transition towards effective and safe use. Scientists

Value-Added Electricity Services: New Roles for Utilities and Third-Party Providers

Energy Technology Data Exchange (ETDEWEB)

Blansfield, J. [Inst. for Electric Innovations, Washington, DC (United States); Wood, L. [Inst. for Electric Innovations, Washington, DC (United States); Katofsky, R. [Advanced Energy Economy, Washington, DC (United States); Stafford, B. [Advanced Energy Economy, Washington, DC (United States); Waggoner, D. [Advanced Energy Economy, Washington, DC (United States); Schwartz, L. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2017-10-30

New energy generation, storage, delivery, and end-use technologies support a broad range of value-added electricity services for retail electricity customers. Sophisticated energy management services, distributed generation coupled with storage, and electric vehicle charging are just a few examples of emerging offerings. Who should provide value-added services — utilities or third parties, or both, and under what conditions? What policy and regulatory changes may be needed to promote competition and innovation, to account for utility costs to enable these services, and to protect consumers? The report approaches the issues from three perspectives: utilities, third-party service providers, and consumers: -Jonathan Blansfield and Lisa Wood, Institute for Electric Innovation -Ryan Katofsky, Benjamin Stafford and Danny Waggoner, Advanced Energy Economy -National Association of State Utility Consumer Advocates

General Practitioners' Attitudes Toward a Web-Based Mental Health Service for Adolescents: Implications for Service Design and Delivery.

Science.gov (United States)

Subotic-Kerry, Mirjana; King, Catherine; O'Moore, Kathleen; Achilles, Melinda; O'Dea, Bridianne

2018-03-23

Anxiety disorders and depression are prevalent among youth. General practitioners (GPs) are often the first point of professional contact for treating health problems in young people. A Web-based mental health service delivered in partnership with schools may facilitate increased access to psychological care among adolescents. However, for such a model to be implemented successfully, GPs' views need to be measured. This study aimed to examine the needs and attitudes of GPs toward a Web-based mental health service for adolescents, and to identify the factors that may affect the provision of this type of service and likelihood of integration. Findings will inform the content and overall service design. GPs were interviewed individually about the proposed Web-based service. Qualitative analysis of transcripts was performed using thematic coding. A short follow-up questionnaire was delivered to assess background characteristics, level of acceptability, and likelihood of integration of the Web-based mental health service. A total of 13 GPs participated in the interview and 11 completed a follow-up online questionnaire. Findings suggest strong support for the proposed Web-based mental health service. A wide range of factors were found to influence the likelihood of GPs integrating a Web-based service into their clinical practice. Coordinated collaboration with parents, students, school counselors, and other mental health care professionals were considered important by nearly all GPs. Confidence in Web-based care, noncompliance of adolescents and GPs, accessibility, privacy, and confidentiality were identified as potential barriers to adopting the proposed Web-based service. GPs were open to a proposed Web-based service for the monitoring and management of anxiety and depression in adolescents, provided that a collaborative approach to care is used, the feedback regarding the client is clear, and privacy and security provisions are assured. ©Mirjana Subotic

Bandwidth Estimation in Wireless Lans for Multimedia Streaming Services

Directory of Open Access Journals (Sweden)

Heung Ki Lee

2007-01-01

Full Text Available The popularity of multimedia streaming services via wireless networks presents major challenges in the management of network bandwidth. One challenge is to quickly and precisely estimate the available bandwidth for the decision of streaming rates of layered and scalable multimedia services. Previous studies based on wired networks are too burdensome to be applied to multimedia applications in wireless networks. In this paper, a new method, IdleGap, is suggested to estimate the available bandwidth of a wireless LAN based on the information from a low layer in the protocol stack. We use a network simulation tool, NS-2, to evaluate our new method with various ranges of cross-traffic and observation times. Our simulation results show that IdleGap accurately estimates the available bandwidth for all ranges of cross-traffic (100 Kbps ∼ 1 Mbps with a very short observation time of 10 seconds.

Spatial Cognition and Range Use in Free-Range Laying Hens.

Science.gov (United States)

Campbell, Dana L M; Talk, Andrew C; Loh, Ziyang A; Dyall, Tim R; Lee, Caroline

2018-02-08

Radio-frequency identification tracking shows individual free-range laying hens vary in range use, with some never going outdoors. The range is typically more environmentally complex, requiring navigation to return to the indoor resources. Outdoor-preferring hens may have improved spatial abilities compared to indoor-preferring hens. Experiment 1 tested 32 adult ISA Brown hens in a T-maze learning task that showed exclusively-indoor birds were slowest to reach the learning success criterion ( p 0.05), the age that coincided with the onset of lay. Enriched birds that were faster to learn the maze task showed more range visits in the first 4 weeks of range access. Enriched and non-enriched birds showed no differences in telencephalon or hippocampal volume ( p > 0.05). Fear may reduce spatial abilities but further testing with more pen replicates per early rearing treatments would improve our understanding of the relationship between spatial cognitive abilities and range use.

Pre-Service Primary Teachers' Attitudes towards Inclusive Education

Science.gov (United States)

Varcoe, Linda; Boyle, Christopher

2014-01-01

Research has demonstrated that an important factor in the success of inclusive education is dependent upon teachers' attitudes. Based on this evidence, the present study investigated the impact of a range of teacher variables in association with training on primary pre-service teachers' attitudes by examining total inclusion scores, positive…

Temporal sketching as a method to balance service and experience design

DEFF Research Database (Denmark)

Vistisen, Peter; Poulsen, Søren Bolvig

2018-01-01

of a touchpoint’s interfaces, to a systemic perspective’s focus on actor maps and service blueprints. We propose video- and animation-based sketching as a way to use the temporal nature of both disciplines as a common language for zooming in and out of both micro, meso and macro levels of a service system design......This paper discusses the challenges of balancing service- and user experience design perspectives when engaging in the complexity of modern design processes. We argue this can be seen as a balance between different levels of socio-technical complexity – ranging from micro perspectives...

IoT Service Clustering for Dynamic Service Matchmaking.

Science.gov (United States)

Zhao, Shuai; Yu, Le; Cheng, Bo; Chen, Junliang

2017-07-27

As the adoption of service-oriented paradigms in the IoT (Internet of Things) environment, real-world devices will open their capabilities through service interfaces, which enable other functional entities to interact with them. In an IoT application, it is indispensable to find suitable services for satisfying users' requirements or replacing the unavailable services. However, from the perspective of performance, it is inappropriate to find desired services from the service repository online directly. Instead, clustering services offline according to their similarity and matchmaking or discovering service online in limited clusters is necessary. This paper proposes a multidimensional model-based approach to measure the similarity between IoT services. Then, density-peaks-based clustering is employed to gather similar services together according to the result of similarity measurement. Based on the service clustering, the algorithms of dynamic service matchmaking, discovery, and replacement will be performed efficiently. Evaluating experiments are conducted to validate the performance of proposed approaches, and the results are promising.

Self-service for software development projects and HPC activities

International Nuclear Information System (INIS)

Husejko, M; Høimyr, N; Gonzalez, A; Koloventzos, G; Asbury, D; Trzcinska, A; Agtzidis, I; Botrel, G; Otto, J

2014-01-01

This contribution describes how CERN has implemented several essential tools for agile software development processes, ranging from version control (Git) to issue tracking (Jira) and documentation (Wikis). Running such services in a large organisation like CERN requires many administrative actions both by users and service providers, such as creating software projects, managing access rights, users and groups, and performing tool-specific customisation. Dealing with these requests manually would be a time-consuming task. Another area of our CERN computing services that has required dedicated manual support has been clusters for specific user communities with special needs. Our aim is to move all our services to a layered approach, with server infrastructure running on the internal cloud computing infrastructure at CERN. This contribution illustrates how we plan to optimise the management of our of services by means of an end-user facing platform acting as a portal into all the related services for software projects, inspired by popular portals for open-source developments such as Sourceforge, GitHub and others. Furthermore, the contribution will discuss recent activities with tests and evaluations of High Performance Computing (HPC) applications on different hardware and software stacks, and plans to offer a dynamically scalable HPC service at CERN, based on affordable hardware.

Service Interaction Flow Analysis Technique for Service Personalization

DEFF Research Database (Denmark)

Korhonen, Olli; Kinnula, Marianne; Syrjanen, Anna-Liisa

2017-01-01

Service interaction flows are difficult to capture, analyze, outline, and represent for research and design purposes. We examine how variation of personalized service flows in technology-mediated service interaction can be modeled and analyzed to provide information on how service personalization...... could support interaction. We have analyzed service interaction cases in a context of technology-mediated car rental service. With the analysis technique we propose, inspired by Interaction Analysis method, we were able to capture and model the situational service interaction. Our contribution regarding...... technology-mediated service interaction design is twofold: First, with the increased understanding on the role of personalization in managing variation in technology-mediated service interaction, our study contributes to designing service management information systems and human-computer interfaces...

Semantic Service Search, Service Evaluation and Ranking in Service Oriented Environment

Science.gov (United States)

Dong, Hai; Hussain, Farookh Khadeer; Chang, Elizabeth

The theory of Service Oriented Environment (SOE) emerges with advanced connectivity of the Internet technologies, openness of business environment and prosperousness of business activities. Service, as a critical object impenetrating every corner of SOE, is a hot research topic in many research domains. Software Engineering (SE), as a subject in engineering field, its researchers pay more attention to supporting advanced technologies for promoting service activities in SOE. In this paper, we draw the position in the research field of semantic service search, service evaluation and ranking in SOE. By means of the case study and literature review research approach, we discover the research motivations and research issues in this field.

An ecosystem service approach to support integrated pond management: A case study using Bayesian belief networks – Highlighting opportunities and risks

NARCIS (Netherlands)

Landuyt, D.; Lemmens, P.; D'Hondt, R.; Broekx, S.; Liekens, I.; De Bie, T.; Declerck, S.A.J.; De Meester, L.; Goethals, P.

2014-01-01

Freshwater ponds deliver a broad range of ecosystem services (ESS). Taking into account this broad range of services to attain cost-effective ESS delivery is an important challenge facing integrated pond management. To assess the strengths and weaknesses of an ESS approach to support decisions in

Measuring Systems for Thermometer Calibration in Low-Temperature Range

Science.gov (United States)

Szmyrka-Grzebyk, A.; Lipiński, L.; Manuszkiewicz, H.; Kowal, A.; Grykałowska, A.; Jancewicz, D.

2011-12-01

The national temperature standard for the low-temperature range between 13.8033 K and 273.16 K has been established in Poland at the Institute of Low Temperature and Structure Research (INTiBS). The standard consists of sealed cells for realization of six fixed points of the International Temperature Scale of 1990 (ITS-90) in the low-temperature range, an adiabatic cryostat and Isotech water and mercury triple-point baths, capsule standard resistance thermometers (CSPRT), and AC and DC bridges with standard resistors for thermometers resistance measurements. INTiBS calibrates CSPRTs at the low-temperature fixed points with uncertainties less than 1 mK. In lower temperature range—between 2.5 K and about 25 K — rhodium-iron (RhFe) resistance thermometers are calibrated by comparison with a standard which participated in the EURAMET.T-K1.1 comparison. INTiBS offers a calibration service for industrial platinum resistance thermometers and for digital thermometers between 77 K and 273 K. These types of thermometers may be calibrated at INTiBS also in a higher temperature range up to 550°C. The Laboratory of Temperature Standard at INTiBS acquired an accreditation from the Polish Centre for Accreditation. A management system according to EN ISO/IEC 17025:2005 was established at the Laboratory and presented on EURAMET QSM Forum.

Effects of Fire Suppression Agents and Weathering in the Analysis of Fire Debris by HS-MS eNose

Directory of Open Access Journals (Sweden)

Barbara Falatová

2018-06-01

Full Text Available In arson attacks the detection of ignitable liquid residues (ILRs at fire scenes provides key evidence since ignitable liquids, such as gasoline, are commonly used to initiate the fire. In most forensic laboratories gas chromatography-mass spectrometry is employed for the analysis of ILRs. When a fire occurs, suppression agents are used to extinguish the fire and, before the scene is investigated, the samples at the scene are subjected to a variety of processes such as weathering, which can significantly modify the chemical composition and thus lead to erroneous conclusions. In order to avoid this possibility, the application of chemometric tools that help the analyst to extract useful information from data is very advantageous. The study described here concerned the application of a headspace-mass spectrometry electronic nose (HS-MS eNose combined with chemometric tools to determine the presence/absence of gasoline in weathered fire debris samples. The effect of applying two suppression agents (Cafoam Aquafoam AF-6 and Pyro-chem PK-80 Powder and delays in the sampling time (from 0 to 48 h were studied. It was found that, although the suppression systems affect the mass spectra, the HS-MS eNose in combination with suitable pattern recognition chemometric tools, such as linear discriminant analysis, is able to identify the presence of gasoline in any of the studied situations (100% correct classification.

Compressive laser ranging.

Science.gov (United States)

Babbitt, Wm Randall; Barber, Zeb W; Renner, Christoffer

2011-12-15

Compressive sampling has been previously proposed as a technique for sampling radar returns and determining sparse range profiles with a reduced number of measurements compared to conventional techniques. By employing modulation on both transmission and reception, compressive sensing in ranging is extended to the direct measurement of range profiles without intermediate measurement of the return waveform. This compressive ranging approach enables the use of pseudorandom binary transmit waveforms and return modulation, along with low-bandwidth optical detectors to yield high-resolution ranging information. A proof-of-concept experiment is presented. With currently available compact, off-the-shelf electronics and photonics, such as high data rate binary pattern generators and high-bandwidth digital optical modulators, compressive laser ranging can readily achieve subcentimeter resolution in a compact, lightweight package.

Effective Testing Principles for the Mobile Data Services Applications

NARCIS (Netherlands)

Srirama, S.; Kakumani, R.; Aggarwal, A.; Pawar, P.

Wireless communication technologies like GPRS, UMTS and WLAN, combined with the availability of high-end, affordable mobile devices enable the development of the advanced and innovative mobile services. Devices such as mobile phones and Personal Digital Assistants let the users access a wide range

Designing an energy-efficient quick service restaurant

Energy Technology Data Exchange (ETDEWEB)

Young, R.; Spata, A.J.; Turnbull, P.; Allen, T.E.

1999-07-01

Food service operators typically focus on controlling labor and food costs in order to increase profits. Energy, which typically represents 2% to 6% of the total cost to operate, is often a lower priority due to the complexity of food service operations and the lack of practical information. However, in an increasing competitive market, operators are actively seeking opportunities to further reduce overhead, and energy represents a good candidate. This paper presents an overview of the design and application of energy-efficient technologies to a quick service restaurant (QSR) and the resulting energy savings. Included in the discussion are the relevance of energy efficiency in a QSR, the criteria for choosing appropriate energy-efficient technologies, the replication of results to other restaurants, and the performance of the individual energy-saving technologies. Three different techniques were used to estimate energy savings of the energy-efficient technologies, with results in the range of 12% to 18% savings in overall annual restaurant energy costs.

Mechanism Design for Task Procurement with Flexible Quality of Service

Science.gov (United States)

Gerding, Enrico H.; Larson, Kate; Rogers, Alex; Jennings, Nicholas R.

In this paper, we consider the problem where an agent wishes to complete a single computational task, but lacks the required resources. Instead, it must contract self-interested service providers, who are able to flexibly manipulate the quality of service they deliver, in order to maximise their own utility. We extend an existing model to allow for multiple such service providers to be contracted for the same task, and derive optimal task procurement mechanisms in the setting where the agent has full knowledge of the cost functions of these service providers (considering both simultaneous and sequential procurement). We then extend these results to the incomplete information setting where the agent must elicit cost information from the service providers, and we characterise a family of incentive-compatible and individually-rational mechanisms. We show empirically that sequential procurement always generates greater utility for the agent compared to simultaneous procurement, and that over a range of settings, contracting multiple providers is preferable to contracting just one.

Trace saver: A tool for network service improvement and personalised analysis of user centric statistics

Science.gov (United States)

Bilal, Muhammad; Asfand-e-Yar, Mockford, Steve; Khan, Wasiq; Awan, Irfan

2012-11-01

Mobile technology is among the fastest growing technologies in today's world with low cost and highly effective benefits. Most important and entertaining areas in mobile technology development and usage are location based services, user friendly networked applications and gaming applications. However, concern towards network operator service provision and improvement has been very low. The portable applications available for a range of mobile operating systems which help improve the network operator services are desirable by the mobile operators. This paper proposes a state of the art mobile application Tracesaver, which provides a great achievement over the barriers in gathering device and network related information, for network operators to improve their network service provision. Tracesaver is available for a broad range of mobile devices with different mobile operating systems and computational capabilities. The availability of Tracesaver in market has proliferated over the last year since it was published. The survey and results show that Tracesaver is being used by millions of mobile users and provides novel ways of network service improvement with its highly user friendly interface.

Service validity and service reliability of search, experience and credence services. A scenario study

NARCIS (Netherlands)

Galetzka, Mirjam; Verhoeven, J.W.M.; Pruyn, Adriaan T.H.

2006-01-01

The purpose of this research is to add to our understanding of the antecedents of customer satisfaction by examining the effects of service reliability (Is the service “correctly” produced?) and service validity (Is the “correct” service produced?) of search, experience and credence services.

Filling some black holes: modeling the connection between urbanization, infrastructure, and global service intensity

OpenAIRE

Van De Vijver, Elien; Derudder, Ben; Bassens, David; Witlox, Frank

2014-01-01

This empirical article combines insights from previous research on the level of knowledge-intensive service in metropolitan areas with the aim to develop an understanding of the spatial structure of the global service economy. We use a stepwise regression model with the Globalization and World Cities research network's measure of globalized service provisioning as the dependent variable and a range of variables focusing on population, infrastructure, urban primacy, and national regulation as ...

Multimedia services in intelligent environments recommendation services

CERN Document Server

Virvou, Maria; Jain, Lakhmi

2013-01-01

Multimedia services are now commonly used in various activities in the daily lives of humans. Related application areas include services that allow access to large depositories of information, digital libraries, e-learning and e-education, e-government and e-governance, e-commerce and e-auctions, e-entertainment, e-health and e-medicine, and e-legal services, as well as their mobile counterparts (i.e., m-services). Despite the tremendous growth of multimedia services over the recent years, there is an increasing demand for their further development. This demand is driven by the ever-increasing desire of society for easy accessibility to information in friendly, personalized and adaptive environments. In this book at hand, we examine recent Recommendation Services. Recommendation services appear in the mobile environment, medicine/biology, tourism, education, and so on. The book includes ten chapters, which present various recently developed recommendation services. This research book is directed to professors...

Global priorities for conservation of threatened species, carbon storage, and freshwater services

DEFF Research Database (Denmark)

Larsen, Frank Wugt; Londoño-Murcia, Maria C.; Turner, Will R.

2011-01-01

The potential of global biodiversity conservation efforts to also deliver critical benefits, such as carbon storage and freshwater services, is still unclear. Using spatially explicit data on 3,500 range-restricted threatened species, carbon storage, and freshwater provision to people, we conducted...... for which spatial planning and appropriate conservation mechanisms (e.g., payments for ecosystem services) can be used to realize synergies and mitigate tradeoffs....

Creating an Excellent Patient Experience Through Service Education: Content and Methods for Engaging and Motivating Front-Line Staff.

Science.gov (United States)

Kennedy, Denise M

2017-12-01

Service quality and patient satisfaction affect an organization's value-based payments. This new value paradigm calls for a new approach to service education and training for front-line staff. Thoughtfully conceived, department-specific content, infused with patient feedback, value creation, and science of service quality principles, was developed to give front-line staff a deeper understanding of the impact of their performance on patient experience, value creation, and value-based revenue. Feedback from nearly 1500 trainees in 60 educational sessions delivered over 7 years indicates good understanding of the content and appreciation of the targeted approach. On a 5-point scale ranging from 1 (least effective) to 5 (most effective), trainees' ratings of their understanding of service quality concepts and impact on value ranged from 4.7 to 4.9. Verbatim comments showed a positive impact on staff. Employee feedback suggests that value-based service education may be useful in motivating front-line staff, improving service quality, and creating value.

Controlling service delivery in service triads

NARCIS (Netherlands)

Iwaarden, van J.; Valk, van der W.; Aalders, L.; Virolainen, V.-M.

2010-01-01

Organizations are increasingly sourcing services that are directly delivered to their (end) customers by external providers. Buying organization, supplier and (end) customer operate in a triadic service relationship. In these triads, the buying organization lacks direct control over service delivery

Patient Awareness and Expectations of Pharmacist Services During Hospital Stay.

Science.gov (United States)

King, Philip K; Martin, Steven J; Betka, Eric M

2017-10-01

There are insufficient data in the United States regarding patient awareness and expectations of hospital pharmacist availability and services. The objective of this research is to assess patient awareness and expectations of hospital pharmacist services and to determine whether a marketing campaign for pharmacist services increases patient awareness and expectations. Eligible inpatients were surveyed before and after implementation of a hospital-wide pharmacist services marketing campaign (12 items; Likert scale of 1 [strongly disagree] to 4 [strongly agree]; maximum total score of 48) regarding awareness of pharmacist services. The primary outcome was the change in median total survey scores from baseline. Other outcomes included the frequency of patient requests for pharmacists. Similar numbers of patients completed the survey before and after the campaign (intervention, n = 140, vs control, n = 147). Awareness of pharmacist availability and services was increased (41 [interquartile ranges, IQRs: 36-46] vs 37 [IQR 31-43]; P marketing campaign implementation. Awareness among inpatients of pharmacist services is low. Marketing pharmacist availability and services to patients in the hospital improves awareness and expectations for pharmacist-provided care and increases the frequency of patient-initiated interaction between pharmacists and patients. This could improve patient outcomes as pharmacists become more integrally involved in direct patient care.

Feasibility of implementing a comprehensive warfarin pharmacogenetics service.

Science.gov (United States)

Nutescu, Edith A; Drozda, Katarzyna; Bress, Adam P; Galanter, William L; Stevenson, James; Stamos, Thomas D; Desai, Ankit A; Duarte, Julio D; Gordeuk, Victor; Peace, David; Kadkol, Shrihari S; Dodge, Carol; Saraf, Santosh; Garofalo, John; Krishnan, Jerry A; Garcia, Joe G N; Cavallari, Larisa H

2013-11-01

To determine the procedural feasibility of a pharmacist-led interdisciplinary service for providing genotype-guided warfarin dosing for hospitalized patients newly starting warfarin. Prospective observational study. A 438-bed tertiary care hospital affiliated with a large academic institution. Eighty patients who started warfarin therapy and were managed by a newly implemented pharmacogenetics service. All patients received routine warfarin genotyping and clinical pharmacogenetics consultation. The primary outcomes were percentage of genotype-guided dose recommendations available prior to the second warfarin dose and adherence of the medical staff to doses recommended by the pharmacogenetics service. Of 436 genotype orders placed during the first 6 months of the service, 190 (44%) were deemed appropriate. For the 80 patients on the service who consented to data collection, 76% of the genotypes were available prior to the second warfarin dose. The median (range) time from genotype order to genotype result was 26 hours (7-80 hrs), and the time to genotype-guided dose recommendation was 30 hours (7-80 hrs). A total of 73% of warfarin doses ordered by the medical staff were within 0.5 mg of the daily dose recommended by the pharmacogenetics consult service. Providing routine genotype-guided warfarin dosing supported by a pharmacogenetics consult service is feasible from a procedural standpoint, with most genotypes available prior to the second warfarin dose and good adherence to genotype-guided dose recommendations by the medical staff. © 2013 Pharmacotherapy Publications, Inc.

Cost analysis for the implementation of a medication review with follow-up service in Spain.

Science.gov (United States)

Noain, Aranzazu; Garcia-Cardenas, Victoria; Gastelurrutia, Miguel Angel; Malet-Larrea, Amaia; Martinez-Martinez, Fernando; Sabater-Hernandez, Daniel; Benrimoj, Shalom I

2017-08-01

Background Medication review with follow-up (MRF) is a professional pharmacy service proven to be cost-effective. Its broader implementation is limited, mainly due to the lack of evidence-based implementation programs that include economic and financial analysis. Objective To analyse the costs and estimate the price of providing and implementing MRF. Setting Community pharmacy in Spain. Method Elderly patients using poly-pharmacy received a community pharmacist-led MRF for 6 months. The cost analysis was based on the time-driven activity based costing model and included the provider costs, initial investment costs and maintenance expenses. The service price was estimated using the labour costs, costs associated with service provision, potential number of patients receiving the service and mark-up. Main outcome measures Costs and potential price of MRF. Results A mean time of 404.4 (SD 232.2) was spent on service provision and was extrapolated to annual costs. Service provider cost per patient ranged from €196 (SD 90.5) to €310 (SD 164.4). The mean initial investment per pharmacy was €4594 and the mean annual maintenance costs €3,068. Largest items contributing to cost were initial staff training, continuing education and renting of the patient counselling area. The potential service price ranged from €237 to €628 per patient a year. Conclusion Time spent by the service provider accounted for 75-95% of the final cost, followed by initial investment costs and maintenance costs. Remuneration for professional pharmacy services provision must cover service costs and appropriate profit, allowing for their long-term sustainability.

Catalog of Audiovisual Productions. Volume 3. Air Force and Miscellaneous DoD Productions

Science.gov (United States)

1984-06-01

operation of betatrons, cyclotrons, synchrotrons , etc. For atomic and molecular structure and spectra, see T/02 CrhAisILr. For application, see 0...STRATOSPHERE 0/03 SYNCHRONOUS SATELLITES X/02 STRAW J/06 SYNCHROTRONS T/06 STREAMS(iMETEOROLOGY), JET D/CS SYNTAX B/10 STRUCTURAL ENGINEERING F/12...ENEMIES 50579-DF JOHNNY LINGOGOD26B0 GODF TEA FOR ELSA 26927-OF RESURRECTION OF JOE C HAMMOND 5OSSO.DF CIPHER IN THE SNOW 26505-OF LAND OF THE BRAVE 2692

8th International Conference on Field and Service Robotics

CERN Document Server

Tadokoro, Satoshi

2014-01-01

FSR, the International Conference on Field and Service Robotics, is the leading single track conference of robotics for field and service applications. This book presents the results of FSR2012, the eighth conference of Field and Service Robotics, which was originally planned for 2011 with the venue of Matsushima in Tohoku region of Japan. However, on March 11, 2011, a magnitude M9.0 earthquake occurred off the Pacific coast of Tohoku, and a large-scale disaster was caused by the Tsunami which resulted, therefore the conference was postponed by one year to July, 2012. In fact, this earthquake raised issues concerning the contribution of field and service robotics technology to emergency scenarios. A number of precious lessons were learned from operation of robots in the resulting, very real and challenging, disaster environments. Up-to-date study on disaster response, relief and recovery was then featured in the conference. This book offers 43 papers on a broad range of topics including: Disaster Response, Se...

Hydrogen meter for service in liquid sodium

International Nuclear Information System (INIS)

McCown, J.J.

1983-11-01

This standard establishes the requirements for the design, materials, fabrication, quality assurance, examination, and acceptance testing of a hydrogen meter and auxiliary equipment for use in radioactive or nonradioactive liquid sodium service. The meter shall provide a continuous and accurate indication of the hydrogen impurity concentration over the range 0.03 to 10 ppM hydrogen in sodium at temperatures between 800 and 1000 0 F (427 and 538 0 C). The meter may also be used to rapidly monitor changes in hydrogen concentration, over the same concentration range, and, therefore can be used as a sensor for sodium-water reactions in LMFBR steam generators

Does human resource management improve family planning service quality? Analysis from the Kenya Service Provision Assessment 2010.

Science.gov (United States)

Thatte, Nandita; Choi, Yoonjoung

2015-04-01

Human resource (HR) management is a priority for health systems strengthening in developing countries, yet few studies have empirically examined associations with service quality. The purpose of this study was to assess the relationship between HR management and family planning (FP) service quality. Data came from the 2010 Kenya Service Provision Assessment, a nationally representative health facility assessment. In total, 912 FP consultations from 301 facilities were analysed. Four indices were created to measure quality on reproductive history taking, physical examination, sexually transmitted infections prevention and pill/injectable specific counselling. HR management variables included training in the past year, any and supportive (i.e. with feedback, technical updates and discussion) in-person supervision in the past 6 months and having a written job description. Multivariate linear regression analyses were conducted to estimate coefficients of HR management variables on each of the four quality indices, adjusting for background characteristics of clients, provider and facilities. The level of service quality ranged from 16 to 53 out of a maximum score of 100 across the indices. Fifty-two per cent of consultations were done by providers who received supportive in-person supervision in the previous 6 months. In 23% and 38% of consultations, the provider was trained in the past year and had a written job description, respectively. Multivariate analyses indicated that having a written job description was associated with higher service quality in history taking, physical examination and the pill/injectable specific counselling. Other HR management variables were not significantly associated with service quality. Having a written job description was significantly associated with higher service quality and may be a useful tool for strengthening management practices. The details of such job descriptions and the quality of other management indicators should be

Unitarity corrections to short-range order long-range rapidity correlations

CERN Document Server

Capella, A

1978-01-01

Although the effective hadronic forces have short range in rapidity space, one nevertheless expects long-range dynamical correlations induced by unitarity constraints. This paper contains a thorough discussion of long-range rapidity correlations in high-multiplicity events. In particular, the authors analyze in detail the forward- backward multiplicity correlations, measured recently in the whole CERN ISR energy range. They find from these data that the normalized variance of the number n of exchanged cut Pomerons, ((n/(n)-1)/sup 2/) , is most probably in the range 0.32 to 0.36. They show that such a number is obtained from Reggeon theory in the eikonal approximation. The authors also predict a very specific violation of local compensation of charge in multiparticle events: The violation should appear in the fourth-order zone correlation function and is absent in the second-order correlation function, the only one measured until now. (48 refs).

Impact of Child Life Services on Children and Families Admitted to Start the Ketogenic Diet.

Science.gov (United States)

Kossoff, Eric H; Sutter, Lindsay; Doerrer, Sarah C; Haney, Courtney A; Turner, Zahava

2017-08-01

Traditionally the ketogenic diet is started as an inpatient admission to the hospital. Starting in January 2015, child life services were made formally available during ketogenic diet admissions to help families cope. One-page surveys were then provided to 15 parents on the day of discharge and again after 3 months. Every family believed that the child life services were helpful. Children who were developmentally appropriate/mildly delayed had higher parent-reported anxiety scores than those who were moderate to severely delayed (4.4 vs 1.0, P = .02). At 3 months, child life services were deemed very helpful for the parents (mean score: 8.9, range: 5-10), and were more helpful for the parent than the child (mean 6.2, range 1-10, P = .047). One of the most helpful services was a prior phone call to parents 1 week prior. In this small pilot study, child life involvement during the start of the ketogenic diet was highly useful.

Location-Based Rainfall Nowcasting Service for Public

Science.gov (United States)

Woo, Wang-chun

2013-04-01

The Hong Kong Observatory has developed the "Short-range Warning of Intense Rainstorms in Localized Systems (SWIRLS)", a radar-based rainfall nowcasting system originally to support forecasters in rainstorm warning and severe weather forecasting such as hail, lightning and strong wind gusts in Hong Kong. The system has since been extended to provide rainfall nowcast service direct for the public in recent years. Following the launch of "Rainfall Nowcast for the Pearl River Delta Region" service provided via a Geographical Information System (GIS) platform in 2008, a location-based rainfall nowcast service served through "MyObservatory", a smartphone app for iOS and Android developed by the Observatory, debuted in September 2012. The new service takes advantage of the capability of smartphones to detect own locations and utilizes the quantitative precipitation forecast (QPF) from SWIRLS to provide location-based rainfall nowcast to the public. The conversion of radar reflectivity data (at 2 or 3 km above ground) to rainfall in SWIRLS is based on the Z-R relationship (Z=aRb) with dynamical calibration of the coefficients a and b determined using real-time rain gauge data. Adopting the "Multi-scale Optical-flow by Variational Analysis (MOVA)" scheme to track the movement of radar echoes and Semi-Lagrangian Advection (SLA) scheme to extrapolate their movement, the system is capable of producing QPF for the next six hours in a grid of 480 x 480 that covers a domain of 256 km x 256 km once every 6 minutes. Referencing the closest point in a resampled 2-km grid over the territory of Hong Kong, a prediction as to whether there will be rainfall exceeding 0.5 mm in every 30 minute intervals for the next two hours at users' own or designated locations are made available to the users in both textual and graphical format. For those users who have opted to receive notifications, a message would pop up on the user's phone whenever rain is predicted in the next two hours in a user

Facilitators and barriers of implementing and delivering social prescribing services: a systematic review.

Science.gov (United States)

Pescheny, Julia Vera; Pappas, Yannis; Randhawa, Gurch

2018-02-07

Social Prescribing is a service in primary care that involves the referral of patients with non-clinical needs to local services and activities provided by the third sector (community, voluntary, and social enterprise sector). Social Prescribing aims to promote partnership working between the health and the social sector to address the wider determinants of health. To date, there is a weak evidence base for Social Prescribing services. The objective of the review was to identify factors that facilitate and hinder the implementation and delivery of SP services based in general practice involving a navigator. We searched eleven databases, the grey literature, and the reference lists of relevant studies to identify the barriers and facilitators to the implementation and delivery of Social Prescribing services in June and July 2016. Searches were limited to literature written in English. No date restrictions were applied. Findings were synthesised narratively, employing thematic analysis. The Mixed Methods Appraisal Tool Version 2011 was used to evaluate the methodological quality of included studies. Eight studies were included in the review. The synthesis identified a range of factors that facilitate and hinder the implementation and delivery of SP services. Facilitators and barriers were related to: the implementation approach, legal agreements, leadership, management and organisation, staff turnover, staff engagement, relationships and communication between partners and stakeholders, characteristics of general practices, and the local infrastructure. The quality of most included studies was poor and the review identified a lack of published literature on factors that facilitate and hinder the implementation and delivery of Social Prescribing services. The review identified a range of factors that facilitate and hinder the implementation and delivery of Social Prescribing services. Findings of this review provide an insight for commissioners, managers, and providers

Making the case for a fracture liaison service: a qualitative study of the experiences of clinicians and service managers.

Science.gov (United States)

Drew, Sarah; Gooberman-Hill, Rachael; Farmer, Andrew; Graham, Laura; Javaid, M Kassim; Cooper, Cyrus; Judge, Andrew

2015-10-01

To develop services, healthcare professionals must make business cases to managerial bodies within Hospital Trusts and if approved, to commissioning bodies. Patients with hip fracture are at high risk of subsequent fracture. To prevent this, guidance recommends structuring fracture prevention services around coordinator based models. These are known as Fracture Liaison Services (FLS). 33 semi-structured qualitative interviews were conducted with healthcare professionals with experience of making business cases for FLS. Data was analysed thematically. Challenges in the development of business cases included collecting all the relevant data and negotiating compartmentalised budgets that impeded service development. Participants described communication and cooperation between providers and commissioners as variable. They felt financial considerations were the most important factor in funding decisions, while improved quality of care was less influential. Other factors included national guidelines and political priorities. The personalities of clinicians championing services, and the clinical interests of commissioners were seen to influence the decision-making process, suggesting that participants felt that decisions were not always made on the basis of evidence-based care. Effective strategies included ways of providing support, demonstrating potential cost effectiveness and improved quality of care. Using a range of sources including audit data collected on the successful Glasgow FLS, and improving cooperation between stakeholders was advocated. Participants felt that the work of commissioners and providers should be better integrated and suggested strategies for doing this. This study provides information to healthcare professionals about how best to develop business cases for FLS. We conclude with recommendations on how to develop effective cases. These include using guidance such as toolkits, aligning the aims of FLS with national priorities and benchmarking

Solution scanning as a key policy tool: identifying management interventions to help maintain and enhance regulating ecosystem services

Directory of Open Access Journals (Sweden)

William J. Sutherland

2014-06-01

Full Text Available The major task of policy makers and practitioners when confronted with a resource management problem is to decide on the potential solution(s to adopt from a range of available options. However, this process is unlikely to be successful and cost effective without access to an independently verified and comprehensive available list of options. There is currently burgeoning interest in ecosystem services and quantitative assessments of their importance and value. Recognition of the value of ecosystem services to human well-being represents an increasingly important argument for protecting and restoring the natural environment, alongside the moral and ethical justifications for conservation. As well as understanding the benefits of ecosystem services, it is also important to synthesize the practical interventions that are capable of maintaining and/or enhancing these services. Apart from pest regulation, pollination, and global climate regulation, this type of exercise has attracted relatively little attention. Through a systematic consultation exercise, we identify a candidate list of 296 possible interventions across the main regulating services of air quality regulation, climate regulation, water flow regulation, erosion regulation, water purification and waste treatment, disease regulation, pest regulation, pollination and natural hazard regulation. The range of interventions differs greatly between habitats and services depending upon the ease of manipulation and the level of research intensity. Some interventions have the potential to deliver benefits across a range of regulating services, especially those that reduce soil loss and maintain forest cover. Synthesis and applications: Solution scanning is important for questioning existing knowledge and identifying the range of options available to researchers and practitioners, as well as serving as the necessary basis for assessing cost effectiveness and guiding implementation strategies. We

The quality of tourist service in hotels, as a factor to attract tourists

Directory of Open Access Journals (Sweden)

Sergeev A.A.

2017-01-01

Full Text Available in condition of fierce competition, those hospitality businesses win that primarily seek to satisfy the needs of consumers. Successful hotels, seeking their own economic benefits, provide social needs and satisfy the desires of customers. To achieve these goals, they introduce new technology, develop new methods of personnel management and new range of services in the hotel business. Practical experience shows that the service is an important element of management. The article describes practical methods of assessing the quality of customer service.

The quality of mobile phone services provided by Romanian operators, from consumers` perspective

Directory of Open Access Journals (Sweden)

Doru Alexandru Pleşea

2013-06-01

Full Text Available The mobile services are distinguished through their quality, either we speak about the way the client is approached and placed in the centre of the operator's actions, or about the services the client benefits in his capacity as a client. The Romanian mobile operators’ services have greatly evolved from their launch in 1997. Along these times, the mobile operators brought more value to these services, due to their need to meet the consumers' expectations with services of high quality and competitiveness. Usually the Romanian consumers place the price in the forefront of their service/mobile phone services acquisition, but an objective analyze of the quality of the mobile phone services has to take into account both technical aspects of the services and the interfacing services too. Therefore, this paper takes into account technical characteristics of the services such as national telephony coverage, data transmission services coverage, the signal quality, maximum speed of data transfer as well as related services such as distribution network, sales and support sales services, after-sales services, and range of available terminals. Based on mobile services comprehensive analysis made available to consumers by the major players on the Romanian market, this paper aims to highlight the main reasons of the consumers’ satisfaction and dissatisfaction.

Does this range suit me? Range satisfaction of battery electric vehicle users.

Science.gov (United States)

Franke, Thomas; Günther, Madlen; Trantow, Maria; Krems, Josef F

2017-11-01

User satisfaction is a vital design criterion for sustainable systems. The present research aimed to understand factors relating to individually perceived range satisfaction of battery electric vehicle (BEV) users. Data from a large-scale BEV field trial (N = 72) were analyzed. Apart from an initial drop in range satisfaction, increasing practical experience was related to increased range satisfaction. Classical indicators of users' mobility profiles (daily travel distances) were only weakly related to lower range satisfaction (not significant), after controlling for practical experience and preferred coverage of mobility needs. The regularity/predictability of users' mobility patterns, the percentage of journeys not coverable because of range issues, and users' individual comfortable range accounted for variance in range satisfaction. Finally, range satisfaction was related to key indicators of general BEV acceptance (e.g., purchase intentions). These results underline the complex dynamics involved in individual range satisfaction, as well as its central role for BEV acceptance. Copyright © 2017 Elsevier Ltd. All rights reserved.

Internal Audit Service | Internal Audit Service

Science.gov (United States)

their internal auditing function in the areas of professional excellence, quality of service and Students and teachers Media Internal Audit Service Navbar Toggle Home About the Staff Risk Assessment and Planning Internal Audit Process Search for Search Home The mission of the Fermilab Internal Audit Service

Multiscale Laboratory Infrastructure and Services to users: Plans within EPOS

Science.gov (United States)

Spiers, Chris; Willingshofer, Ernst; Drury, Martyn; Funiciello, Francesca; Rosenau, Matthias; Scarlato, Piergiorgio; Sagnotti, Leonardo; EPOS WG6, Corrado Cimarelli

2015-04-01

The participant countries in EPOS embody a wide range of world-class laboratory infrastructures ranging from high temperature and pressure experimental facilities, to electron microscopy, micro-beam analysis, analogue modeling and paleomagnetic laboratories. Most data produced by the various laboratory centres and networks are presently available only in limited "final form" in publications. Many data remain inaccessible and/or poorly preserved. However, the data produced at the participating laboratories are crucial to serving society's need for geo-resources exploration and for protection against geo-hazards. Indeed, to model resource formation and system behaviour during exploitation, we need an understanding from the molecular to the continental scale, based on experimental data. This contribution will describe the plans that the laboratories community in Europe is making, in the context of EPOS. The main objectives are: • To collect and harmonize available and emerging laboratory data on the properties and processes controlling rock system behaviour at multiple scales, in order to generate products accessible and interoperable through services for supporting research activities. • To co-ordinate the development, integration and trans-national usage of the major solid Earth Science laboratory centres and specialist networks. The length scales encompassed by the infrastructures included range from the nano- and micrometer levels (electron microscopy and micro-beam analysis) to the scale of experiments on centimetre sized samples, and to analogue model experiments simulating the reservoir scale, the basin scale and the plate scale. • To provide products and services supporting research into Geo-resources and Geo-storage, Geo-hazards and Earth System Evolution. If the EPOS Implementation Phase proposal presently under construction is successful, then a range of services and transnational activities will be put in place to realize these objectives.

Social-ecological drivers of multiple ecosystem services: what variables explain patterns of ecosystem services across the Norrström drainage basin?

Directory of Open Access Journals (Sweden)

Megan Meacham

2016-03-01

Full Text Available In human dominated landscapes many diverse, and often antagonistic, human activities are intentionally and inadvertently determining the supply of various ecosystem services. Understanding how different social and ecological factors shape the availability of ecosystem services is essential for fair and effective policy and management. In this paper, we evaluate how well alternative social-ecological models of human impact on ecosystems explain patterns of 16 ecosystem services (ES across the 62 municipalities of the Norrström drainage basin in Sweden. We test four models of human impact on ecosystems, land use, ecological modernization, ecological footprint, and location theory, and test their ability to predict both individual ES and bundles of ES. We find that different models do best to predict different types of individual ES. Land use is the best model for predicting provisioning services, standing water quality, biodiversity appreciation, and cross-country skiing, while other models work better for the remaining services. However, this range of models is not able to predict some of the cultural ES. ES bundles are predicted worse than individual ES by these models, but provide a clear picture of variation in multiple ecosystem services based on limited information. Based on our results, we offer suggestions on how social-ecological modeling and assessments of ecosystems can be further developed.

Technology review of commercial food service equipment - final report

Energy Technology Data Exchange (ETDEWEB)

Rahbar, S; Krsikapa, S [Canadian Gas Research Inst., Don Mills, ON (Canada); Fisher, D; Nickel, J; Ardley, S; Zabrowski, D [Fisher Consultants (Canada); Barker, R F [ed.

1996-05-15

Technical information on commercial gas cooking appliances was presented. This second volume provided an appliance-by-appliance comprehensive assessment of the energy performance of commercial food service equipment. Energy assessments were made for the following categories of cooking equipment: fryers, griddles, broilers, ranges, Chinese ranges, ovens, steamers, steam kettles, and braising pans. Recommendations were made for improving the energy efficiency and overall performance of gas appliances to support of the Canadian gas utilities marketing and energy conservation initiatives. 71 refs., 37 tabs., 58 figs.

Service Modularity

DEFF Research Database (Denmark)

Avlonitis, Viktor; Hsuan, Juliana

2015-01-01

The purpose of this research is to investigate the studies on service modularity with a goal of informing service science and advancing contemporary service systems research. Modularity, a general systems property, can add theoretical underpinnings to the conceptual development of service science...... in general and service systems in particular. Our research is guided by the following question: how can modularity theory inform service system design? We present a review of the modularity literature and associated concepts. We then introduce the contemporary service science and service system discourse...

服务购买型公私合作(PPP)项目财政补偿的有效区间研究%The Study on the Effective Range of Fiscal Compensation of Public Private Partnerships Project Regarding Services Sold to the Public Sector

Institute of Scientific and Technical Information of China (English)

胡振; 王秀婧; 刘华

2013-01-01

Through the comparison of investment and operating costs occurred under traditional development and Public Private Partnerships (PPP) regarding services sold to the public sector, this paper studies the fundamental model regarding the effective range of fiscal compensation, as well as its evolution in the context of the existence of advanced supply of public service. The model shows that due to the advantages in finance, technology and management, the private entities could produce the "win-win range" of PPP projects, and both public and private stakeholders can gain benefit by fiscal compensation on the range.%通过对比传统开发与公私合作(PPP)两种模式下的投资和经营成本,研究服务购买型PPP项目财政补偿有效区间的基础模型;考虑公共服务提前供应条件下基础模型的演变,表明由于民间实体利用其资金、技术以及管理优势,能够创造出PPP项目的“双赢区间”,在该区间内进行财政补偿,公私双方都能获益.

Faculty at Work: Focus on Research, Scholarship, and Service.

Science.gov (United States)

Blackburn, Robert T.; And Others

1991-01-01

A study compared selected personal and environmental motivational variables in college faculty with allocation of work effort to research, scholarship, and service. Faculty were from eight liberal arts and sciences departments in a range of institution types. For all institutional types, self-valuation motivators significantly accounted for the…

Auxiliary services for petrochemistry. Cogeneration, thermocompression, steam distribution networks

International Nuclear Information System (INIS)

Vergerio, G.; Bruzzi, V.

1999-01-01

The article gives some guidelines for the choice of the most suitable energy vectors distributed in petrochemical plants and refineries for auxiliary services and for processes (mainly distillation). Conclusions are summed up in a diagram showing the most suitable heat sources and sinks for the various temperature ranges [it

Tax subsidization of personal assistance services.

Science.gov (United States)

Mendelsohn, Steven; Myhill, William N; Morris, Michael

2012-04-01

Personal assistance services (PAS) is the term used to describe the range of assistance, services, and supports many people with disabilities and older Americans need to remain in their homes and communities. The Americans with Disabilities Act requires that people with disabilities receive essential services in the communities of their choice rather than in institutional settings. PAS availability often determines whether persons with disabilities become institutionalized or remain in their communities. PAS, however, are not inexpensive or broadly available. Strategies are needed to improve their availability to people with disabilities and the elderly. We sought to analyze 8 provisions of the Internal Revenue Code for their utility to make PAS more affordable and available. The authors conducted a legal analysis of 8 statutory provisions, as interpreted by regulations, court decisions, and other authoritative sources. Each of the tax provisions analyzed covers some PAS expenses incurred by an individual or family. Favorable tax treatment is impacted by the nature and amount of expenses and by the location and conditions of services. The current limitations and complexities of legal interpretations and the fact that many individuals with disabilities are uninformed about these tax provisions present challenges and opportunities. As the need for PAS grows, reform of tax policy is an important complement to health care and long-term services and supports for people with disabilities. To increase utilization of current beneficial tax provisions that subsidize the cost of PAS, individuals with disabilities and tax preparers must become better informed about using these provisions. Copyright © 2012 Elsevier Inc. All rights reserved.

Who Receives Speech/Language Services by 5 Years of Age in the United States?

Science.gov (United States)

Hammer, Carol Scheffner; Farkas, George; Hillemeier, Marianne M.; Maczuga, Steve; Cook, Michael; Morano, Stephanie

2016-01-01

Purpose We sought to identify factors predictive of or associated with receipt of speech/language services during early childhood. We did so by analyzing data from the Early Childhood Longitudinal Study–Birth Cohort (ECLS-B; Andreassen & Fletcher, 2005), a nationally representative data set maintained by the U.S. Department of Education. We addressed two research questions of particular importance to speech-language pathology practice and policy. First, do early vocabulary delays increase children's likelihood of receiving speech/language services? Second, are minority children systematically less likely to receive these services than otherwise similar White children? Method Multivariate logistic regression analyses were performed for a population-based sample of 9,600 children and families participating in the ECLS-B. Results Expressive vocabulary delays by 24 months of age were strongly associated with and predictive of children's receipt of speech/language services at 24, 48, and 60 months of age (adjusted odds ratio range = 4.32–16.60). Black children were less likely to receive speech/language services than otherwise similar White children at 24, 48, and 60 months of age (adjusted odds ratio range = 0.42–0.55). Lower socioeconomic status children and those whose parental primary language was other than English were also less likely to receive services. Being born with very low birth weight also significantly increased children's receipt of services at 24, 48, and 60 months of age. Conclusion Expressive vocabulary delays at 24 months of age increase children’s risk for later speech/language services. Increased use of culturally and linguistically sensitive practices may help racial/ethnic minority children access needed services. PMID:26579989

Novel signal multiplexing methods for integration of services in in-building broadband multimode fibre networks

NARCIS (Netherlands)

Koonen, A.M.J.

2004-01-01

Many different services with widely ranging signal characteristics are to be supported in in-building networks: fast data transport (e.g. Gbit Ethernet), video, high-Q audio, and control signals. These services may use wired or wireless connection to the end user. In order to support them in

Performance in Service Marketing from Philosophy to Customer Relationship Management

Directory of Open Access Journals (Sweden)

Victor Danciu

2007-08-01

Full Text Available The contribution of services to the development of every national economy is in the progress,they becoming the major contributor to the gross national product of most countries. In their turn, thecustomers become more demanding and powerful in their relationship with service providers. They askfor more and new relationship. The appropriate new marketing, known as Relationship Marketing, looksto engage the customer interactively in the many steps of creating value which is later shared betweenservice provider and customer. This requires to focus on long-term customer relationship. In order toestablish and maintain long-term relationship, the relationship marketing should understand customerexpectations, know the customers, evaluate services process, obtain a proper service quality and adequatelymanage customers’ relationships. The service customer’s is placed on an expectation range to afive dimension scale and have two levels which may be analyzed into a model of service. A stimulus forrelationship marketing performance may be the quality of service. The objective and subjective quality ofservice is essential for the service customer relationship management. In order to reach the goal ofretaining actual customers, service companies should be prepared to spot customers who leave and thenanalyze and act on information they provide. Managers should make sure the entire organization understandthe importance of keeping customers and encourage employees to pursue zero defections by tryingincentives, planning, and budgeting to defections targets. Most important, managers use defections as avehicle for continuously improving the quality and value of the service they provide to customer.

Assessing customer satisfaction for improving NOAA's climate products and services

Science.gov (United States)

Meyers, J. C.; Hawkins, M. D.; Timofeyeva, M. M.

2009-12-01

NOAA's National Weather Service (NWS) Climate Services Division (CSD) is developing a comprehensive climate user requirements process with the ultimate goal of producing climate services that meet the needs of NWS climate information users. An important part of this effort includes engaging users through periodical surveys conducted by the Claes Fornell International (CFI) Group using the American Customer Satisfaction Index (ACSI). The CFI Group conducted a Climate Services Satisfaction (CSS) Survey in May of 2009 to measure customer satisfaction with current products and services and to gain insight on areas for improvement. The CSS Survey rates customer satisfaction on a range of NWS climate services data and products, including Climate Prediction Center (CPC) outlooks, drought monitoring, and ENSO monitoring and forecasts, as well as NWS local climate data services. In addition, the survey assesses the users of the products to give the NWS insight into its climate customer base. The survey also addresses specific topics such as NWS forecast category names, probabilistic nature of climate products, and interpretation issues. The survey results identify user requirements for improving existing NWS climate services and introducing new ones. CSD will merge the survey recommendations with available scientific methodologies and operational capabilities to develop requirements for improved climate products and services. An overview of the 2009 survey results will be presented, such as users' satisfaction with the accuracy, reliability, display and functionality of products and services.

MAPI: towards the integrated exploitation of bioinformatics Web Services.

Science.gov (United States)

Ramirez, Sergio; Karlsson, Johan; Trelles, Oswaldo

2011-10-27

Bioinformatics is commonly featured as a well assorted list of available web resources. Although diversity of services is positive in general, the proliferation of tools, their dispersion and heterogeneity complicate the integrated exploitation of such data processing capacity. To facilitate the construction of software clients and make integrated use of this variety of tools, we present a modular programmatic application interface (MAPI) that provides the necessary functionality for uniform representation of Web Services metadata descriptors including their management and invocation protocols of the services which they represent. This document describes the main functionality of the framework and how it can be used to facilitate the deployment of new software under a unified structure of bioinformatics Web Services. A notable feature of MAPI is the modular organization of the functionality into different modules associated with specific tasks. This means that only the modules needed for the client have to be installed, and that the module functionality can be extended without the need for re-writing the software client. The potential utility and versatility of the software library has been demonstrated by the implementation of several currently available clients that cover different aspects of integrated data processing, ranging from service discovery to service invocation with advanced features such as workflows composition and asynchronous services calls to multiple types of Web Services including those registered in repositories (e.g. GRID-based, SOAP, BioMOBY, R-bioconductor, and others).

Assessing care-givers' satisfaction with child immunisation services in Zambia: Evidence from a national survey.

Science.gov (United States)

Chama-Chiliba, Chitalu Miriam; Masiye, Felix; Mphuka, Chrispin

2017-10-09

The main aim of this study was to assess care-giver satisfaction with vaccination services in public health facilities in Zambia, and examine its determinants. This study used data from a recent population-based household survey, conducted from May to August 2015. Respondent satisfaction with vaccination services received during the last visit was measured on a five point Likert scale ranging from 1 to 5. We used an ordered logistic regression model to analyse the significance of perceived quality of vaccination services, immunisation delivery mode and a range of individual characteristics in predicting care-giver satisfaction. Findings show that one in five care givers were unsatisfied with the vaccination services that they had received, with rural populations showing a significantly higher level of satisfaction. Poor quality of care, defined by long waiting times, poor quality of communication between health staff and care givers, long distance to vaccination sites, mode of delivery, and personal characteristics were among major factors driving care-giver satisfaction ratings. We also find that receiving a vaccination at outreach mode of delivery was associated with higher odds of greater satisfaction compared to on-facility vaccination services. The odds of satisfaction were lower for respondents living further away from a health facility, which emphasizes the importance of access in seeking vaccination services. These findings suggest that major improvements in quality of vaccination and service organisation will be needed to increase client satisfaction and service utilisation. Copyright © 2017 Elsevier Ltd. All rights reserved.

A comparison of tools for modeling freshwater ecosystem services.

Science.gov (United States)

Vigerstol, Kari L; Aukema, Juliann E

2011-10-01

Interest in ecosystem services has grown tremendously among a wide range of sectors, including government agencies, NGO's and the business community. Ecosystem services entailing freshwater (e.g. flood control, the provision of hydropower, and water supply), as well as carbon storage and sequestration, have received the greatest attention in both scientific and on-the-ground applications. Given the newness of the field and the variety of tools for predicting water-based services, it is difficult to know which tools to use for different questions. There are two types of freshwater-related tools--traditional hydrologic tools and newer ecosystem services tools. Here we review two of the most prominent tools of each type and their possible applications. In particular, we compare the data requirements, ease of use, questions addressed, and interpretability of results among the models. We discuss the strengths, challenges and most appropriate applications of the different models. Traditional hydrological tools provide more detail whereas ecosystem services tools tend to be more accessible to non-experts and can provide a good general picture of these ecosystem services. We also suggest gaps in the modeling toolbox that would provide the greatest advances by improving existing tools. Copyright © 2011 Elsevier Ltd. All rights reserved.

The dilemma of service productivity and service innovation : An empirical exploration in financial services

NARCIS (Netherlands)

Aspara, Jaakko; Klein, Jan; Luo, Xueming; Tikkanen, Henrikki

2017-01-01

We conduct a systematic exploratory investigation of the effects of firms’ existing service productivity on the success of their new service innovations. Although previous research extensively addresses service productivity and service innovation, respectively, this is the first empirical study that

Alanine-EPR dosimetry for measurements of ionizing radiation absorbed doses in the range 0.5-10 kGy

CERN Document Server

Peimel-Stuglik, Z

2001-01-01

The usefulness of two, easy accessible alanine dosimeters (ALANPOL from IChTJ and foil dosimeter from Gamma Service, Radeberg, Germany) to radiation dose measurement in the range of 0.5-10 kGy, were investigated. In both cases, the result of the test was positive. The foil dosemeter from Gamma Service is recommended for dose distribution measurements in fantoms or products, ALANPOL - for routine measurements. The EPR-alanine method based on the described dosimeters can be successfully used, among others, in the technology of radiation protection of food.

Opal web services for biomedical applications.

Science.gov (United States)

Ren, Jingyuan; Williams, Nadya; Clementi, Luca; Krishnan, Sriram; Li, Wilfred W

2010-07-01

Biomedical applications have become increasingly complex, and they often require large-scale high-performance computing resources with a large number of processors and memory. The complexity of application deployment and the advances in cluster, grid and cloud computing require new modes of support for biomedical research. Scientific Software as a Service (sSaaS) enables scalable and transparent access to biomedical applications through simple standards-based Web interfaces. Towards this end, we built a production web server (http://ws.nbcr.net) in August 2007 to support the bioinformatics application called MEME. The server has grown since to include docking analysis with AutoDock and AutoDock Vina, electrostatic calculations using PDB2PQR and APBS, and off-target analysis using SMAP. All the applications on the servers are powered by Opal, a toolkit that allows users to wrap scientific applications easily as web services without any modification to the scientific codes, by writing simple XML configuration files. Opal allows both web forms-based access and programmatic access of all our applications. The Opal toolkit currently supports SOAP-based Web service access to a number of popular applications from the National Biomedical Computation Resource (NBCR) and affiliated collaborative and service projects. In addition, Opal's programmatic access capability allows our applications to be accessed through many workflow tools, including Vision, Kepler, Nimrod/K and VisTrails. From mid-August 2007 to the end of 2009, we have successfully executed 239,814 jobs. The number of successfully executed jobs more than doubled from 205 to 411 per day between 2008 and 2009. The Opal-enabled service model is useful for a wide range of applications. It provides for interoperation with other applications with Web Service interfaces, and allows application developers to focus on the scientific tool and workflow development. Web server availability: http://ws.nbcr.net.

Triple Play Service and IPTV Services Offered within it

Directory of Open Access Journals (Sweden)

Dagmar Pajdusakova

2008-01-01

Full Text Available This paper deals with Triple Play multimedia service and figures its architecture. Triple Play offers voice, video and data services together in one customer connection. There is offered IPTV (Internet Protocol Television service within this service, where we can include also Video on Demand service and other different additional services. In the paper is described classification of Video on Demand services.

Realizing ecosystem services: wetland hydrologic function along a gradient of ecosystem condition.

Science.gov (United States)

McLaughlin, Daniel L; Cohen, Matthew J

2013-10-01

Wetlands provide numerous ecosystem services, from habitat provision to pollutant removal, floodwater storage, and microclimate regulation. Delivery of particular services relies on specific ecological functions, and thus to varying degree on wetland ecological condition, commonly quantified as departure from minimally impacted reference sites. Condition assessments are widely adopted as regulatory indicators of ecosystem function, and for some services (e.g., habitat) links between condition and function are often direct. For others, however, links are more tenuous, and using condition alone to enumerate ecosystem value (e.g., for compensatory mitigation) may underestimate important services. Hydrologic function affects many services cited in support of wetland protection both directly (floodwater retention, microclimate regulation) and indirectly (biogeochemical cycling, pollutant removal). We investigated links between condition and hydrologic function to test the hypothesis, embedded in regulatory assessment of wetland value, that condition predicts function. Condition was assessed using rapid and intensive approaches, including Florida's official wetland assessment tool, in 11 isolated forested wetlands in north Florida (USA) spanning a land use intensity gradient. Hydrologic function was assessed using hydrologic regime (mean, variance, and rates of change of water depth), and measurements of groundwater exchange and evapotranspiration (ET). Despite a wide range in condition, no systematic variation in hydrologic regime was observed; indeed reference sites spanned the full range of variation. In contrast, ET was affected by land use, with higher rates in intensive (agriculture and urban) landscapes in response to higher leaf area. ET determines latent heat exchange, which regulates microclimate, a valuable service in urban heat islands. Higher ET also indicates higher productivity and thus carbon cycling. Groundwater exchange regularly reversed flow direction

A general approach for cache-oblivious range reporting and approximate range counting

DEFF Research Database (Denmark)

Afshani, Peyman; Hamilton, Chris; Zeh, Norbert

2010-01-01

We present cache-oblivious solutions to two important variants of range searching: range reporting and approximate range counting. Our main contribution is a general approach for constructing cache-oblivious data structures that provide relative (1+ε)-approximations for a general class of range c...

A Soil Service Index: a method for quantifying the value, vulnerability, and status of soil resources

Science.gov (United States)

Harden, J. W.; Loisel, J.; Hugelius, G.; Sulman, B. N.; Bond-Lamberty, B. P.; Abramoff, R. Z.; Malhotra, A.; Gill, A. L.

2017-12-01

Soils support ecological and human systems by providing a physical and biogeochemical basis for plant growth, ecological functions, water quality, and water storage, and by providing services and functions needed for economic development, human well-being, and conservation of natural resources. Quantitative evaluation of soil services, however, is inconsistent and poorly communicated, in part because we lack a scientific, unified basis for evaluating soils and their potential for serving our needs. We introduce an index of soil service (SSI) in which multiple services are numerically or quantitatively assessed, normalized to a unit-less scale for purposes of intercomparability, and evaluated for a given site or region. Services include organic matter and/or organic carbon storage; plant productivity; CO2 or GHG exchange with the atmosphere; water storage capacity; and nutrient storage and/or availability. The status of SSI can be evaluated by individual services or by a composite index that combines multiple services. The status can be monitored over time; and key services that are more highly valued for a given soil can be weighted accordingly in comparison to other services. As a first step, existing data for each service are captured from a literature and data review in order to establish the full range of values. A site value establishes the ranking relative to the full range. Key services are weighted according to local values. A final index is the sum of the normalized, weighted products. Metrics can be updated and adapted as new data or services are discovered or recognized. Metrics can be used to compare among sites, regions, or time periods.

Commissioning of specialist palliative care services in England.

Science.gov (United States)

Lancaster, Harriet; Finlay, Ilora; Downman, Maxwell; Dumas, James

2018-03-01

Some failures in end-of-life care have been attributed to inconsistent provision of palliative care across England. We aimed to explore the variation in commissioning of services by Clinical Commissioning Groups (CCGs) using a data collection exercise. We sent a Freedom of Information request in the form of an open questionnaire to all 209 CCGs in England to assess their commissioning of palliative and end-of-life care services, mainly focused on the provision of specialist palliative care services. 29 CCGs provided information about the number of patients with some form of palliative care needs in their population. For specialist palliative care services, CCGs allocated budgets ranging from £51.83 to £2329.19 per patient per annum. 163 CCGs (77.90%) currently commission 7-day admission to their specialist palliative care beds. 82.84% of CCGs commission 7-day specialist palliative care services in patients' own homes and out-of-hours services rely heavily on hospice provision. 64 CCGs (31.37%) commission pain control teams, the majority of whom only operate in regular working hours. 68.14% of CCGs reported commissioning palliative care education of any sort for healthcare professionals and 44.85% of CCGs had no plans to update or review their palliative care services. The most important finding from this exercise is that the information CCGs hold about their population and services is not standardised. However, information based on data that are more objective, for example, population and total budget for palliative care, demonstrate wide variations in commissioning. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

INCREASING THE QUALITY OF SERVICE : Case Service Desk

OpenAIRE

Åhlgren, Niklas

2014-01-01

The topic of this thesis was to study how service quality is formed and to use this outcome to improve the quality of an IT service desk. The goal was to bring value to the customers and to the company by orienting the service desk personnel towards better service quality. By giving the service desk personnel a better understanding of the business process, customer relationship management and service quality the employees would gain more insight in to their own importance when it comes to imp...

Direct-to-consumer sales of genetic services on the Internet.

Science.gov (United States)

Gollust, Sarah E; Wilfond, Benjamin S; Hull, Sara Chandros

2003-01-01

PURPOSE The increasing use of the Internet to obtain genetics information and to order medical services without a prescription, combined with a rise in direct-to-consumer marketing for genetic testing, suggests the potential for the Internet to be used to sell genetic services. METHODS A systematic World Wide Web search was conducted in May 2002 to assess the availability of genetic services sold directly to consumers on the Internet. RESULTS Out of 105 sites that offered genetic services directly, most offered non-health-related services, including parentage confirmation testing (83%), identity testing (56%), and DNA banking (24%); however, health-related genetic tests were offered through 14 sites (13%). The health-related genetic tests available ranged from standard tests, such as hemochromatosis and cystic fibrosis, to more unconventional tests related to nutrition, behavior, and aging. Of these 14 sites, 5 described risks associated with the genetic services and 6 described the availability of counseling. CONCLUSIONS The availability of direct sales of health-related genetic tests creates the potential for inadequate pretest decision making, misunderstanding test results, and access to tests of questionable clinical value.

ASTRID In Service Inspection and Repair: Review of R&D program and associated results

International Nuclear Information System (INIS)

Baqué, François; Jadot, Françoise; Bourdais, Florian le; Sibilo, Julien; Augem, Jean-Michel; Gastaldi, Olivier

2013-01-01

In Service Inspection & Repair (ISI&R): → range of provisions enabling to verify that the equipments state is in compliance with design criteria; → other range of provisions allowing to characterize an abnormal situation (failure, operation mistake) and to perform necessary actions to reach again an achievable plant configuration

Characteristics of private abortion services in Mexico City after legalization.

Science.gov (United States)

Schiavon, Raffaela; Collado, Maria Elena; Troncoso, Erika; Soto Sánchez, José Ezequiel; Zorrilla, Gabriela Otero; Palermo, Tia

2010-11-01

In 2007, first trimester abortion was legalized in Mexico City, and the public sector rapidly expanded its abortion services. In 2008, to obtain information on the effect of the law on private sector abortion services, we interviewed 135 physicians working in private clinics, located through an exhaustive search. A large majority of the clinics offered a range of reproductive health services, including abortions. Over 70% still used dilatation and curettage (D&C); less than a third offered vacuum aspiration or medical abortion. The average number of abortions per facility was only three per month; few reported more than 10 abortions monthly. More than 90% said they had been offering abortion services for less than 20 months. Many women are still accessing abortion services privately, despite the availability of free or low-cost services at public facilities. However, the continuing use of D&C, high fees (mean of $157-505), poor pain management practices, unnecessary use of ultrasound, general anaesthesia and overnight stays, indicate that private sector abortion services are expensive and far from optimal. Now that abortions are legal, these results highlight the need for private abortion providers to be trained in recommended abortion methods and quality of private abortion care improved. Copyright © 2010 Reproductive Health Matters. Published by Elsevier Ltd. All rights reserved.

The experience of applying academic service learning within the ...

African Journals Online (AJOL)

The experience of applying academic service learning within the discipline of speech pathology and audiology at a South African university. ... The argument put forward is that this type of pedagogy would appear to be applicable across a broad range of disciplines and represents one strategy for assisting higher education ...

Dimensions of hospital service quality: a critical review: perspective of patients from global studies.

Science.gov (United States)

Pai, Yogesh P; Chary, Satyanarayana T

2013-01-01

The purpose of this paper is to review the service quality dimensions established in various studies conducted across the world specifically applied to health care. Studies conducted on quality of care selected from literature databases - Ebsco, Emerald Insight, ABI/Inform - was subjected to a comprehensive in-depth content analysis. Service quality has been extensively studied with considerable efforts taken to develop survey instruments for measuring purposes. The number of dimensional structure varies across the studies. Self-administered questionnaire dominates in terms of mode of administration adopted in the studies, with respondents ranging from 18 to 85 years. Target sample size ranged from 84-2,000 respondents in self-administered questionnaires and for mail administration ranged from 300-2,600 respondents. Studies vary in terms of the scores used ranging from four to ten-point scale. A total of 27 of the studies have used EFA, 11 studies have used structural equation modelling and eight studies used gap scores. Cronbach's alpha is the most commonly used measure of scale reliability. There is variation in terms of measuring the content, criteria and construct validation among the studies. The literature offers dimensions used in assessing patient perceived service quality. The review reveals diversity and a plethora of dimensions and methodology to develop the construct discussed. The reported study describes and contrasts a large number of service-quality measurement constructs and highlights the usage of dimensions. The findings are valuable to academics in terms of dimensions and methodology used, approach for analysis; whereas findings are of value to practitioners in terms of the dimensions found in the research and to identify the gap in their setting.

Monitoring Users' Satisfactions of the NOAA NWS Climate Products and Services

Science.gov (United States)

Horsfall, F. M.; Timofeyeva, M. M.; Dixon, S.; Meyers, J. C.

2011-12-01

The NOAA's National Weather Service (NWS) Climate Services Division (CSD) ensures the relevance of NWS climate products and services. There are several ongoing efforts to identify the level of user satisfaction. One of these efforts includes periodical surveys conducted by Claes Fornell International (CFI) Group using the American Customer Satisfaction Index (ACSI), which is "the only uniform, national, cross-industry measure of satisfaction with the quality of goods and services available in the United States" (http://www.cfigroup.com/acsi/overview.asp). The CFI Group conducted NWS Climate Products and Services surveys in 2004 and 2009. In 2010, a prominent routine was established for a periodical assessment of the customer satisfaction. From 2010 onward, yearly surveys will cover major climate services products and services. An expanded suite of climate products will be surveyed every other year. Each survey evaluated customer satisfaction with a range of NWS climate services, data, and products, including Climate Prediction Center (CPC) outlooks, drought monitoring, and ENSO monitoring and forecasts, as well as NWS local climate data and forecast products and services. The survey results provide insight into the NWS climate customer base and their requirements for climate services. They also evaluate whether we are meeting the needs of customers and the ease of their understanding for routine climate services, forecasts, and outlooks. In addition, the evaluation of specific topics, such as NWS forecast product category names, probabilistic nature of climate products, interpretation issues, etc., were addressed to assess how our users interpret prediction terminology. This paper provides an analysis of the following products: hazards, extended-range, long-lead and drought outlooks, El Nino Southern Oscillation monitoring and predictions as well as local climate data products. Two key issues make comparing the different surveys challenging, including the

Towards Integrating Soil Quality Monitoring Targets as Measures of Soil Natural Capital Stocks with the Provision of Ecosystem Services

Science.gov (United States)

Taylor, M. D.; Mackay, A. D.; Dominati, E.; Hill, R. B.

2012-04-01

This paper presents the process used to review soil quality monitoring in New Zealand to better align indicators and indicator target ranges with critical values of change in soil function. Since its inception in New Zealand 15 year ago, soil quality monitoring has become an important state of the environment reporting tool for Regional Councils. This tool assists councils to track the condition of soils resources, assess the impact of different land management practices, and provide timely warning of emerging issues to allow early intervention and avoid irreversible loss of natural capital stocks. Critical to the effectiveness of soil quality monitoring is setting relevant, validated thresholds or target ranges. Provisional Target Ranges were set in 2003 using expert knowledge available and data on production responses. Little information was available at that time for setting targets for soil natural capital stocks other than those for food production. The intention was to revise these provisional ranges as further information became available and extend target ranges to cover the regulating and cultural services provided by soils. A recently developed ecosystems service framework was used to explore the feasibility of linking soil natural capital stocks measured by the current suite of soil quality indicators to the provision of ecosystem services by soils. Importantly the new approach builds on and utilises the time series data sets collected by current suite of soil quality indicators, adding value to the current effort, and has the potential to set targets ranges based on the economic and environmental outcomes required for a given farm, catchment or region. It is now timely to develop a further group of environmental indicators for measuring specific soil issues. As with the soil quality indicators, these environmental indicators would be aligned with the provision of ecosystem services. The toolbox envisaged is a set of indicators for specific soil issues

Connecting knowledge and performance in public services: from knowing to doing

National Research Council Canada - National Science Library

Walshe, Kieran; Harvey, Gill, RGN; Jas, Pauline

2010-01-01

...'? This book tackles this important question by reviewing a wide range of performance mechanisms. It explores how information about performance can be translated into improvements in services and, conversely, why this does not always happen in practice"--

Evaluating the return in ecosystem services from investment in public land acquisitions.

Directory of Open Access Journals (Sweden)

Kent Kovacs

Full Text Available We evaluate the return on investment (ROI from public land conservation in the state of Minnesota, USA. We use a spatially-explicit modeling tool, the Integrated Valuation of Ecosystem Services and Tradeoffs (InVEST, to estimate how changes in land use and land cover (LULC, including public land acquisitions for conservation, influence the joint provision and value of multiple ecosystem services. We calculate the ROI of a public conservation acquisition as the ratio of the present value of ecosystem services generated by the conservation to the cost of the conservation. For the land scenarios analyzed, carbon sequestration services generated the greatest benefits followed by water quality improvements and recreation opportunities. We found ROI values ranged from 0.21 to 5.28 depending on assumptions about future land use change, service values, and discount rate. Our study suggests conservation is a good investment as long as investments are targeted to areas with low land costs and high service values.

Evaluating the Return in Ecosystem Services from Investment in Public Land Acquisitions

Science.gov (United States)

Kovacs, Kent; Polasky, Stephen; Nelson, Erik; Keeler, Bonnie L.; Pennington, Derric; Plantinga, Andrew J.; Taff, Steven J.

2013-01-01

We evaluate the return on investment (ROI) from public land conservation in the state of Minnesota, USA. We use a spatially-explicit modeling tool, the Integrated Valuation of Ecosystem Services and Tradeoffs (InVEST), to estimate how changes in land use and land cover (LULC), including public land acquisitions for conservation, influence the joint provision and value of multiple ecosystem services. We calculate the ROI of a public conservation acquisition as the ratio of the present value of ecosystem services generated by the conservation to the cost of the conservation. For the land scenarios analyzed, carbon sequestration services generated the greatest benefits followed by water quality improvements and recreation opportunities. We found ROI values ranged from 0.21 to 5.28 depending on assumptions about future land use change, service values, and discount rate. Our study suggests conservation is a good investment as long as investments are targeted to areas with low land costs and high service values. PMID:23776429

Pan-London tuberculosis services: a service evaluation

Directory of Open Access Journals (Sweden)

Belling Ruth

2012-07-01

Full Text Available Abstract Background London has the largest proportion of tuberculosis (TB cases of any western European capital, with almost half of new cases drug-resistant. Prevalence varies considerably between and within boroughs with research suggesting inadequate control of TB transmission in London. Economic pressures may exacerbate the already considerable challenges for service organisation and delivery within this context. This paper presents selected findings from an evaluation of London’s TB services’ organisation, delivery, professional workforce and skill mix, intended to support development of a strategic framework for a pan-London TB service. These may also interest health service professionals and managers in TB services in the UK, other European cities and countries and in services currently delivered by multiple providers operating independently. Methods Objectives were: 1 To establish how London’s TB services are structured and delivered in relation to leadership, management, organisation and delivery, coordination, staffing and support; 2 To identify tools/models for calculating skill mix as a basis for identifying skill mix requirements in delivering TB services across London; 3 To inform a strategic framework for the delivery of a pan-London TB service, which may be applicable to other European cities. The multi-method service audit evaluation comprised documentary analysis, semi-structured interviews with TB service users (n = 10, lead TB health professionals and managers (n = 13 representing London’s five sectors and focus groups with TB nurses (n = 8 and non-London network professionals (n = 2. Results Findings showed TB services to be mainly hospital-based, with fewer community-based services. Documentary analysis and professionals’ interviews suggested difficulties with early access to services, low suspicion index amongst some GPs and restricted referral routes. Interviews indicated lack of managed

Incorporating threat in hotspots and coldspots of biodiversity and ecosystem services.

Science.gov (United States)

Schröter, Matthias; Kraemer, Roland; Ceauşu, Silvia; Rusch, Graciela M

2017-11-01

Spatial prioritization could help target conservation actions directed to maintain both biodiversity and ecosystem services. We delineate hotspots and coldspots of two biodiversity conservation features and five regulating and cultural services by incorporating an indicator of 'threat', i.e. timber harvest profitability for forest areas in Telemark (Norway). We found hotspots, where high values of biodiversity, ecosystem services and threat coincide, ranging from 0.1 to 7.1% of the area, depending on varying threshold levels. Targeting of these areas for conservation follows reactive conservation approaches. In coldspots, high biodiversity and ecosystem service values coincide with low levels of threat, and cover 0.1-3.4% of the forest area. These areas might serve proactive conservation approaches at lower opportunity cost (foregone timber harvest profits). We conclude that a combination of indicators of biodiversity, ecosystem services and potential threat is an appropriate approach for spatial prioritization of proactive and reactive conservation strategies.

Expenditure Analysis of HIV Testing and Counseling Services Using the Cascade Framework in Vietnam.

Directory of Open Access Journals (Sweden)

Van Thu Nguyen

Full Text Available Currently, HIV testing and counseling (HTC services in Vietnam are primarily funded by international sources. However, international funders are now planning to withdraw their support and the Government of Vietnam (GVN is seeking to identify domestic funding and generate client fees to continue services. A clear understanding of the cost to sustain current HTC services is becoming increasingly important to facilitate planning that can lead to making HTC and other HIV services more affordable and sustainable in Vietnam. The objectives of this analysis were to provide a snapshot of current program costs to achieve key program outcomes including 1 testing and identifying PLHIV unaware of their HIV status and 2 successfully enrolling HIV (+ clients in care.We reviewed expenditure data reported by 34 HTC sites in nine Vietnamese provinces over a one-year period from October 2012 to September 2013. Data on program outcomes were extracted from the HTC database of 42,390 client records. Analysis was carried out from the service providers' perspective.The mean expenditure for a single client provided HTC services (testing, receiving results and referral for care/treatment was US $7.6. The unit expenditure per PLHIV identified through these services varied widely from US $22.8 to $741.5 (median: $131.8. Excluding repeat tests, the range for expenditure to newly diagnose a PLHIV was even wider (from US $30.8 to $1483.0. The mean expenditure for one successfully referred HIV client to care services was US $466.6. Personnel costs contributed most to the total cost.Our analysis found a wide range of expenditures by site for achieving the same outcomes. Re-designing systems to provide services at the lowest feasible cost is essential to making HIV services more affordable and treatment for prevention programs feasible in Vietnam. The analysis also found that understanding the determinants and reasons for variance in service costs by site is an important

Valuation of ecosystem services: paradox or Pandora’s box for decision-makers?

OpenAIRE

Nijnik,Maria; Miller,David

2017-01-01

The valuation of ecosystem services (ES) employs a range of methods. Based on a literature review and selected empirical examples, we consider major opportunities and challenges in ecosystem services valuation. We analyse when different valuation methods are appropriate and most useful. We demonstrate that mechanisms to capture benefits and costs are needed; and that the use of valuation should be incorporated more widely in decision-making. However, we argue that ecosystems are complex syste...

Service engineering for prospective vehicle service processes

OpenAIRE

Nagel, Alexander; Steinhilper, Rolf; Freiberger, Stefan; Thäter, Stefan

2013-01-01

Garages are - concerning the vehicle service - faced with growing complexity in automotive mechatronics and on-board bus communication technology. Because of the necessity of profound technical knowledge and smart as well as cost efficient diagnostic tools for garages, Bayreuth University and Fraunhofer IPA pick up the challenge and develop innovative service-processes for future requirements by the project "Kfz-Service Engineering 2020". In order to improve established service-processes and ...

An Integrated Recovery-oriented Model (IRM) for mental health services: evolution and challenges.

Science.gov (United States)

Frost, Barry G; Tirupati, Srinivasan; Johnston, Suzanne; Turrell, Megan; Lewin, Terry J; Sly, Ketrina A; Conrad, Agatha M

2017-01-17

Over past decades, improvements in longer-term clinical and personal outcomes for individuals experiencing serious mental illness (SMI) have been moderate, although recovery has clearly been shown to be possible. Recovery experiences are inherently personal, and recovery can be complex and non-linear; however, there are a broad range of potential recovery contexts and contributors, both non-professional and professional. Ongoing refinement of recovery-oriented models for mental health (MH) services needs to be fostered. This descriptive paper outlines a service-wide Integrated Recovery-oriented Model (IRM) for MH services, designed to enhance personally valued health, wellbeing and social inclusion outcomes by increasing access to evidenced-based psychosocial interventions (EBIs) within a service context that supports recovery as both a process and an outcome. Evolution of the IRM is characterised as a series of five broad challenges, which draw together: relevant recovery perspectives; overall service delivery frameworks; psychiatric and psychosocial rehabilitation approaches and literature; our own clinical and service delivery experience; and implementation, evaluation and review strategies. The model revolves around the person's changing recovery needs, focusing on underlying processes and the service frameworks to support and reinforce hope as a primary catalyst for symptomatic and functional recovery. Within the IRM, clinical rehabilitation (CR) practices, processes and partnerships facilitate access to psychosocial EBIs to promote hope, recovery, self-agency and social inclusion. Core IRM components are detailed (remediation of functioning; collaborative restoration of skills and competencies; and active community reconnection), together with associated phases, processes, evaluation strategies, and an illustrative IRM scenario. The achievement of these goals requires ongoing collaboration with community organisations. Improved outcomes are achievable for

Rock glaciers, Zailiysiky Range, Kungei Ranges, Tienshan, Kazakhstan, Version 1

Data.gov (United States)

National Aeronautics and Space Administration — The Zailiyskiy Alatau is the northernmost parallel latitudinal ranges of the Northern Tien Shan. The highest point of this range is the Talgar peak (4973 m a.s.l.)....

The User Community and a Multi-Mission Data Project: Services, Experiences and Directions of the Space Physics Data Facility

Science.gov (United States)

Fung, Shing F.; Bilitza, D.; Candey, R.; Chimiak, R.; Cooper, John; Fung, Shing; Harris, B.; Johnson R.; King, J.; Kovalick, T.;

A Web service substitution method based on service cluster nets

Science.gov (United States)

Du, YuYue; Gai, JunJing; Zhou, MengChu

2017-11-01

Service substitution is an important research topic in the fields of Web services and service-oriented computing. This work presents a novel method to analyse and substitute Web services. A new concept, called a Service Cluster Net Unit, is proposed based on Web service clusters. A service cluster is converted into a Service Cluster Net Unit. Then it is used to analyse whether the services in the cluster can satisfy some service requests. Meanwhile, the substitution methods of an atomic service and a composite service are proposed. The correctness of the proposed method is proved, and the effectiveness is shown and compared with the state-of-the-art method via an experiment. It can be readily applied to e-commerce service substitution to meet the business automation needs.

A Community-Based, Technology-Supported Health Service for Detecting and Preventing Frailty among Older Adults: A Participatory Design Development Process.

Science.gov (United States)

van Velsen, Lex; Illario, Maddalena; Jansen-Kosterink, Stephanie; Crola, Catherine; Di Somma, Carolina; Colao, Annamaria; Vollenbroek-Hutten, Miriam

2015-01-01

Frailty is a multifaceted condition that affects many older adults and marks decline on areas such as cognition, physical condition, and nutritional status. Frail individuals are at increased risk for the development of disability, dementia, and falls. There are hardly any health services that enable the identification of prefrail individuals and that focus on prevention of further functional decline. In this paper, we discuss the development of a community-based, technology-supported health service for detecting prefrailty and preventing frailty and further functional decline via participatory design with a wide range of stakeholders. The result is an innovative service model in which an online platform supports the integration of traditional services with novel, Information Communication Technology supported tools. This service is capable of supporting the different phases of screening and offers training services, by also integrating them with community-based services. The service model can be used as a basis for developing similar services within a wide range of healthcare systems. We present the service model, the general functioning of the technology platform, and the different ways in which screening for and prevention of frailty has been localized. Finally, we reflect on the added value of participatory design for creating such health services.

Transitions of Care from Child and Adolescent Mental Health Services to Adult Mental Health Services (TRACK Study: A study of protocols in Greater London

Directory of Open Access Journals (Sweden)

Ford Tamsin

2008-06-01

Full Text Available Abstract Background Although young people's transition from Child and Adolescent Mental Health Services (CAMHS to Adult Mental Health Services (AMHS in England is a significant health issue for service users, commissioners and providers, there is little evidence available to guide service development. The TRACK study aims to identify factors which facilitate or impede effective transition from CAHMS to AMHS. This paper presents findings from a survey of transition protocols in Greater London. Methods A questionnaire survey (Jan-April 2005 of Greater London CAMHS to identify transition protocols and collect data on team size, structure, transition protocols, population served and referral rates to AMHS. Identified transition protocols were subjected to content analysis. Results Forty two of the 65 teams contacted (65% responded to the survey. Teams varied in type (generic/targeted/in-patient, catchment area (locality-based, wider or national and transition boundaries with AMHS. Estimated annual average number of cases considered suitable for transfer to AMHS, per CAMHS team (mean 12.3, range 0–70, SD 14.5, n = 37 was greater than the annual average number of cases actually accepted by AMHS (mean 8.3, range 0–50, SD 9.5, n = 33. In April 2005, there were 13 active and 2 draft protocols in Greater London. Protocols were largely similar in stated aims and policies, but differed in key procedural details, such as joint working between CAHMS and AMHS and whether protocols were shared at Trust or locality level. While the centrality of service users' involvement in the transition process was identified, no protocol specified how users should be prepared for transition. A major omission from protocols was procedures to ensure continuity of care for patients not accepted by AMHS. Conclusion At least 13 transition protocols were in operation in Greater London in April 2005. Not all protocols meet all requirements set by government policy. Variation in

Integrating forest products with ecosystem services: a global perspective

Science.gov (United States)

Robert L. Deal; Rachel. White

2012-01-01

Around the world forests provide a broad range of vital ecosystem services. Sustainable forest management and forest products play an important role in global carbon management, but one of the major forestry concerns worldwide is reducing the loss of forestland from development. Currently, deforestation accounts for approximately 20% of total greenhouse gas emissions....

The English and Welsh perspective on legal aid for crime victims

OpenAIRE

Taylor, Louise

2014-01-01

The purpose of this paper is to give a brief overview of the English and Welsh Criminal Justice System and to explain the role of crime victims within it; to offer an insight into some of the soft law provisions that have been developed in England and Wales as alternatives to more formal provisions such as legal aid in offering protection and support to crime victims; and to question whether a right to legal aid to provide independent legal representation (ILR) for victims shou...

Relationship between welfare and individual ranging behaviour in commercial free-range laying hens.

Science.gov (United States)

Larsen, H; Hemsworth, P H; Cronin, G M; Gebhardt-Henrich, S G; Smith, C L; Rault, J-L

2018-01-24

Laying hens housed in free-range systems have access to an outdoor range, and individual hens within a flock differ in their ranging behaviour. Whether there is a link between ranging and laying hen welfare remains unclear. We analysed the relationships between ranging by individual hens on a commercial free-range layer farm and behavioural, physiological and health measures of animal welfare. We hypothesised that hens that access the range more will be (1) less fearful in general and in response to novelty and humans, (2) have better health in terms of physical body condition and (3) have a reduced physiological stress response to behavioural tests of fear and health assessments than hens that use the range less. Using radio frequency identification tracking across two flocks, we recorded individual hens' frequency, duration and consistency of ranging. We also assessed how far hens ventured into the range based on three zones: 0 to 2.4, 2.4 to 11.4 or >11.4 m from the shed. We assessed hen welfare using a variety of measures including: tonic immobility, open field, novel object, human approach, and human avoidance (HAV) behavioural tests; stress-induced plasma corticosterone response and faecal glucocorticoid metabolites; live weight, comb colour, and beak, plumage, footpad, and keel bone condition. Range use was positively correlated with plasma corticosterone response, faecal glucocorticoid metabolites, and greater flight distance during HAV. Hens that used the range more, moved towards rather than away from the novel object more often than hens that ranged less. Distance ranged from the shed was significantly associated with comb colour and beak condition, in that hens with darker combs and more intact beaks ranged further. Overall the findings suggest that there is no strong link between outdoor range usage and laying hen welfare. Alternatively, it may be that hens that differed in their ranging behaviour showed few differences in measures of welfare because

Services de transfert des savoirs

Directory of Open Access Journals (Sweden)

Albert Simard

2009-03-01

include independence from content, an organizational focus, scalability, two drivers, and two levels of resolution. The model is based on a value chain in which value is embedded, advanced, or extracted. A knowledge services system comprises nine stages: generate, transform, manage, use internally, transfer, add value, use professionally, use personally, and evaluate. Knowledge services are delivered through a delivery spectrum ranging from rich to reach. Each region of the delivery spectrum has a set of attributes that influence how services should be delivered.

Specialist services: the need for multi-agency partnership.

Science.gov (United States)

Christian, J; Gilvarry, E

1999-07-01

In the UK the broad trend noted in prevalence surveys is towards increased availability, exposure, and use of illicit drugs across all social strata. There is a developing consensus regarding those groups of young people who are at particular risk. They may be homeless, pregnant, leaving local authority or foster care, engaged in prostitution or involved with the criminal justice system. These young people are likely to require intervention from a variety of agencies and professionals to respond to their multiple needs, yet they are faced with a dearth of specialist substance misuse services. Consequently there is a need to develop a range of partnership approaches amongst both providers and commissioners of services. The importance of partnership has been stressed in a succession of professional guidance documents, but there remain considerable bureaucratic, organisational, and historical barriers that must be overcome. Effective service models that exist in the UK and elsewhere are a source of ideas to stimulate appropriate, child-centred developments. Overall the need for a fresh impetus is emphasised, in which new partnerships are formed, and collaborative services are developed and evaluated. In this way future initiatives can be based upon evidence of clinical and cost effectiveness.

Assessment of usefulness of amplitude-spectrum discriminants for vibroacoustic diagnosis of gearheads of shearer loaders with ranging arms

Energy Technology Data Exchange (ETDEWEB)

Sikora, W; Zakrzewski, T

1985-01-01

Use of vibration and acoustic measurement is analyzed for detection of failures and wear assessment of gearheads of the KWB-3RDU shearer loaders with shearer drums on ranging arms. Problems associated with selecting the optimum measuring points on the gearheads as well as measuring methods and methods for statistical analysis of measurement results are analyzed. Amplitude and frequency range of vibrations generated by the elements of mechanical transmissions in the gearheads are investigated. Use of amplitude-spectrum discriminants for analyzing vibroacoustic processes during idle running and shearer drum operation under conditions of nominal loading is evaluated. Analyses showed that vibration and acoustic measurements are an efficienct method for wear assessment and forecasting service life of gearheads of the KWB-3RDU shearer loaders. The gearheads with the maximum vibrations were characterized by the lowest service life and the highest failure probability. Loading increase caused vibration increase under conditions of idle running and nominal loading. 13 references.

Prioritising Mangrove Ecosystem Services Results in Spatially Variable Management Priorities.

Science.gov (United States)

Atkinson, Scott C; Jupiter, Stacy D; Adams, Vanessa M; Ingram, J Carter; Narayan, Siddharth; Klein, Carissa J; Possingham, Hugh P

2016-01-01

Incorporating the values of the services that ecosystems provide into decision making is becoming increasingly common in nature conservation and resource management policies, both locally and globally. Yet with limited funds for conservation of threatened species and ecosystems there is a desire to identify priority areas where investment efficiently conserves multiple ecosystem services. We mapped four mangrove ecosystems services (coastal protection, fisheries, biodiversity, and carbon storage) across Fiji. Using a cost-effectiveness analysis, we prioritised mangrove areas for each service, where the effectiveness was a function of the benefits provided to the local communities, and the costs were associated with restricting specific uses of mangroves. We demonstrate that, although priority mangrove areas (top 20%) for each service can be managed at relatively low opportunity costs (ranging from 4.5 to 11.3% of overall opportunity costs), prioritising for a single service yields relatively low co-benefits due to limited geographical overlap with priority areas for other services. None-the-less, prioritisation of mangrove areas provides greater overlap of benefits than if sites were selected randomly for most ecosystem services. We discuss deficiencies in the mapping of ecosystems services in data poor regions and how this may impact upon the equity of managing mangroves for particular services across the urban-rural divide in developing countries. Finally we discuss how our maps may aid decision-makers to direct funding for mangrove management from various sources to localities that best meet funding objectives, as well as how this knowledge can aid in creating a national mangrove zoning scheme.

Prioritising Mangrove Ecosystem Services Results in Spatially Variable Management Priorities.

Directory of Open Access Journals (Sweden)

Scott C Atkinson

Full Text Available Incorporating the values of the services that ecosystems provide into decision making is becoming increasingly common in nature conservation and resource management policies, both locally and globally. Yet with limited funds for conservation of threatened species and ecosystems there is a desire to identify priority areas where investment efficiently conserves multiple ecosystem services. We mapped four mangrove ecosystems services (coastal protection, fisheries, biodiversity, and carbon storage across Fiji. Using a cost-effectiveness analysis, we prioritised mangrove areas for each service, where the effectiveness was a function of the benefits provided to the local communities, and the costs were associated with restricting specific uses of mangroves. We demonstrate that, although priority mangrove areas (top 20% for each service can be managed at relatively low opportunity costs (ranging from 4.5 to 11.3% of overall opportunity costs, prioritising for a single service yields relatively low co-benefits due to limited geographical overlap with priority areas for other services. None-the-less, prioritisation of mangrove areas provides greater overlap of benefits than if sites were selected randomly for most ecosystem services. We discuss deficiencies in the mapping of ecosystems services in data poor regions and how this may impact upon the equity of managing mangroves for particular services across the urban-rural divide in developing countries. Finally we discuss how our maps may aid decision-makers to direct funding for mangrove management from various sources to localities that best meet funding objectives, as well as how this knowledge can aid in creating a national mangrove zoning scheme.

Services and the nuclear after-market

International Nuclear Information System (INIS)

Masche, G.C.; Daub, R.

1980-01-01

What are the business opportunities for a reactor vendor in the nuclear after-market, for servicing the reactor after it has started operating. The range of activities which a vendor can perform on behalf of its customers, and the prospects for growth in this market, are reviewed. Considerable advantages accrue to the utility from hiring outside contractors to undertake maintenance, fuelling, and inspection. Among these advantages are increased availability of the reactor and low radiation exposure for the utility's own personnel. (author)

Resource-based interdependencies in value networks for mobile Internet services

NARCIS (Netherlands)

Montalvo, U.W. de; Kar, E. van de; Maitland, C.

2004-01-01

The advent of new electronic platforms, such as fixed and mobile Internet, is forcing firms from a range of industries to come together in so-called 'value networks' for the provision of innovative services. Firms from different industries have widely varying resources. Our analysis is aimed at

Range Reference Atmosphere 0-70 Km Altitude. Kwajalein Missile Range, Kwajalein, Marshall Islands

Science.gov (United States)

1982-01-01

DOCUMENT 360-82 KWAJALEIN MISSILE RANGE KWAJALEIN, MARSHALL ISLANDS RANGE REFERENCE ATMOSPHERE 0-70 KM ALTITUDE, C00 L’’I METEOROLOGY GROUP .RANGE...34Reference Atmosphere (Part 1), Kwajale 4n Missile Range, Kwajalein, Marshall Islands ," ADA002664. * 19. KEY WORDS (Continue on revorsae d. If necoeewy...CLASSIFICATION OF TIlS PAGE (Whe~n Data EnterecD -v DOCUMENT 360-82 Vo- KWAJALEIN MISSILE RANGE KWAJALEIN, MARSHALL ISLANDS RANGE REFERENCE ATMOSPHERE 0-70 km

Assessing Joint Service Opportunities through a Consideration of the Motivating and Constraining Factors

Directory of Open Access Journals (Sweden)

Mark Borman

2006-11-01

Full Text Available In a wide range of industries services are increasingly being developed, or evolving, to support groups of organisations. Not all such joint service initiatives though have been successful. The paper aims to highlight potential issues that need to be addressed when investigating the introduction of a joint service by identifying the motivators and constraints. The approach outlined draws upon network externality theory to provide the motivation for a joint service, and resource based and dependency theories to highlight the constraining factors. Three instances of joint services – in the Banking, Telecommunications and Travel sectors – are subsequently examined. It is concluded that as well as providing externality benefits joint service initiatives can also improve the terms of access to a service – in particular through realising economies of scale. Furthermore it would appear that organisations will have to think carefully about the best way to create, structure and manage a joint service initiative – including who to partner with – given their own particular circumstances, as multiple alternative approaches, with potentially differing ramifications, are available.

ServiceBlueprinting as a service management tool in radiology

International Nuclear Information System (INIS)

Maurer, Martin H.; Hamm, Bernd; Teichgraeber, Ulf

2011-01-01

Purpose: To describe the ServiceBlueprint model as a suitable method of service management in clinical medicine using the example of the routine clinical setting of a radiological department. Materials and methods: ServiceBlueprinting is a concept for the analysis, visualization, and optimization of service processes. To investigate whether the model will also provide a suitable representation of medical services, particularly the provision of radiological services, ServiceBlueprints were created for the modality computed tomography (CT). To this end, an independent observer analyzed the workflow of 40 consecutive CT examinations. Results: The ServiceBlueprint provided an analysis of the status quo of the service processes in CT imaging modality. Weak points in the processes thus became immediately apparent. The model could also be used for personnel management in that it helped to define the roles of staff members from different categories in the value-added process. It served as a basis for the implementation of quality management systems according to Total Quality Management (TQM) and DIN-EN-ISO-9001:2000. Conclusions: The ServiceBlueprint model is a service management concept that is also suitable to visualize medical service processes in routine clinical settings like in a radiology department and has a multifarious potential in process optimization, implementation of quality management systems, and human resources management.

Web Services in 3G Service Platforms

NARCIS (Netherlands)

Lagerberg, Ko; Plas, Dirk-Jaap; Wegdam, M.

2002-01-01

In third-generation (3G) networks, third-party service developers will have access to the mobile network resources using open network interfaces, such as the 3rd Generation Partnership Project's (3GPP's) Open Service Access (OSA). The service platforms that offer these interfaces provide

Routing Service Quality—Local Driver Behavior Versus Routing Services

DEFF Research Database (Denmark)

Ceikute, Vaida; Jensen, Christian S.

2013-01-01

of the quality of one kind of location-based service, namely routing services. Specifically, the paper presents a framework that enables the comparison of the routes provided by routing services with the actual driving behaviors of local drivers. Comparisons include route length, travel time, and also route...... popularity, which are enabled by common driving behaviors found in available trajectory data. The ability to evaluate the quality of routing services enables service providers to improve the quality of their services and enables users to identify the services that best serve their needs. The paper covers......Mobile location-based services is a very successful class of services that are being used frequently by users with GPS-enabled mobile devices such as smartphones. This paper presents a study of how to exploit GPS trajectory data, which is available in increasing volumes, for the assessment...