WorldWideScience

Sample records for range parameter r1

  1. The Operational Parameter Electronic Database of the IPR-R1 TRIGA Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Amir Zacarias; Gomes do Prado Souza, Rose Mary [Nuclear Technology Development Center (CDTN), Belo Horizonte - MG (Brazil)

    2008-10-29

    The new data acquisition based on microcomputer has been designed and developed to allow the real-time collection of all IPR-R1 TRIGA operational parameters. The System monitors and stores the following parameters: control rod positions and its reactivity, reactor power by neutronic and thermal methods, fuel and water temperatures, radiation levels, primary cooling system flow, water pool level and so on. The reactor instrumentation includes four neutron channels that are fed by three neutron-sensitive ion chambers, and by one fission chamber located around the core. The detector signals are amplified in a voltage amplifier. The amplified output voltage is between 0 to {+-} 10 V which is the input sign of the multiplexing board and to the analog to digital converter card of the PC with the associated software. Other analog signs, collected by the data acquisition system, are outputs of the reactor control console and from some digital indicators or directly from the thermocouples. The measure data are shown in the LCD computer video monitor. The data acquisition system is programmed with a set of icons called visual programming. The main indications of the control console are collected by the data acquisition system. Information on all aspects of reactor operation is displayed on the computer screen. The program presents four screens: 1 - control, start up channel, period and reactivity, 2 - radiation levels, 3 - power channels and 4 - cooling system and temperatures. Bar graph indicators, and visual and audible enunciators are also provided. Information displayed on the monitor is recorded on hard disk copy. The analogical signs are received in three cards model PCLD-789 by Advantech Co connected in cascade, each one with 16 channels which totalize 48 inputs. The outputs of the three conditioning cards are addressed to the analog input plug of the data acquisition card, model PCL-818hd by Advantech Co. The system collects data during reactor operations and stores

  2. Neutronic parameters characterization of the TRIGA IPR-R1 using scale 6.0 (KENO VI)

    Energy Technology Data Exchange (ETDEWEB)

    Faria, Victor; Miro, Rafael; Verdu, Gumersindo; Barrachina, Teresa [Institute for Industrial, Radiophysical and Environmental Safety (ISIRYM), Universitat Politecnica de València (Spain); Silva, Clarysson A. Mello da; Pereira, Claubia [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Dalle, Hugo Moura [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2011-07-01

    KENO-VI is a Monte Carlo based transport code used to obtain the criticality of a nuclear system. A model built using this code in the SCALE6.0 software system was developed for the characterization of neutronic parameters of the IPR-R1 TRIGA research reactor. A comparison with experimental values and those calculated with a MCNP code model could be then attained with the purpose to validate this methodology. (author)

  3. Design of a digital system for operational parameters simulation of IPR-R1 TRIGA nuclear research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Lage, Aldo M.F.; Mesquita, Amir Z.; Felippe, Adriano de A.M., E-mail: aldo@cdtn.br, E-mail: amir@cdtn.br, E-mail: adrianoamfelippe@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN /CNEN-MG), Belo Horizonte, MG (Brazil); Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2017-11-01

    The instrumentation of nuclear reactors is designed based on the reliability, redundancy and diversification of control systems. The monitoring of the parameters is of crucial importance with regard to the operational efficiency and safety of the installation. Since the first criticality of a nuclear reactor, achieved by Fermi et al. in 1942, there has been concern about the reliable monitoring of the parameters involved in the chain reaction. This paper presents the current stage of the system of simulation, which is under development at the CDTN, which intends to simulate the operation of the TRIGA IPR-R1 nuclear reactor, involving the evolution of neutron flux and reactor power related events. The system will be developed using LabVIEW® software, using the modern concept of virtual instruments (VIs) that are visualized in a video monitor. For the implementation of this model, computational tools and systems analysis are necessary, which help and facilitate the implementation of the simulator. In this article we will show some of these techniques and the initial design of the model to be implemented. The design of a computational system is of great importance, since it guides in the implementation stages and generates the documentation for later maintenance and updating of the computational system. It is noteworthy that the innovations developed in research reactors are normally used in power reactors. The relatively low costs enable research reactors to be an excellent laboratory for developing techniques for future reactors. (author)

  4. Relativity Parameters Determined from Lunar Laser Ranging

    Science.gov (United States)

    Williams, J. G.; Newhall, X. X.; Dickey, J. O.

    1996-01-01

    Analysis of 24 years of lunar laser ranging data is used to test the principle of equivalence, geodetic precession, the PPN parameters beta and gamma, and G/G. Recent data can be fitted with a rms scatter of 3 cm. (a) Using the Nordtvedt effect to test the principle of equivalence, it is found that the Moon and Earth accelerate alike in the Sun's field. The relative accelerations match to within 5 x 10(exp -13) . This limit, combined with an independent determination of y from planetary time delay, gives beta. Including the uncertainty due to compositional differences, the parameter beta differs from unity by no more than 0.0014; and, if the weak equivalence principle is satisfied, the difference is no more than 0.0006. (b) Geodetic precession matches its expected 19.2 marc sec/yr rate within 0.7%. This corresponds to a 1% test of gamma. (c) Apart from the Nordtvedt effect, beta and gamma can be tested from their influence on the lunar orbit. It is argued theoretically that the linear combination 0.8(beta) + 1.4(gamma) can be tested at the 1% level of accuracy. For solutions using numerically derived partial derivatives, higher sensitivity is found. Both 6 and y match the values of general relativity to within 0.005, and the linear combination beta+ gamma matches to within 0,003, but caution is advised due to the lack of theoretical understanding of these sensitivities. (d) No evidence for a changing gravitational constant is found, with absolute value of G/G less than or equal to 8 x lO(exp -12)/yr. There is significant sensitivity to G/G through solar perturbations on the lunar orbit.

  5. Reference Physiological Ranges for Serum Biochemical Parameters ...

    African Journals Online (AJOL)

    SUMMARY. Background: A valid scientific evaluation of the efficacy of HIV vaccines or antiretroviral drugs includes ... biochemical parameters among healthy adult Cameroonians to support planned HIV Vaccine clinical trials and ... participants: AST, ALT, alkaline phosphatase, creatinine, total protein, albumin, triglyceride,.

  6. Ratio of ellipticities between 192 and 208 nm (R1): An effective electronic circular dichroism parameter for characterization of the helical components of proteins and peptides.

    Science.gov (United States)

    Banerjee, Raja; Sheet, Tridip

    2017-11-01

    Circular dichroism (CD) spectroscopy represents an important tool for characterization of the peptide and protein secondary structures that mainly arise from the conformational disposition of the peptide backbone in solution. In 1991 Manning and Woody proposed that, in addition to the signal intensity, the ratio between [θ]nπ* and [θ]ππ*ǁ ((R 2 ) ≅ [θ] 222 /[θ] 208 ), along with [θ]ππ*⊥ and [θ]ππ*ǁ ((R 1 ) ≅ [θ] 192 /[θ] 208 ), may be utilized towards identifying the peptide/protein conformation (especially 3 10 - and α-helices). However, till date the use of the ratiometric ellipticity component for helical structure analysis of peptides and proteins has not been reported. We studied a series of temperature dependent CD spectra of a thermally stable, model helical peptide and its related analogs in water as a function of added 2,2,2-trifluoroethanol (TFE) in order to explore their landscape of helicity. For the first time, we have experimentally shown here that the R 1 parameter can characterize better the individual helices, while the other parameter R 2 and the signal intensity do not always converge. We emphasize the use of the R 1 ratio of ellipticities for helical characterization because of the common origin of these two bands (exciton splitting of the amide π→ π* transition in a helical polypeptide). This approach may become worthwhile and timely with the increasing accessibility of CD synchrotron sources. © 2017 Wiley Periodicals, Inc.

  7. Reference Physiological Ranges for Serum Biochemical Parameters ...

    African Journals Online (AJOL)

    After complete assay, the data were subjected to both parametric and non parametric statistics for analyses with 2.5 and 97.5 percentiles considered as the lower and upper limits of reference ranges. Results: There were 331(66.1%) males and 170(33.9) females, with 359(71.7%) and 142(28.3) of them residing in the urban ...

  8. Quantitative multi-parameter mapping of R1, PD*, MT and R2* at 3T: a multi-center validation

    Directory of Open Access Journals (Sweden)

    Nikolaus eWeiskopf

    2013-06-01

    Full Text Available Multi-center studies using magnetic resonance imaging facilitate studying small effect sizes, global population variance and rare diseases. The reliability and sensitivity of these multi-center studies crucially depend on the comparability of the data generated at different sites and time points. The level of inter-site comparability is still controversial for conventional anatomical T1-weighted MRI data. Quantitative multi-parameter mapping (MPM was designed to provide MR parameter measures that are comparable across sites and time points, i.e., 1mm high-resolution maps of the longitudinal relaxation rate (R1=1/T1, effective proton density (PD*, magnetization transfer saturation (MT and effective transverse relaxation rate (R2*=1/T2*. MPM was validated at 3T for use in multi-center studies by scanning five volunteers at three different sites. We determined the inter-site bias, inter-site and intra-site coefficient of variation (CoV for typical morphometric measures (i.e., gray matter probability maps used in voxel-based morphometry and the four quantitative parameters. The inter-site bias and CoV were smaller than 3.1% and 8%, respectively, except for the inter-site CoV of R2* (< 20%. The gray matter probability maps based on the MT parameter maps had a 14% higher inter-site reproducibility than maps based on conventional T1-weighted images. The low inter-site bias and variance in the parameters and derived gray matter probability maps confirm the high comparability of the quantitative maps across sites and time points. The reliability, short acquisition time, high resolution and the detailed insights into the brain microstructure provided by MPM makes it an efficient tool for multi-center imaging studies.

  9. Quantitative multi-parameter mapping of R1, PD(*), MT, and R2(*) at 3T: a multi-center validation.

    Science.gov (United States)

    Weiskopf, Nikolaus; Suckling, John; Williams, Guy; Correia, Marta M; Inkster, Becky; Tait, Roger; Ooi, Cinly; Bullmore, Edward T; Lutti, Antoine

    2013-01-01

    Multi-center studies using magnetic resonance imaging facilitate studying small effect sizes, global population variance and rare diseases. The reliability and sensitivity of these multi-center studies crucially depend on the comparability of the data generated at different sites and time points. The level of inter-site comparability is still controversial for conventional anatomical T1-weighted MRI data. Quantitative multi-parameter mapping (MPM) was designed to provide MR parameter measures that are comparable across sites and time points, i.e., 1 mm high-resolution maps of the longitudinal relaxation rate (R1 = 1/T1), effective proton density (PD(*)), magnetization transfer saturation (MT) and effective transverse relaxation rate (R2(*) = 1/T2(*)). MPM was validated at 3T for use in multi-center studies by scanning five volunteers at three different sites. We determined the inter-site bias, inter-site and intra-site coefficient of variation (CoV) for typical morphometric measures [i.e., gray matter (GM) probability maps used in voxel-based morphometry] and the four quantitative parameters. The inter-site bias and CoV were smaller than 3.1 and 8%, respectively, except for the inter-site CoV of R2(*) (maps based on the MT parameter maps had a 14% higher inter-site reproducibility than maps based on conventional T1-weighted images. The low inter-site bias and variance in the parameters and derived GM probability maps confirm the high comparability of the quantitative maps across sites and time points. The reliability, short acquisition time, high resolution and the detailed insights into the brain microstructure provided by MPM makes it an efficient tool for multi-center imaging studies.

  10. Reference Ranges for Some Biochemical Parameters in Adult ...

    African Journals Online (AJOL)

    PURPOSE: To establish the reference ranges of some biochemical parameters for adult Kenyan population. METHODS: In a prospective involving 1100 healthy blood donors (age: 18-55 yr) in Kenyatta National Hospital, Kenya reference ranges of some biochemical analytes were constructed by using the parametric ...

  11. Analysis of the variation of range parameters of thermal cameras

    Science.gov (United States)

    Bareła, Jarosław; Kastek, Mariusz; Firmanty, Krzysztof; Krupiński, Michał

    2016-10-01

    Measured range characteristics may vary considerably (up to several dozen percent) between different samples of the same camera type. The question is whether the manufacturing process somehow lacks repeatability or the commonly used measurement procedures themselves need improvement. The presented paper attempts to deal with the aforementioned question. The measurement method has been thoroughly analyzed as well as the measurement test bed. Camera components (such as detector and optics) have also been analyzed and their key parameters have been measured, including noise figures of the entire system. Laboratory measurements are the most precise method used to determine range parameters of a thermal camera. However, in order to obtain reliable results several important conditions have to be fulfilled. One must have the test equipment capable of measurement accuracy (uncertainty) significantly better than the magnitudes of measured quantities. The measurements must be performed in a controlled environment thus excluding the influence of varying environmental conditions. The personnel must be well-trained, experienced in testing the thermal imaging devices and familiar with the applied measurement procedures. The measurement data recorded for several dozen of cooled thermal cameras (from one of leading camera manufacturers) have been the basis of the presented analysis. The measurements were conducted in the accredited research laboratory of Institute of Optoelectronics (Military University of Technology).

  12. Daily Earth orientation parameters from satellite laser ranging

    Science.gov (United States)

    Pavlis, E.

    2003-04-01

    The JCET/GSFC Associate Analysis Center for the International Laser Ranging Service (ILRS) participated over the past year in a Pilot Project of the ILRS Analysis Working Group. The goal of the Pilot Project is the optimal combination of laser ranging data from ETALON 1 and 2 with the nominal data set from LAGEOS and LAGEOS 2, which ILRS normally uses in our series of Earth Orientation Parameters EOP, submitted to the International Earth Rotation Service (IERS). We present here the new re-analysis of the expanded data set for the definition of the Terrestrial Reference Frame (TRF) and its crust-fixed orientation. This latest analysis of the SLR data set from LAGEOS and LAGEOS 2 with the addition of the data from ETALON 1 and 2, examines the possibility of improving the results for the TRF and EOP, with only a small increase in the processing effort. This work is being done in the framework of the ILRS Pilot Project for, amongst other things, the precise estimation of the EOP from SLR data in a routine fashion. Along with the Earth orientation and the static parameters of the TRF we determined a time series of variations of its origin with respect to the instantaneous center of mass of the Earth system (geocenter). The data from the two newly included targets, ETALON 1 and 2, come from an enhanced data set which is the result of a dedicated tracking campaign by the ILRS network of stations, initiated at the request of the ILRS Analysis Working Group on April 1, 2001 and currently in progress. Due to the different orbital geometry and tracking pattern of the two “constellations” (LAGEOS vs. ETALON), it was required to carefully evaluate the relative weight between the two data sets in order to optimally combine them. The data were reduced using NASA Goddard’s GEODYN/SOLVE II software, resulting in a final RMS error of about 8 mm. We will discuss our weighting scheme, vis-à-vis our solution for the EOP and geocenter, compare them to our previous solutions based

  13. Parameter-free Locality Sensitive Hashing for Spherical Range Reporting

    DEFF Research Database (Denmark)

    Ahle, Thomas Dybdahl; Pagh, Rasmus; Aumüller, Martin

    2017-01-01

    by standard LSH) and easy queries such as those where the number of points to report is a constant fraction of S, or where almost all points in S are far away from the query point. In contrast, known data structures fix LSH parameters based on certain parameters of the input alone. The algorithm has expected...

  14. Survey of nuclear parameters from the TRIGA Mark I IPR R1 Brazilian reactor with concentric configuration aiming the application of K{sub 0} neutron activation technique; Levantamento de parametros nucleares do reator TRIGA Mark I IPR R1 com configuracao concentrica visando a aplicacao da tecnica de ativacao neutronica K{sub 0}

    Energy Technology Data Exchange (ETDEWEB)

    Franco, Milton Batista

    2006-07-01

    This research intended to determine the nuclear parameters a, f, spectral index and neutron temperature in several irradiations positions of the TRIGA Mark 1 IPR-R1 reactor, for use on the parametric method K{sub 0} in the CDTN. K{sub 0} is a monostandard method of neutron activation analysis. It is, on the whole, experimentally simple, flexible and an important tool for accurate and convenient standardization in instrumental multi-element analysis. At the time the parameters were determined at the rotatory rack, lower layer and in the central thimble: alpha was calculated applying the three bare monitor method using {sup 197}Au, {sup 94}Zr and {sup 96}Zr; f determination was done according to the bare bi-isotopic method; neutron temperature was calculated through the direct method using {sup 176}Lu, {sup 94}Zr, {sup 96}Zr and {sup 197}Au and the Westcott's g(Tn) function for the {sup 176}Lu was calculated and the result was interpolated in the Grintakis and Kim (1975) Table, determining the neutron temperature. The procedure to check the parameters consisted in using standard solutions of Au (metal foil, NBS), Lu (LuO{sub 2}, Johnson Mattey Company - JMC) and Zr (ZrO{sub 2} and metal foil, Johnson Mattey Company 99,99% and Zry - 4: 98,14% of Zr, National Bureau of Standard- NBS). Several certified reference materials and two samples of intercomparisons (samples of sediment of the IAEA/ARCAL XXVI project) have been analysed by means of k{sub 0}- INAA in order to verify the efficiency of the method and the quality of the parameters. The certified reference materials were: GXR-2, GXR-5 and GXR-6 of the United States Geological Survey (USGS) and Soil-5, Soil-7 and SL-1 of the International Atomic Energy Agency (IAEA). (author)

  15. Kinematic parameter estimation using close range photogrammetry for sport applications

    Science.gov (United States)

    Magre Colorado, Luz Alejandra; Martínez Santos, Juan Carlos

    2015-12-01

    In this article, we show the development of a low-cost hardware/software system based on close range photogrammetry to track the movement of a person performing weightlifting. The goal is to reduce the costs to the trainers and athletes dedicated to this sport when it comes to analyze the performance of the sportsman and avoid injuries or accidents. We used a web-cam as the data acquisition hardware and develop the software stack in Processing using the OpenCV library. Our algorithm extracts size, position, velocity, and acceleration measurements of the bar along the course of the exercise. We present detailed characteristics of the system with their results in a controlled setting. The current work improves the detection and tracking capabilities from a previous version of this system by using HSV color model instead of RGB. Preliminary results show that the system is able to profile the movement of the bar as well as determine the size, position, velocity, and acceleration values of a marker/target in scene. The average error finding the size of object at four meters of distance is less than 4%, and the error of the acceleration value is 1.01% in average.

  16. Biological decolorization of malachite green by Deinococcus radiodurans R1.

    Science.gov (United States)

    Lv, Guo-Ying; Cheng, Jian-Hui; Chen, Xiao-Yang; Zhang, Zuo-Fa; Fan, Lei-Fa

    2013-09-01

    Cultures of Deinococcus radiodurans R1 were observed to decolorize malachite green (MG) dye. The effects of various factors on decolorization efficiency were investigated. The optimal decolorization temperature and pH ranges were 25-50°C and 6.0-8.0, respectively. With increasing initial MG concentration, the decolorization efficiency decreased, and the kinetic parameters, R(MG,max) and K(m) were 416.7 mg-MG/g-cell/h and 1033.7 mg/L, respectively. The D. radiodurans R1 cells were capable of tolerating and rapidly degrading high concentrations of the dye. When MG concentration was 200 mg/L, decolorization efficiency was up to 97.2% within 30 min. The intermediate products of MG biodegradation were 4-(dimethylamino)phenol and 4-(dimethylamino)benzophenone, as identified by gas chromatography/mass spectrometry analysis. Toxicity tests indicated that D. radiodurans R1 did not detoxify an MG solution completely, but clearly reduced its toxicity. This study demonstrated that this strain was an efficient degrader compared to other microorganisms. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. New Y-function based MOSFET parameter extraction method from weak to strong inversion range

    Science.gov (United States)

    Henry, J. B.; Rafhay, Q.; Cros, A.; Ghibaudo, G.

    2016-09-01

    A new Y-function based MOSFET parameter extraction method is proposed. This method relies on explicit expressions of inversion charge and drain current versus Yc(=Qi√Cgc)-function and Y(=Id/√gm)-function, respectively, applicable from weak to strong inversion range. It enables a robust MOSFET parameter extraction even for low gate voltage overdrive, whereas conventional extraction techniques relying on strong inversion approximation fail.

  18. The largest reference range study for hematological parameters from Turkey: A case control study

    OpenAIRE

    Nilgün Tekkeşin; Hüseyin Bekoz; Faruk Tükenmez

    2015-01-01

    Objectives: Accurate, reliable laboratory reference ranges are essential for effective clinical evaluation and monitoring. We present robust reference ranges established for hematology parameters using the Sysmex XT2000i analyzer. Methods: Blood samples were taken from 17409 healthy adults (19 to 49 years, 51.4% men and 48.6% women) and routine hematology analysis performed. Patients were assessed as healthy on the basis of a medical history and routine medical examinations. Serum hematini...

  19. Model Study of Wave Overtopping of Marine Structure for a Wide Range of Geometric Parameters

    DEFF Research Database (Denmark)

    Kofoed, Jens Peter

    2000-01-01

    The objective of the study described in this paper is to enable estimation of wave overtopping rates for slopes/ramps given by a wide range of geometric parameters when subjected to varying wave conditions. To achieve this a great number of model tests are carried out in a wave tank using irregular...

  20. Effective-range parameters and vertex constants for Λ-nuclear systems

    Science.gov (United States)

    Rakityansky, S. A.; Gopane, I. M.

    For a wide range of the core-nuclei (6 ≤ A ≤ 207), the scattering lengths, effective radii, and the other effective-range parameters (up to the order ˜ k8) for the angular momentum ℓ = 0, 1, 2 are calculated within a two-body ΛA-model. For the same hypernuclear systems, the S-matrix residues as well as the corresponding Nuclear-Vertex and Asymptotic-Normalization constants (NVC’s and ANC’s) for the bound states are also found.

  1. Phases' characteristics of poultry litter hydrothermal carbonization under a range of process parameters.

    Science.gov (United States)

    Mau, Vivian; Quance, Julie; Posmanik, Roy; Gross, Amit

    2016-11-01

    The aim of this work was to study the hydrothermal carbonization of poultry litter under a range of process parameters. Experiments were conducted to investigate the effect of HTC of poultry litter under a range of operational parameters (temperature, reaction time, and solids concentration) on the formation and characteristics of its phases. Results showed production of a hydrochar with caloric value of 24.4MJ/kg, similar to sub-bituminous coal. The gaseous phase consisted mainly of CO2. However, significant amounts of H2S dictate the need for (further) treatment. The process also produced an aqueous phase with chemical characteristics suggesting its possible use as a liquid fertilizer. Temperature had the most significant effect on processes and product formation. Solids concentration was not a significant factor once dilution effects were considered. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. [Dielectric parameters of ascitic and pleural fluids in the microwave range in different nosologies].

    Science.gov (United States)

    Romanov, A N; Kovrigin, A O; Grigorchuk, O G; Lubennikov, V A; Lazarev, A F

    2011-01-01

    The dielectric parameters of ascitic and pleural fluids formed in the human body in oncological and nononcological diseases of different nosology have been estimated in the range between 400 MHz and 1.2 GHZ. The dependence of refractive and absorption indices of ascitic and pleural liquids on the signal frequency and mass concentration of dissolved substances was found. Common regularities and distinctions in the behavior of their dielectric properties were revealed.

  3. Diffusion and Home Range Parameters for Rodents: Peromyscus maniculatus in New Mexico

    OpenAIRE

    Abramson, G.; Giuggioli, L.; Kenkre, V. M.; Dragoo, J. W.; Parmenter, R. R.; Parmenter, C. A.; Yates, T. L.

    2005-01-01

    We analyze data from a long term field project in New Mexico, consisting of repeated sessions of mark-recaptures of Peromyscus maniculatus (Rodentia: Muridae), the host and reservoir of Sin Nombre Virus (Bunyaviridae: Hantavirus). The displacements of the recaptured animals provide a means to study their movement from a statistical point of view. We extract two parameters from the data with the help of a simple model: the diffusion constant of the rodents, and the size of their home range. Th...

  4. Improved Semiconductor Lattice Parameters and Band Gaps from a Middle-Range Screened Hybrid Functional

    OpenAIRE

    Lucero, Melissa J.; Henderson, Thomas M.; Scuseria, Gustavo E.

    2011-01-01

    We show that the middle-range exchange-correlation hybrid of Henderson, Izmaylov, Scuseria and Savin (HISS) performs extremely well for elemental and binary semiconductors with narrow or visible spectrum band gaps, as well as some wider gap or more ionic systems used commercially. The lattice parameters are superior to those predicted by the screened hybrid functional of Heyd, Scuseria and Ernzerhof (HSE), and provide a significant improvement over geometries predicted by semilocal functional...

  5. Full gate voltage range Lambert-function based methodology for FDSOI MOSFET parameter extraction

    Science.gov (United States)

    Karatsori, T. A.; Theodorou, C. G.; Ioannidis, E. G.; Haendler, S.; Josse, E.; Dimitriadis, C. A.; Ghibaudo, G.

    2015-09-01

    A new full gate voltage range methodology using a Lambert W function based inversion charge model, for extracting the electrical parameters in FDSOI nano-MOSFET devices, has been developed. Split capacitance-voltage measurements carried out on 14 nm technology FDSOI devices show that the inversion charge variation with gate voltage can be well described by a Lambert W function. Based on the drain current equation in the linear region including the inversion charge described by the Lambert function of gate voltage and the standard mobility equation enables five electrical MOSFET parameters to be extracted from experimental Id-Vg measurements (ideality factor, threshold voltage, low field mobility, first and second order mobility attenuation factors). The extracted parameters were compared with those extracted by the well-known Y-function in strong inversion region. The present methodology for extracting the electrical MOSFET parameters was verified over a wide range of channel lengths on nano-scale FDSOI devices, demonstrating its simplicity, accuracy and robustness.

  6. Correlation of normal-range FMR1 repeat length or genotypes and reproductive parameters.

    Science.gov (United States)

    Maslow, Bat-Sheva L; Davis, Stephanie; Engmann, Lawrence; Nulsen, John C; Benadiva, Claudio A

    2016-09-01

    This study aims to ascertain whether the length of normal-ranged CGG repeats on the FMR1 gene correlates with abnormal reproductive parameters. We performed a retrospective, cross-sectional study of all FMR1 carrier screening performed as part of routine care at a large university-based fertility center from January 2011 to March 2014. Correlations were performed between normal-range FMR1 length and baseline serum anti-Müllerian hormone (AMH), cycle day 3 follicle stimulating hormone (FSH), ovarian volumes (OV), antral follicle counts (AFC), and incidence of diminished ovarian reserve (DOR), while controlling for the effect of age. Six hundred three FMR1 screening results were collected. One subject was found to be a pre-mutation carrier and was excluded from the study. Baseline serum AMH, cycle day 3 FSH, OV, and AFC data were collected for the 602 subjects with normal-ranged CGG repeats. No significant difference in median age was noted amongst any of the FMR1 repeat genotypes. No significant correlation or association was found between any allele length or genotype, with any of the reproductive parameters or with incidence of DOR at any age (p > 0.05). However, subjects who were less than 35 years old with low/low genotype were significantly more likely to have below average AMH levels compared to those with normal/normal genotype (RR 3.82; 95 % CI 1.38-10.56). This large study did not demonstrate any substantial association between normal-range FMR1 repeat lengths and reproductive parameters.

  7. Signatures of the Martian rotation parameters in the Doppler and range observables

    Science.gov (United States)

    Yseboodt, Marie; Dehant, Véronique; Péters, Marie-Julie

    2017-09-01

    The position of a Martian lander is affected by different aspects of Mars' rotational motions: the nutations, the precession, the length-of-day variations and the polar motion. These various motions have a different signature in a Doppler observable between the Earth and a lander on Mars' surface. Knowing the correlations between these signatures and the moments when these signatures are not null during one day or on a longer timescale is important to identify strategies that maximize the geophysical return of observations with a geodesy experiment, in particular for the ones on-board the future NASA InSight or ESA-Roscosmos ExoMars2020 missions. We provide first-order formulations of the signature of the rotation parameters in the Doppler and range observables. These expressions are functions of the diurnal rotation of Mars, the lander position, the planet radius and the rotation parameter. Additionally, the nutation signature in the Doppler observable is proportional to the Earth declination with respect to Mars. For a lander on Mars close to the equator, the motions with the largest signature in the Doppler observable are due to the length-of-day variations, the precession rate and the rigid nutations. The polar motion and the liquid core signatures have a much smaller amplitude. For a lander closer to the pole, the polar motion signature is enhanced while the other signatures decrease. We also numerically evaluate the amplitudes of the rotation parameters signature in the Doppler observable for landers on other planets or moons.

  8. The largest reference range study for hematological parameters from Turkey: A case control study

    Directory of Open Access Journals (Sweden)

    Nilgün Tekkeşin

    2014-12-01

    Full Text Available Objectives: Accurate, reliable laboratory reference ranges are essential for effective clinical evaluation and monitoring. We present robust reference ranges established for hematology parameters using the Sysmex XT2000i analyzer. Methods: Blood samples were taken from 17409 healthy adults (19 to 49 years, 51.4% men and 48.6% women and routine hematology analysis performed. Patients were assessed as healthy on the basis of a medical history and routine medical examinations. Serum hematinic assays (vitamin B12, folate, iron and ferritin were also analyzed in order to exclude the potential anemia existence. Results: There was a statistically significant difference (p<0.001 between men and women, with the former showing higher CBC values, except WBC, neutrophil and platelet counts compared to females. Several differences were observed when compared to previously established values from Turkey, most notably in leucocytes and platelets. Our findings for CBC parameters, except leucocyte count and MCV are in general agreement with previously published data from more limited trials undertaken in other countries. Conclusions: In spite of the uncontrolled factors influencing hematological values, this study permitted to establish the new hematological reference values in Turkey, especially living near sea level. In the absence of previously detailed investigated hematological reference values in Turkey, we offered to use these results for clinical management of Turkish patients and interpretations of laboratory data for research purpose. J Clin Exp Invest 2014; 5 (4: 548-552

  9. Improved semiconductor lattice parameters and band gaps from a middle-range screened hybrid exchange functional.

    Science.gov (United States)

    Lucero, M J; Henderson, T M; Scuseria, G E

    2012-04-11

    We show that the middle-range exchange-correlation hybrid of Henderson, Izmaylov, Scuseria and Savin (HISS) performs extremely well for elemental and binary semiconductors with narrow or visible spectrum band gaps, as well as some wider gap or more ionic systems used in devices. The lattice parameters are superior to those predicted by the screened hybrid functional of Heyd, Scuseria and Ernzerhof (HSE), and provide a significant improvement over the geometries predicted by typical semilocal functionals, yielding results competitive with PBEsol, which was specially tuned for solids. HISS also yields band gaps superior to those produced by functionals developed specifically for the solid state. Timings indicate that HISS is more computationally efficient than HSE, implying that the high quality lattice constants coupled with improved optical band gap predictions render HISS a useful adjunct to HSE in the modeling of geometry-sensitive semiconductors.

  10. ATMOSPHERIC DYNAMICS OF TERRESTRIAL EXOPLANETS OVER A WIDE RANGE OF ORBITAL AND ATMOSPHERIC PARAMETERS

    Energy Technology Data Exchange (ETDEWEB)

    Kaspi, Yohai [Department of Earth and Planetary Sciences, Weizmann Institute of Science, 234 Herzl st., 76100, Rehovot (Israel); Showman, Adam P., E-mail: yohai.kaspi@weizmann.ac.il [Department of Planetary Sciences and Lunar and Planetary Laboratory, The University of Arizona, 1629 University Blvd., Tucson, AZ 85721 (United States)

    2015-05-01

    The recent discoveries of terrestrial exoplanets and super-Earths extending over a broad range of orbital and physical parameters suggest that these planets will span a wide range of climatic regimes. Characterization of the atmospheres of warm super-Earths has already begun and will be extended to smaller and more distant planets over the coming decade. The habitability of these worlds may be strongly affected by their three-dimensional atmospheric circulation regimes, since the global climate feedbacks that control the inner and outer edges of the habitable zone—including transitions to Snowball-like states and runaway-greenhouse feedbacks—depend on the equator-to-pole temperature differences, patterns of relative humidity, and other aspects of the dynamics. Here, using an idealized moist atmospheric general circulation model including a hydrological cycle, we study the dynamical principles governing the atmospheric dynamics on such planets. We show how the planetary rotation rate, stellar flux, atmospheric mass, surface gravity, optical thickness, and planetary radius affect the atmospheric circulation and temperature distribution on such planets. Our simulations demonstrate that equator-to-pole temperature differences, meridional heat transport rates, structure and strength of the winds, and the hydrological cycle vary strongly with these parameters, implying that the sensitivity of the planet to global climate feedbacks will depend significantly on the atmospheric circulation. We elucidate the possible climatic regimes and diagnose the mechanisms controlling the formation of atmospheric jet streams, Hadley and Ferrel cells, and latitudinal temperature differences. Finally, we discuss the implications for understanding how the atmospheric circulation influences the global climate.

  11. NEUTRON-PROTON EFFECTIVE RANGE PARAMETERS AND ZERO-ENERGY SHAPE DEPENDENCE.

    Energy Technology Data Exchange (ETDEWEB)

    HACKENBURG, R.W.

    2005-06-01

    A completely model-independent effective range theory fit to available, unpolarized, np scattering data below 3 MeV determines the zero-energy free proton cross section {sigma}{sub 0} = 20.4287 {+-} 0.0078 b, the singlet apparent effective range r{sub s} = 2.754 {+-} 0.018{sub stat} {+-} 0.056{sub syst} fm, and improves the error slightly on the parahydrogen coherent scattering length, a{sub c} = -3.7406 {+-} 0.0010 fm. The triplet and singlet scattering lengths and the triplet mixed effective range are calculated to be a{sub t} = 5.4114 {+-} 0.0015 fm, a{sub s} = -23.7153 {+-} 0.0043 fm, and {rho}{sub t}(0,-{epsilon}{sub t}) = 1.7468 {+-} 0.0019 fm. The model-independent analysis also determines the zero-energy effective ranges by treating them as separate fit parameters without the constraint from the deuteron binding energy {epsilon}{sub t}. These are determined to be {rho}{sub t}(0,0) = 1.705 {+-} 0.023 fm and {rho}{sub s}(0,0) = 2.665 {+-} 0.056 fm. This determination of {rho}{sub t}(0,0) and {rho}{sub s}(0,0) is most sensitive to the sparse data between about 20 and 600 keV, where the correlation between the determined values of {rho}{sub t}(0,0) and {rho}{sub s}(0,0) is at a minimum. This correlation is responsible for the large systematic error in r{sub s}. More precise data in this range are needed. The present data do not event determine (with confidence) that {rho}{sub t}(0,0) {ne} {rho}{sub t}(0, -{epsilon}{sub t}), referred to here as ''zero-energy shape dependence''. The widely used measurement of {sigma}{sub 0} = 20.491 {+-} 0.014 b from W. Dilg, Phys. Rev. C 11, 103 (1975), is argued to be in error.

  12. Comprehensive reference ranges for hematology and clinical chemistry laboratory parameters derived from normal Nigerian adults.

    Science.gov (United States)

    Miri-Dashe, Timzing; Osawe, Sophia; Tokdung, Monday; Daniel, Monday Tokdung Nenbammun; Daniel, Nenbammun; Choji, Rahila Pam; Mamman, Ille; Deme, Kurt; Damulak, Dapus; Abimiku, Alash'le

    2014-01-01

    Interpretation of laboratory test results with appropriate diagnostic accuracy requires reference or cutoff values. This study is a comprehensive determination of reference values for hematology and clinical chemistry in apparently healthy voluntary non-remunerated blood donors and pregnant women. Consented clients were clinically screened and counseled before testing for HIV, Hepatitis B, Hepatitis C and Syphilis. Standard national blood donors' questionnaire was administered to consented blood donors. Blood from qualified volunteers was used for measurement of complete hematology and chemistry parameters. Blood samples were analyzed from a total of 383 participants, 124 (32.4%) males, 125 (32.6%) non-pregnant females and 134 pregnant females (35.2%) with a mean age of 31 years. Our results showed that the red blood cells count (RBC), Hemoglobin (HB) and Hematocrit (HCT) had significant gender difference (p = 0.000) but not for total white blood count (p>0.05) which was only significantly higher in pregnant verses non-pregnant women (p = 0.000). Hemoglobin and Hematocrit values were lower in pregnancy (P = 0.000). Platelets were significantly higher in females than men (p = 0.001) but lower in pregnant women (p =  .001) with marked difference in gestational period. For clinical chemistry parameters, there was no significant difference for sodium, potassium and chloride (p>0.05) but gender difference exists for Bicarbonate (HCO3), Urea nitrogen, Creatinine as well as the lipids (p0.05). Hematological and Clinical Chemistry reference ranges established in this study showed significant gender differences. Pregnant women also differed from non-pregnant females and during pregnancy. This is the first of such comprehensive study to establish reference values among adult Nigerians and difference observed underscore the need to establish reference values for different populations.

  13. Comprehensive reference ranges for hematology and clinical chemistry laboratory parameters derived from normal Nigerian adults.

    Directory of Open Access Journals (Sweden)

    Timzing Miri-Dashe

    Full Text Available BACKGROUND: Interpretation of laboratory test results with appropriate diagnostic accuracy requires reference or cutoff values. This study is a comprehensive determination of reference values for hematology and clinical chemistry in apparently healthy voluntary non-remunerated blood donors and pregnant women. METHODS AND FINDINGS: Consented clients were clinically screened and counseled before testing for HIV, Hepatitis B, Hepatitis C and Syphilis. Standard national blood donors' questionnaire was administered to consented blood donors. Blood from qualified volunteers was used for measurement of complete hematology and chemistry parameters. Blood samples were analyzed from a total of 383 participants, 124 (32.4% males, 125 (32.6% non-pregnant females and 134 pregnant females (35.2% with a mean age of 31 years. Our results showed that the red blood cells count (RBC, Hemoglobin (HB and Hematocrit (HCT had significant gender difference (p = 0.000 but not for total white blood count (p>0.05 which was only significantly higher in pregnant verses non-pregnant women (p = 0.000. Hemoglobin and Hematocrit values were lower in pregnancy (P = 0.000. Platelets were significantly higher in females than men (p = 0.001 but lower in pregnant women (p =  .001 with marked difference in gestational period. For clinical chemistry parameters, there was no significant difference for sodium, potassium and chloride (p>0.05 but gender difference exists for Bicarbonate (HCO3, Urea nitrogen, Creatinine as well as the lipids (p0.05. CONCLUSIONS: Hematological and Clinical Chemistry reference ranges established in this study showed significant gender differences. Pregnant women also differed from non-pregnant females and during pregnancy. This is the first of such comprehensive study to establish reference values among adult Nigerians and difference observed underscore the need to establish reference values for different populations.

  14. Geophysical parameters from laser ranging to the Lageos and Etalon satellites

    Science.gov (United States)

    Pavlis, E.

    The JCET/GSFC Associate Analysis Center for the International Laser Ranging Service (ILRS) participated over the past year in a Pilot Project of the ILRS Analysis Working Group. The goal of the Pilot Project is the optimal combination of laser ranging data from ETALON 1 and 2 with the nominal data set from LAGEOS and LAGEOS 2, which ILRS normally uses in our series of Earth Orientation Parameters -EOP, submitted to the International Earth Rotation Service (IERS). We present here the new re-analysis of the expanded data set for the definition of the Terrestrial Reference Frame (TRF) and its crust-fixed orientation. The TRF plays an important role in the multi-technique monitoring of temporal variations in the gravitational field and its very low degree and order components, as well as changes in the inertia tensor as a result of angular momentum exchanges in the Earth system. This latest analysis of the SLR data set from LAGEOS and LAGEOS 2 with the addition of the data from ETALON 1 and 2, examines the possibility of improving the results for the TRF, with only a small increase in the processing effort. This work is being done in the framework of the ILRS Pilot Project for, amongst other things, the precise estimation of the EOP from SLR data in a routine fashion. Along with the static parameters of the TRF we determined a time series of variations of its origin with respect to the instantaneous center of mass of the Earth system (geocenter). The data from the two newly included targets, ETALON 1 and 2, come from an enhanced data set which is the result of a dedicated tracking campaign by the ILRS network of stations, initiated at the request of the ILRS Analysis Working Group on April 1, 2001 and currently in progress. Due to the different orbital geometry and tracking pattern of the two "constellations" (LAGEOS vs. ETALON), it was required to carefully evaluate the relative weight between the two data sets in order to optimally combine them. The data were reduced

  15. Daily Earth Orientation Parameters From Satellite Laser Ranging to the LAGEOS and ETALON Satellites

    Science.gov (United States)

    Pavlis, E. C.

    2002-05-01

    The JCET/GSFC Associate Analysis Center for the International Laser Ranging Service (ILRS) participated over the past year in a Pilot Project of the ILRS Analysis Working Group. The goal of the Pilot Project is the optimal combination of laser ranging data from ETALON 1 and 2 with the nominal data set from LAGEOS and LAGEOS 2, which ILRS normally uses in our series of Earth Orientation Parameters -EOP, submitted to the International Earth Rotation Service (IERS). We present here our analysis of the expanded data set for the definition of the Terrestrial Reference Frame (TRF) and its crust-fixed orientation. The TRF plays an important role in the multi-technique monitoring of temporal variations in the gravitational field and its very low degree and order components, as well as changes in the inertia tensor as a result of angular momentum exchanges in the Earth system. This latest analysis of the SLR data set from LAGEOS and LAGEOS 2 with the addition of the data from ETALON 1 and 2, examines the possibility of improving the results for the TRF, with only a small increase in the processing effort. This work is being done in the framework of the ILRS Pilot Project for, amongst other things, the precise estimation of the EOP from SLR data in a routine fashion. Along with the static parameters of the TRF we determined a time series of variations of its origin with respect to the instantaneous center of mass of the Earth system (geocenter). The data from the two newly included targets, ETALON 1 and 2, come from an enhanced data set which is the result of a dedicated tracking campaign by the ILRS network of stations, initiated at the request of the ILRS Analysis Working Group on April 1, 2001 and currently in progress. Due to the different orbital geometry and tracking pattern of the two "constellations" (LAGEOS vs. ETALON), it was required to carefully evaluate the relative weight between the two data sets in order to optimally combine them. The data were reduced using

  16. Analysis of Scaling Parameters of the Batch Unscented Transformation for Precision Orbit Determination using Satellite Laser Ranging Data

    Directory of Open Access Journals (Sweden)

    Jae-Hyuk Kim

    2011-09-01

    Full Text Available The current study analyzes the effects of the scaling parameters of the batch unscented transformation on precision satellite orbit determination. Satellite laser ranging (SLR data are used in the orbit determination algorithm, which consists of dynamics model, observation model and filtering algorithm composed of the batch unscented transformation. TOPEX/Poseidon SLR data are used by utilizing the normal point (NP data observed from ground station. The filtering algorithm includes a repeated series of processes to determine the appropriate scaling parameters for the batch unscented transformation. To determine appropriate scaling parameters, general ranges of the scaling parameters of α, β, κ, λ are established. Depending on the range settings, each parameter was assigned to the filtering algorithm at regular intervals. Appropriate scaling parameters are determined for observation data obtained from several observatories, by analyzing the relationship between tuning properties of the scaling parameters and estimated orbit precision. The orbit determination of satellite using the batch unscented transformation can achieve levels of accuracy within several tens of cm with the appropriate scaling parameters. The analyses in the present study give insights into the roles of scaling parameters in the batch unscented transformation method.

  17. DEFINITION OF OPERATING PARAMETERS OUTPUT RANGE OF FUNCTIONAL SUBSYSTEMS HYDRAULIC SYSTEMS OF THE AIRCRAFT

    Directory of Open Access Journals (Sweden)

    M. A. Bobrin

    2014-01-01

    Full Text Available To evaluate the operational tolerance field hydraulic output parameters under various working conditions and the flight stages are mathematical relationships and the results obtained in the environment Mathcad in graphical form.

  18. Crystal lattice properties fully determine short-range interaction parameters for alkali and halide ions.

    Science.gov (United States)

    Mao, Albert H; Pappu, Rohit V

    2012-08-14

    Accurate models of alkali and halide ions in aqueous solution are necessary for computer simulations of a broad variety of systems. Previous efforts to develop ion force fields have generally focused on reproducing experimental measurements of aqueous solution properties such as hydration free energies and ion-water distribution functions. This dependency limits transferability of the resulting parameters because of the variety and known limitations of water models. We present a solvent-independent approach to calibrating ion parameters based exclusively on crystal lattice properties. Our procedure relies on minimization of lattice sums to calculate lattice energies and interionic distances instead of equilibrium ensemble simulations of dense fluids. The gain in computational efficiency enables simultaneous optimization of all parameters for Li+, Na+, K+, Rb+, Cs+, F-, Cl-, Br-, and I- subject to constraints that enforce consistency with periodic table trends. We demonstrate the method by presenting lattice-derived parameters for the primitive model and the Lennard-Jones model with Lorentz-Berthelot mixing rules. The resulting parameters successfully reproduce the lattice properties used to derive them and are free from the influence of any water model. To assess the transferability of the Lennard-Jones parameters to aqueous systems, we used them to estimate hydration free energies and found that the results were in quantitative agreement with experimentally measured values. These lattice-derived parameters are applicable in simulations where coupling of ion parameters to a particular solvent model is undesirable. The simplicity and low computational demands of the calibration procedure make it suitable for parametrization of crystallizable ions in a variety of force fields.

  19. Extending the range and physical accuracy of coarse-grained models: Order parameter dependent interactions

    Science.gov (United States)

    Wagner, Jacob W.; Dannenhoffer-Lafage, Thomas; Jin, Jaehyeok; Voth, Gregory A.

    2017-07-01

    Order parameters (i.e., collective variables) are often used to describe the behavior of systems as they capture different features of the free energy surface. Yet, most coarse-grained (CG) models only employ two- or three-body non-bonded interactions between the CG particles. In situations where these interactions are insufficient for the CG model to reproduce the structural distributions of the underlying fine-grained (FG) model, additional interactions must be included. In this paper, we introduce an approach to expand the basis sets available in the multiscale coarse-graining (MS-CG) methodology by including order parameters. Then, we investigate the ability of an additive local order parameter (e.g., density) and an additive global order parameter (i.e., distance from a hard wall) to improve the description of CG models in interfacial systems. Specifically, we study methanol liquid-vapor coexistence, acetonitrile liquid-vapor coexistence, and acetonitrile liquid confined by hard-wall plates, all using single site CG models. We find that the use of order parameters dramatically improves the reproduction of structural properties of interfacial CG systems relative to the FG reference as compared with pairwise CG interactions alone.

  20. Spherical gearing with intermediate ball elements: parameter ranges with a high contact ratio

    Science.gov (United States)

    Gorbenko, M. V.; Gorbenko, T. I.

    2017-02-01

    The paper presents analytical research of the geometry and kinematical parameters of spherical gearing with ball intermediate elements. The main attention is paid to the influence of the offset coefficient on the tooth geometry generation, the contact ratio and the motion transmission angle. Intermediate ball element racetracks on the gear are trochoidal curves on a spherical surface. Two areas for the offset coefficient values providing a high value of the contact ratio - basic trochoid (without offset) and prolate trochoid with abutting racetracks of adjacent ball elements ― were revealed. Analysis of the investigated parameters showed that for power transmission, it is preferable to use spherical gearing without an offset, and for kinematic transmission, it is possible to use profiles with a large offset. The present study allows making a rational choice of geometrical parameters depending on the transmission predestination.

  1. Determination of plant growth rate and growth temperature range from measurement of physiological parameters

    Science.gov (United States)

    R. S. Criddle; B. N. Smith; L. D. Hansen; J. N. Church

    2001-01-01

    Many factors influence species range and diversity, but temperature and temperature variability are always major global determinants, irrespective of local constraints. On a global scale, the ranges of many taxa have been observed to increase and their diversity decrease with increasing latitude. On a local scale, gradients in species distribution are observable with...

  2. DETERMINE THE RANGE OF VARIATION OF THE CONTROL SUBSYSTEM OUTPUT PARAMETERS

    Directory of Open Access Journals (Sweden)

    M. A. Bobrin

    2015-01-01

    Full Text Available For the evaluation of the tolerance of output parameters of the controls functional subsystem the hydraulic system under different operating conditions and phases of flight are given mathematical relationships and the results obtained in Mathcad are given in graphical form.

  3. Crystal lattice properties fully determine short-range interaction parameters for alkali and halide ions

    OpenAIRE

    Mao, Albert H.; Pappu, Rohit V.

    2012-01-01

    Accurate models of alkali and halide ions in aqueous solution are necessary for computer simulations of a broad variety of systems. Previous efforts to develop ion force fields have generally focused on reproducing experimental measurements of aqueous solution properties such as hydration free energies and ion-water distribution functions. This dependency limits transferability of the resulting parameters because of the variety and known limitations of water models. We present a solvent-indep...

  4. Possible Range of Viscosity Parameters to Trigger Black Hole Candidates to Exhibit Different States of Outbursts

    Science.gov (United States)

    Mondal, Santanu; Chakrabarti, Sandip K.; Nagarkoti, Shreeram; Arévalo, Patricia

    2017-11-01

    In a two component advective flow around a compact object, a high-viscosity Keplerian disk is flanked by a low angular momentum and low-viscosity flow that forms a centrifugal, pressure-supported shock wave close to the black hole. The post-shock region that behaves like a Compton cloud becomes progressively smaller during the outburst as the spectra change from the hard state (HS) to the soft state (SS), in order to satisfy the Rankine–Hugoniot relation in the presence of cooling. The resonance oscillation of the shock wave that causes low-frequency quasi-periodic oscillations (QPOs) also allows us to obtain the shock location from each observed QPO frequency. Applying the theory of transonic flow, along with Compton cooling and viscosity, we obtain the viscosity parameter {α }{SK} required for the shock to form at those places in the low-Keplerian component. When we compare the evolution of {α }{SK} for each outburst, we arrive at a major conclusion: in each source, the advective flow component typically requires an exactly similar value of {α }{SK} when transiting from one spectral state to another (e.g., from HS to SS through intermediate states and the other way around in the declining phase). Most importantly, these {α }{SK} values in the low angular momentum advective component are fully self-consistent in the sense that they remain below the critical value {α }{cr} required to form a Keplerian disk. For a further consistency check, we compute the {α }{{K}} of the Keplerian component, and find that in each of the objects, {α }{SK} < {α }{cr} < {α }{{K}}.

  5. Using a laser range finder mounted on a MicroVision robot to estimate environmental parameters

    Science.gov (United States)

    Fehr, Duc; Papanikolopoulos, Nikos

    2009-05-01

    In this article we will present a new robot (MicroVision) that has been designed at the University of Minnesota (UMN), Center for Distributed Robotics. Its design reminds of the designs of previous robots built at the UMN such as the COTS Scouts or the eROSIs. It is composed of a body with two wheels and a tail just like the two aforementioned robots. However, the MicroVision has more powerful processing and sensing capabilities and we utilized these to compute areas in the surrounding environment by using a convex hull approach. We are trying to estimate the projected area of an object onto the ground. This is done by the computation of convex hulls that are based on the data received from the MicroVision's laser range finder. Although localization of the robot is an important feature in being able to compute these convex hulls, localization and mapping techniques are only used as a tool and are not an end in this work. The main idea of this work is to demonstrate the ability of the laser carrying MicroVision robot to move around an object in order to get a scan from each side. From these scans, the convex hull of the shape is deduced and its projected area onto the ground is estimated.

  6. Roller massager improves range of motion of plantar flexor muscles without subsequent decreases in force parameters.

    Science.gov (United States)

    Halperin, Israel; Aboodarda, Saied Jalal; Button, Duane C; Andersen, Lars L; Behm, David G

    2014-02-01

    Limited dorsiflexion range of motion (ROM) has been linked to lower limb injuries. Improving limited ankle ROM may decrease injury rates. Static stretching (SS) is ubiquitously used to improve ROM but can lead to decreases in force and power if performed prior to the activity. Thus, alternatives to improve ROM without performance decrements are needed. To compare the effects of SS and self massage (SM) with a roller massage of the calf muscles on ankle ROM, maximal voluntary contraction (MVC) force F100 (force produced in the first 100 ms of the MVC), electromyography (EMG of soleus and tibialis anterior) characteristics of the plantar flexors, and a single limb balance test. Fourteen recreationally trained subjects were tested on two separate occasions in a randomized cross-over design. After a warm up, subjects were assessed for passive dorsiflexion ROM, MVC, and a single-limb balance test with eyes closed. The same three measurements were repeated after 10 minutes (min) of rest and prior to the interventions. Following the pre-test, participants randomly performed either SS or SM for 3 sets of 30 seconds (s) with 10s of rest between each set. At one and 10 min post-interventions the participants repeated the three measurements, for a third and fourth cycle of testing. Roller massage increased and SS decreased maximal force output during the post-test measurements, with a significant difference occurring between the two interventions at 10 min post-test (p massage (p massage with a roller massager led to small improvements in MVC force relative to SS at 10 min post-intervention. These results highlight the effectiveness of a roller massager relative to SS. These results could affect the type of warm-up prior to activities that depend on high force and sufficient ankle ROM. 2c.

  7. An exploratory clustering approach for extracting stride parameters from tracking collars on free-ranging wild animals.

    Science.gov (United States)

    Dewhirst, Oliver P; Roskilly, Kyle; Hubel, Tatjana Y; Jordan, Neil R; Golabek, Krystyna A; McNutt, J Weldon; Wilson, Alan M

    2017-02-01

    Changes in stride frequency and length with speed are key parameters in animal locomotion research. They are commonly measured in a laboratory on a treadmill or by filming trained captive animals. Here, we show that a clustering approach can be used to extract these variables from data collected by a tracking collar containing a GPS module and tri-axis accelerometers and gyroscopes. The method enables stride parameters to be measured during free-ranging locomotion in natural habitats. As it does not require labelled data, it is particularly suitable for use with difficult to observe animals. The method was tested on large data sets collected from collars on free-ranging lions and African wild dogs and validated using a domestic dog. © 2017. Published by The Company of Biologists Ltd.

  8. ADMET rules of thumb II: A comparison of the effects of common substituents on a range of ADMET parameters.

    Science.gov (United States)

    Gleeson, Paul; Bravi, Gianpaolo; Modi, Sandeep; Lowe, Daniel

    2009-08-15

    A systematic analysis of data generated in key in vitro assays within GSK has been undertaken to identify what impact a range of common substituents have on a range of ADMET parameters. These include; P450 1A2, 2C9, 2C19, 2D6 and 3A4 inhibition, hERG inhibition, phosphate buffer solubility and artificial membrane permeability. We do this by identifying all matched molecular pairs, differing by the replacement of a hydrogen atom with a list of predefined substituents. For each substituent we calculate the mean difference in the ADMET parameter for all the matched molecular pairs identified, making a statistical assessment of the difference, as well as assessing the diversity for each example to ensure that the results can be generalized. We also relate the change in activity observed for each substituent to differences in their molecular properties in an effort to identify any structural alerts.

  9. Determination of reference ranges for full blood count parameters in neonatal cord plasma in Hilla, Babil, Iraq

    Directory of Open Access Journals (Sweden)

    Al-Marzoki JM

    2012-10-01

    Full Text Available Jasim M Al-Marzoki1, Zainab W Al-Maaroof2, Ali H Kadhum31Department of Pediatrics, 2Department of Pathology, Babylon Medical College, 3Babylon Gynecology and Pediatric Teaching Hospital, Hilla, IraqBackground: The health of an individual is known to vary in different countries, in the same country at different times, and in the same individuals at different ages. This means that the condition of individuals must be related to or compared with reference data. Determination of a reference range for the healthy term newborn is clinically important in terms of various complete blood count parameters. The purpose of this study was to establish a local reference range for full blood count parameters in neonatal cord plasma in Hilla, Babil, Iraq.Methods: A total of 220 mothers and their neonates were enrolled in this cross-sectional study from February 2011 to January 2012. Maternal inclusion criteria were age 15–45 years, an uneventful pregnancy, and hemoglobin ≥ 10 g. Neonatal inclusion criteria were full term (37–42 weeks and normal birth weight. The umbilical cord was immediately clamped after delivery of the baby; 3 mL of cord blood was then taken from the umbilical vein and collected in a tube containing ethylenediamine tetra-acetic acid, its plasma was analyzed for full blood count parameters by standard Coulter gram, and the differential leukocyte count was done manually.Results: Mean neonatal hemoglobin was 13.88 ± 1.34 (range 11–17.3 g/dL and mean white cell count was 10.12 ± 2.8 (range 3.1–21.6 × 109/L. Mean platelet count was 267.63 ± 60.62 (range 152–472 × 109/L. No significant differences in red cell, white cell, or platelet counts were found between males and females, except for neutrophil count. The current study shows lower levels of hemoglobin, white cells, and red cells compared with other studies, and there is agreement with some studies and disagreement with others concerning platelet count.Conclusion: Most results

  10. The Effect of the Accelerometer Operating Range on Biomechanical Parameters: Stride Length, Velocity, and Peak Tibial Acceleration during Running

    Directory of Open Access Journals (Sweden)

    Christian Mitschke

    2018-01-01

    Full Text Available Previous studies have used accelerometers with various operating ranges (ORs when measuring biomechanical parameters. However, it is still unclear whether ORs influence the accuracy of running parameters, and whether the different stiffnesses of footwear midsoles influence this accuracy. The purpose of the present study was to systematically investigate the influence of OR on the accuracy of stride length, running velocity, and on peak tibial acceleration. Twenty-one recreational heel strike runners ran on a 15-m indoor track at self-selected running speeds in three footwear conditions (low to high midsole stiffness. Runners were equipped with an inertial measurement unit (IMU affixed to the heel cup of the right shoe and with a uniaxial accelerometer at the right tibia. Accelerometers (at the tibia and included in the IMU with a high OR of ±70 g were used as the reference and the data were cut at ±32, ±16, and at ±8 g in post-processing, before calculating parameters. The results show that the OR influenced the outcomes of all investigated parameters, which were not influenced by tested footwear conditions. The lower ORs were associated with an underestimation error for all biomechanical parameters, which increased noticeably with a decreasing OR. It can be concluded that accelerometers with a minimum OR of ±32 g should be used to avoid inaccurate measurements.

  11. Systematic inference of the long-range dependence and heavy-tail distribution parameters of ARFIMA models

    Science.gov (United States)

    Watkins, Nick; Graves, Timothy; Franzke, Christian; Gramacy, Robert; Tindale, Elizabeth

    2017-04-01

    Long-Range Dependence (LRD) and heavy-tailed distributions are ubiquitous in natural and socio-economic data. Such data can be self-similar whereby both LRD and heavy-tailed distributions contribute to the self-similarity as measured by the Hurst exponent. Some methods widely used in the physical sciences separately estimate these two parameters, which can lead to estimation bias. Those which do simultaneous estimation are based on frequentist methods such as Whittle's approximate maximum likelihood estimator. Here we present a new and systematic Bayesian framework for the simultaneous inference of the LRD and heavy-tailed distribution parameters of a parametric ARFIMA model with non-Gaussian innovations. As innovations we use the alpha-stable and t-distributions which have power law tails. Our algorithm also provides parameter uncertainty estimates. We test our algorithm using synthetic data, and also data from the Geostationary Operational Environmental Satellite system (GOES) solar X-ray time series. These tests show that our algorithm is able to accurately and robustly estimate the LRD and heavy-tailed distribution parameters. See Physica A: Statistical Mechanics and its Applications, (January 2017), DOI: 10.1016/j.physa.2017.01.028

  12. Systematic inference of the long-range dependence and heavy-tail distribution parameters of ARFIMA models

    Science.gov (United States)

    Graves, Timothy; Franzke, Christian L. E.; Watkins, Nicholas W.; Gramacy, Robert B.; Tindale, Elizabeth

    2017-05-01

    Long-Range Dependence (LRD) and heavy-tailed distributions are ubiquitous in natural and socio-economic data. Such data can be self-similar whereby both LRD and heavy-tailed distributions contribute to the self-similarity as measured by the Hurst exponent. Some methods widely used in the physical sciences separately estimate these two parameters, which can lead to estimation bias. Those which do simultaneous estimation are based on frequentist methods such as Whittle's approximate maximum likelihood estimator. Here we present a new and systematic Bayesian framework for the simultaneous inference of the LRD and heavy-tailed distribution parameters of a parametric ARFIMA model with non-Gaussian innovations. As innovations we use the α-stable and t-distributions which have power law tails. Our algorithm also provides parameter uncertainty estimates. We test our algorithm using synthetic data, and also data from the Geostationary Operational Environmental Satellite system (GOES) solar X-ray time series. These tests show that our algorithm is able to accurately and robustly estimate the LRD and heavy-tailed distribution parameters.

  13. Determination of reference ranges for full blood count parameters in neonatal cord plasma in Hilla, Babil, Iraq.

    Science.gov (United States)

    Al-Marzoki, Jasim M; Al-Maaroof, Zainab W; Kadhum, Ali H

    2012-01-01

    The health of an individual is known to vary in different countries, in the same country at different times, and in the same individuals at different ages. This means that the condition of individuals must be related to or compared with reference data. Determination of a reference range for the healthy term newborn is clinically important in terms of various complete blood count parameters. The purpose of this study was to establish a local reference range for full blood count parameters in neonatal cord plasma in Hilla, Babil, Iraq. A total of 220 mothers and their neonates were enrolled in this cross-sectional study from February 2011 to January 2012. Maternal inclusion criteria were age 15-45 years, an uneventful pregnancy, and hemoglobin ≥ 10 g. Neonatal inclusion criteria were full term (37-42 weeks) and normal birth weight. The umbilical cord was immediately clamped after delivery of the baby; 3 mL of cord blood was then taken from the umbilical vein and collected in a tube containing ethylenediamine tetra-acetic acid, its plasma was analyzed for full blood count parameters by standard Coulter gram, and the differential leukocyte count was done manually. Mean neonatal hemoglobin was 13.88 ± 1.34 (range 11-17.3) g/dL and mean white cell count was 10.12 ± 2.8 (range 3.1-21.6) × 109/L. Mean platelet count was 267.63 ± 60.62 (range 152-472) × 109/L. No significant differences in red cell, white cell, or platelet counts were found between males and females, except for neutrophil count. The current study shows lower levels of hemoglobin, white cells, and red cells compared with other studies, and there is agreement with some studies and disagreement with others concerning platelet count. Most results in the current study were within the reference range. The hematological reference values for Iraqi neonatal cord plasma need to be confirmed by larger numbers of blood samples and by collecting samples from different areas in Iraq.

  14. Solubility parameter of drugs for predicting the solubility profile type within a wide polarity range in solvent mixtures.

    Science.gov (United States)

    Peña, M A; Reíllo, A; Escalera, B; Bustamante, P

    2006-09-14

    The solubility enhancement produced by two binary mixtures with a common cosolvent (ethanol-water and ethyl acetate-ethanol) was studied against the solubility parameter of the mixtures (delta1) to characterize different types of solubility profiles. Benzocaine, salicylic acid and acetanilide show a single peak in the least polar mixture (ethanol-ethyl acetate) at delta1=22.59, 21.70 and 20.91 MPa1/2, respectively. Phenacetin displays two solubility maxima, at delta1=25.71 (ethanol-water) and at delta1=23.30 (ethyl acetate-ethanol). Acetanilide shows an inflexion point in ethanol-water instead of a peak, and the sign of the slope does not vary when changing the cosolvent. The solubility profiles were compared to those obtained in dioxane-water, having a solubility parameter range similar to that covered with the common cosolvent system. All the drugs reach a maximum at about 90% dioxane (delta1=23 MPa1/2). A modification of the extended Hildebrand method is applicable for curves with a single maximum whereas a model including the Hildebrand solubility parameter delta1 and the acidic partial solubility parameter delta1a is required to calculate more complex solubility profiles (with inflexion point or two maxima). A single equation was able to fit the solubility curves of all drugs in the common cosolvent system. The polarity of the drug is related to the shape of the solubility profile against the solubility parameter delta1 of the solvent mixtures. The drugs with solubility parameters below 24 MPa1/2 display a single peak in ethanol-ethyl acetate. The drugs with delta2 values above 25 MPa1/2 show two maxima, one in each solvent mixture (ethanol-water and ethanol-ethyl acetate). The position of the maximum in ethanol-ethyl acetate shifts to larger polarity values (higher delta1 values) as the solubility parameter of the drug delta2 increases.

  15. Parameter space for range of bare graviton mass in an FLRW universe based on dRGT massive gravity theory

    Science.gov (United States)

    Alatas, Husin; Falah, Ahmad K.; Alditia, Randika; Gunara, Bobby E.

    2017-12-01

    We discuss the existence of graviton in a Friedmann-Lemaitre-Robertson-Walker (FLRW) metric of isotropic and homogeneous universe based on de Rham-Gabadadze-Tolley (dRGT) nonlinear massive gravity theory. We consider a similar FLRW fiducial metric in the formulation that lead to a Friedmann-Lemaitre equation similar to the case of cosmological constant based dark energy model. We show that these equations can be constructed by considering a constraint equation found from varying the corresponding action with respect to the fiducial metric. Under a specific choice of fiducial metric lapse function, we determine the range of present cosmological time bare graviton mass in a parameter space by considering the observed cosmological constant density parameter and the related Higuchi bound for the lower dressed graviton mass value. The existence of an indefinite condition in the corresponding parameter space is also discussed and analyzed, as well as the characteristics of the related bare graviton mass and the strong-coupling scale quantity.

  16. Parameter-free numerical method for modeling thermal convection in square cavities in a wide range of Rayleigh numbers

    Science.gov (United States)

    Goloviznin, V. M.; Korotkin, I. A.; Finogenov, S. A.

    2016-12-01

    Some numerical results for the two- and three-dimensional de Vahl Davis benchmark are presented. This benchmark describes thermal convection in a square (cubic) cavity with vertical heated walls in a wide range of Rayleigh numbers (104 to 1014), which covers both laminar and highly turbulent f lows. Turbulent f lows are usually described using a turbulence model with parameters that depend on the Rayleigh number and require adjustment. An alternative is Direct Numerical Simulation (DNS) methods, but they demand extremely large computational grids. Recently, there has been an increasing interest in DNS methods with an incomplete resolution, which, in some cases, are able to provide acceptable results without resolving Kolmogorov scales. On the basis of this approach, the so-called parameter-free computational techniques have been developed. These methods cover a wide range of Rayleigh numbers and allow computing various integral properties of heat transport on relatively coarse computational grids. In this paper, a new numerical method based on the CABARET scheme is proposed for solving the Navier-Stokes equations in the Boussinesq approximation. This technique does not involve a turbulence model or any tuning parameters and has a second-order approximation scheme in time and space on uniform and nonuniform grids with a minimal computational stencil. Testing the technique on the de Vahl Davis benchmark and a sequence of refined grids shows that the method yields integral heat f luxes with a high degree of accuracy for both laminar and highly turbulent f lows. For Rayleigh numbers up to 1014, a several percent accuracy is achieved on an extremely coarse grid consisting of 20 × 20 cells refined toward the boundary. No definite or comprehensive explanation of this computational phenomenon has been given. Cautious optimism is expressed regarding the perspectives of using the new method for thermal convection computations at low Prandtl numbers typical of liquid metals.

  17. Quantitative estimation of climatic parameters from vegetation data in North America by the mutual climatic range technique

    Science.gov (United States)

    Anderson, Katherine H.; Bartlein, Patrick J.; Strickland, Laura E.; Pelltier, Richard T.; Thompson, Robert S.; Shafer, Sarah L.

    2012-01-01

    The mutual climatic range (MCR) technique is perhaps the most widely used method for estimating past climatic parameters from fossil assemblages, largely because it can be conducted on a simple list of the taxa present in an assemblage. When applied to plant macrofossil data, this unweighted approach (MCRun) will frequently identify a large range for a given climatic parameter where the species in an assemblage can theoretically live together. To narrow this range, we devised a new weighted approach (MCRwt) that employs information from the modern relations between climatic parameters and plant distributions to lessen the influence of the "tails" of the distributions of the climatic data associated with the taxa in an assemblage. To assess the performance of the MCR approaches, we applied them to a set of modern climatic data and plant distributions on a 25-km grid for North America, and compared observed and estimated climatic values for each grid point. In general, MCRwt was superior to MCRun in providing smaller anomalies, less bias, and better correlations between observed and estimated values. However, by the same measures, the results of Modern Analog Technique (MAT) approaches were superior to MCRwt. Although this might be reason to favor MAT approaches, they are based on assumptions that may not be valid for paleoclimatic reconstructions, including that: 1) the absence of a taxon from a fossil sample is meaningful, 2) plant associations were largely unaffected by past changes in either levels of atmospheric carbon dioxide or in the seasonal distributions of solar radiation, and 3) plant associations of the past are adequately represented on the modern landscape. To illustrate the application of these MCR and MAT approaches to paleoclimatic reconstructions, we applied them to a Pleistocene paleobotanical assemblage from the western United States. From our examinations of the estimates of modern and past climates from vegetation assemblages, we conclude that

  18. Resistance Upset Welding of ODS Steel Fuel Claddings—Evaluation of a Process Parameter Range Based on Metallurgical Observations

    Directory of Open Access Journals (Sweden)

    Fabien Corpace

    2017-08-01

    Full Text Available Resistance upset welding is successfully applied to Oxide Dispersion Strengthened (ODS steel fuel cladding. Due to the strong correlation between the mechanical properties and the microstructure of the ODS steel, this study focuses on the consequences of the welding process on the metallurgical state of the PM2000 ODS steel. A range of process parameters is identified to achieve operative welding. Characterizations of the microstructure are correlated to measurements recorded during the welding process. The thinness of the clad is responsible for a thermal unbalance, leading to a higher temperature reached. Its deformation is important and may lead to a lack of joining between the faying surfaces located on the outer part of the join which can be avoided by increasing the dissipated energy or by limiting the clad stick-out. The deformation and the temperature reached trigger a recrystallization phenomenon in the welded area, usually combined with a modification of the yttrium dispersion, i.e., oxide dispersion, which can damage the long-life resistance of the fuel cladding. The process parameters are optimized to limit the deformation of the clad, preventing the compactness defect and the modification of the nanoscale oxide dispersion.

  19. Prediction of rumen degradability parameters of a wide range of forages and non-forages by NIRS.

    Science.gov (United States)

    Foskolos, A; Calsamiglia, S; Chrenková, M; Weisbjerg, M R; Albanell, E

    2015-07-01

    Kinetics of nutrient degradation in the rumen is an important component of feed evaluation systems for ruminants. The in situ technique is commonly used to obtain such dynamic parameters, but it requires cannulated animals and incubations last several days limiting its application in practice. On the other hand, feed industry relies strongly on NIRS to predict chemical composition of feeds and it has been used to predict nutrient degradability parameters. However, most of these studies were feedstuff specific, predicting degradability parameters of a particular feedstuff or category of feedstuffs, mainly forages or compound feeds and not grains and byproducts. Our objective was to evaluate the potential of NIRS to predict degradability parameters and effective degradation utilizing a wide range of feedstuffs commonly used in ruminant nutrition. A database of 809 feedstuffs was created. Feedstuffs were grouped as forages (FF; n=256), non-forages (NF; n=539) and of animal origin (n=14). In situ degradability data for dry matter (DM; n=665), CP (n=682) and NDF (n=100) were collected. Degradability was described in terms of washable fraction (a), slowly degradable fraction (b) and its rate of degradation (c). All samples were scanned from 1100 to 2500 nm using an NIRSystems 5000 scanning in reflectance mode. Calibrations were developed for all samples (ALL), FF and NF. Equations were validated with an external validation set of 20% of total samples. NIRS equations to predict the effective degradability and fractions a and b of DM, CP and NDF could be evaluated from being adequate for screening (r(2)>0.77; ratio of performance to deviation (RPD)=2.0 to 2.9) to suitable for quantitative purposes (r(2)>0.84; RPD=3.1 to 4.7), and some predictions were improved by group separation reducing the standard error of prediction. Similarly, the rate of degradation of CP (CP(c)) and DM (DM(c)) was predicted for screening purposes (RPD⩾2 and 2.5 for CP(c) and DM(c), respectively

  20. Morphological Parameters in Relation to the Electromagnetic Properties of Microcellular Thermoplastic Polyurethane Foam in X-Band Frequency Ranges

    Directory of Open Access Journals (Sweden)

    Mohammad Hassan Moeini

    2017-04-01

    Full Text Available Microcellular thermoplastic polyurethane foams are examined as absorbing materials in the X-band (8.2-12.4 GHz frequency range by means of experiment. In this work, we aim to establish relationships between foam morphology including cell size and air volume fraction and electromagnetic properties including absorption, transmission and reflection quality. Nanocomposites based on thermoplastic polyurethane containing carbon black were prepared by coagulation method. In this procedure 15 wt% carbon black-containing nanocomposite was converted to microcellular foams using batch foaming process and supercritical carbon dioxide as physical foaming agent. The morphology of the foams was evaluated by scanning electron microscopy. S-parameters of the samples were measured by a vector network analyzer (VNA and the effect of morphological parameters such as cell size and air volume fraction on the absorbing properties was investigated. We also established structure/properties relationships which were essential for further optimizations of the materials used in the construction of radar absorbing composites. Foaming reduced the percolation threshold of the nanocomposites due to the reduction in the average distance between nanoparticles. Foaming and dielectric constant reduction dropped the reflection percentage significantly. The increase in air volume fraction in the foam increased absorption per its weight, because of multiple scattering in composite media. The sensitivity of electromagnetic wave toward the variation of cell size is strongly weaker than that toward the variation of air volume fraction. Electromagnetic properties of the microcellular foams deviated a little from effective medium theories (EMTs. Air volume fraction of the cells was a function of cell size and smaller cells showed higher absorption.

  1. Egg quality and blood parameters of “Bianca di Saluzzo” and Isa Brown hens kept under free range conditions

    Directory of Open Access Journals (Sweden)

    Luca Doglione

    2010-01-01

    Full Text Available Egg quality traits and some blood parameters of Bianca di Saluzzo hen (BSh were compared to Isa Brown hen (IBh. Birds were reared in free range conditions. Weightofthewholeegg Weight of the whole egg was higher (P≤0.01 for IBh, due to its higher amount of albumen (P≤0.01 whereas BSh egg showed the highest weight and relative percentage of yolk (PP≤0.01. IBh and BSh egg chemical composition was similar.Totalredcellsdidnotshowstatisticaldifferencesbetweengroups,whiletotalleucocytes Total red cells did not show statistical differences between groups, while total leucocytes were lower (P≤0.05 forBShhens. Heterophyl/Lymphocyte(H/L ratioof BShwaslower (P for BSh hens. Heterophyl/Lymphocyte(H/L ratioof BShwaslower (P . Heterophyl/Lymphocyte(H/L ratioof BShwaslower (P Heterophyl/Lymphocyte (H/L ratio of BSh was lower (P (PP≤0.01 than IBh(0.33 IBh (0.33 (0.33 vs. 0.82.IBh 0.82. IBh IBh α-1 acid glycoprotein (AGPmeanconcentrationswereaffectedbytime: (AGP mean concentrations were affected by time: the values registered after 15 d (T1 and 2 months (T2 of observation were similar (345±132 and 279±58 μg/mlrespectively,whileAGPvalueregisteredafter4months(T3weresignificantlyhigher μg/ml respectively,whileAGPvalueregisteredafter4months(T3weresignificantlyhigher , while AGP value registered after 4 months (T3 were significantly higher (700±487 μg/ml;BShdidnotdisplayanyAGPstatisticalvariationovertime.IBhalbuminmeancon- μg/ml; BShdidnotdisplayanyAGPstatisticalvariationovertime.IBhalbuminmeancon- BSh did not display any AGP statistical variation over time. IBh albumin mean con- centration (1.62 g/dL was statistically lower than BSh values (1.89 g/dL; in both groups no effect of time of sampling was recorded. Acutephaseprotein(APPvaluesofBShsuggestedamoreadaptive Acute phase protein (APPvaluesofBShsuggestedamoreadaptive (APP values of BSh suggested a more adaptive attitude to free range conditions and appeared more constant over time. The present

  2. Forecasting Kp from solar wind data: input parameter study using 3-hour averages and 3-hour range values

    Science.gov (United States)

    Wintoft, Peter; Wik, Magnus; Matzka, Jürgen; Shprits, Yuri

    2017-11-01

    We have developed neural network models that predict Kp from upstream solar wind data. We study the importance of various input parameters, starting with the magnetic component Bz, particle density n, and velocity V and then adding total field B and the By component. As we also notice a seasonal and UT variation in average Kp we include functions of day-of-year and UT. Finally, as Kp is a global representation of the maximum range of geomagnetic variation over 3-hour UT intervals we conclude that sudden changes in the solar wind can have a big effect on Kp, even though it is a 3-hour value. Therefore, 3-hour solar wind averages will not always appropriately represent the solar wind condition, and we introduce 3-hour maxima and minima values to some degree address this problem. We find that introducing total field B and 3-hour maxima and minima, derived from 1-minute solar wind data, have a great influence on the performance. Due to the low number of samples for high Kp values there can be considerable variation in predicted Kp for different networks with similar validation errors. We address this issue by using an ensemble of networks from which we use the median predicted Kp. The models (ensemble of networks) provide prediction lead times in the range 20-90 min given by the time it takes a solar wind structure to travel from L1 to Earth. Two models are implemented that can be run with real time data: (1) IRF-Kp-2017-h3 uses the 3-hour averages of the solar wind data and (2) IRF-Kp-2017 uses in addition to the averages, also the minima and maxima values. The IRF-Kp-2017 model has RMS error of 0.55 and linear correlation of 0.92 based on an independent test set with final Kp covering 2 years using ACE Level 2 data. The IRF-Kp-2017-h3 model has RMSE = 0.63 and correlation = 0.89. We also explore the errors when tested on another two-year period with real-time ACE data which gives RMSE = 0.59 for IRF-Kp-2017 and RMSE = 0.73 for IRF-Kp-2017-h3. The errors as function

  3. Spatial distribution of spectral parameters of high latitude geomagnetic disturbances in the Pc5/Pi3 frequency range

    Directory of Open Access Journals (Sweden)

    N. V. Yagova

    2010-09-01

    Full Text Available We analyze spectral parameters of the geomagnetic disturbances within the 1–4 mHz (Pc5/Pi3 frequency range for 29 observatories from polar to auroral latitudes. The main object of this study is the broadband (noise background under quiet and moderately disturbed conditions. To obtain a quantitative description of background high-latitude long period ULF activity the log-log dependence of the spectral power on frequency is expanded over Legendre polynomials, and the coefficients of this expansion (spectral moments are used to describe the most common features of these spectra. Not only the spectral power, but also the spectral slope and higher spectral moments, averaged over relatively long time intervals, demonstrate a systematic dependence on corrected geomagnetic (CGM latitude, Φ, and magnetic local time, MLT. The 2-D distributions of the spectral moments in Φ-MLT coordinates are characterized by existence of structures, narrow in latitude and extended in MLT, which can be attributed to the projections of different magnetospheric domains. Spatio-temporal distributions of spectral power of elliptically (P-component and randomly (N-component polarized signal are similar, but not identical. The N-component contribution to the total signal becomes non-negligible in regions with a high local activity, such as the auroral oval and dayside polar cusp. The spectral slope indicates a larger relative contribution of higher frequencies upon the latitude decrease, probably, as a result of the resonant effects in the ULF noise. The higher spectral moments are also controlled mostly by CGM latitude and MLT and are fundamentally different for the polarized and non-polarized components. This study is a step towards the construction of an empirical model of the ULF wave power in Earth's magnetosphere.

  4. New burnup calculation of TRIGA IPR-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Meireles, Sincler P. de; Campolina, Daniel de A.M.; Santos, Andre A. Campagnole dos; Menezes, Maria A.B.C.; Mesquita, Amir Z., E-mail: sinclercdtn@hotmail.com.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-07-01

    The IPR-R1 TRIGA Mark I research reactor, located at the Nuclear Technology Development Center - CDTN, Belo Horizonte, Brazil, operates since 1960.The reactor is operating for more than fifty years and has a long history of operation. Determining the current composition of the fuel is very important to calculate various parameters. The reactor burnup calculation has been performed before, however, new techniques, methods, software and increase of the processing capacity of the new computers motivates new investigations to be performed. This work presents the evolution of effective multiplication constant and the results of burnup. This new model has a more detailed geometry with the introduction of the new devices, like the control rods and the samarium discs. This increase of materials in the simulation in burnup calculation was very important for results. For these series of simulations a more recently cross section library, ENDF/B-VII, was used. To perform the calculations two Monte Carlo particle transport code were used: Serpent and MCNPX. The results obtained from two codes are presented and compared with previous studies in the literature. (author)

  5. [Corrective effects of electromagnetic radiation in a millimeter wavelength range on the parameters of oxidative stress after standard anti-helicobacterial therapy in patients with ulcer disease].

    Science.gov (United States)

    Ivanishkina, E V; Podoprigorova, V G

    2012-01-01

    We assessed the possibilities of correction of oxidative stress parameters in the serum and gastroduodenal mucosa using electromagnetic radiation in a millimeter wavelength range in 127 patients with gastric and duodenal ulcer after eradication therapy. Control group included 230 healthy subjects. Parameter of lipid oxidation by free radicals were measured by direct methods (hemiluminescence and EPR-spectroscopy). The results show that standard eradication therapy does not influence parameters of oxidative stress. More pronounced effect of electromagnetic radiation in a millimeter wavelength range may be due to the correction of prooxidant-antioxidant and antioxidant disbalance. This observation provides pathogenetic substantiation for the inclusion of this physical method in modern therapeutic modalities.

  6. Soil and geomorphological parameters to characterize natural environmental and human induced changes within the Guadarrama Range (Central Spain)

    Science.gov (United States)

    Schmid, Thomas; Inclán-Cuartas, Rosa M.; Santolaria-Canales, Edmundo; Saa, Antonio; Rodríguez-Rastrero, Manuel; Tanarro-Garcia, Luis M.; Luque, Esperanza; Pelayo, Marta; Ubeda, Jose; Tarquis, Ana; Diaz-Puente, Javier; De Marcos, Javier; Rodriguez-Alonso, Javier; Hernandez, Carlos; Palacios, David; Gallardo-Díaz, Juan; Fidel González-Rouco, J.

    2016-04-01

    to determine the physical and chemical soil properties. The parent material is gneiss andassociated deposits and, as a result, soils are acid. The soils have a low to medium organic matter content and are non-saline. They are moderately to well drained soils and have no or slight evidence of erosion. The soil within the high mountain area has clear evidence of frost heave that has a vertical displacement of the surface in the centimeter range. The stations within the lowland and mid mountain areas represent the most degraded sites as a result of the livestock keeping, whereas the high mountain area is mainly influenced by natural environmental conditions. These soil and geomorphological parameters will constitute a basis for site characterization in future studies regarding soil degradation; determining the interaction between soil, vegetation and atmosphere with respect to human induced activities (e.g. atmospheric contamination and effects of fires); determining the nitrogen and carbon cycles; and the influence of heavy metal contaminants in the soils.

  7. Characterization of the decolorizing activity of azo dyes by Bacillus subtilis azoreductase AzoR1

    Directory of Open Access Journals (Sweden)

    Montira Leelakriangsak

    2012-11-01

    Full Text Available The product of the Bacillus subtilis gene azoR1 is annotated as a putative azoreductase, production of which isinduced in response to thiol-reactive compounds. Here we report on the decolorization of four azo dyes by azoreductaseactivity. The ability of overexpressed AzoR1 strain ORB7106 to catalyze decolorization of azo dyes was investigated on agarplates and in liquid cultures. The decolorization efficacy of a mutant, ORB7106, which has lost negative control of azoR1expression, was significantly better than the parental strain (JH642, providing evidence that the azoR1 gene product isan azoreductase with the ability to decolorize azo dyes. ORB7106 showed 40-98% azo dye decolorization within 48 h. Thebacterium exhibited a remarkable color removal capability over a wide range of Methyl Red concentrations (10-200 mg l-1, pH(5-9 and temperatures (25-45°C. A significant increase in the decolorization activity was observed after induction of AzoR1production. The results suggested that AzoR1 production could be induced by Methyl Red. The decolorizing activity isprimarily associated with the cytosolic fraction and requires NADH as a cofactor.

  8. Mineral metabolism parameters throughout chronic kidney disease stages 1-5-achievement of K DOQI target ranges

    National Research Council Canada - National Science Library

    Craver, Lourdes; Marco, Maria Paz; Martínez, Isabel; Rue, Montserrat; Borràs, Merce; Martín, Maria Luisa; Sarró, Felipe; Valdivielso, José Manuel; Fernández, Elvira

    2007-01-01

    Background. Dialysis Outcomes and Practice Patterns Study has shown that the proportion of haemodialysis patients with adequate mineral metabolism parameters according to the Kidney Disease Outcome Quality Initiative (K/DOQI...

  9. Emerging roles of the corepressors NCoR1 and SMRT in homeostasis.

    Science.gov (United States)

    Mottis, Adrienne; Mouchiroud, Laurent; Auwerx, Johan

    2013-04-15

    Epigenetic regulation of gene expression is strongly influenced by the accessibility of nucleosomal DNA or the state of chromatin compaction. In this context, coregulators, including both coactivators and corepressors, are pivotal intermediates that bridge chromatin-modifying enzymes and transcription factors. NCoR1 (nuclear receptor corepressor) and SMRT (silencing mediator of retinoic acid and thyroid hormone receptor) are among the best-characterized corepressors from a molecular point of view. These coregulators have conserved orthologs in lower organisms, which underscores their functional importance. Here we summarize the results from recent in vivo studies that reveal the wide-ranging roles of NCoR1 and SMRT in developmental as well as homeostatic processes, including metabolism, inflammation, and circadian rhythms. We also discuss the potential implications of NCoR1 and SMRT regulation of pathways ranging from genomic stability and carcinogenesis to metabolic diseases such as type 2 diabetes.

  10. Parameters affecting the environmental impact of a range of dairy farming systems in Denmark, Germany and Italy

    DEFF Research Database (Denmark)

    Guerci, Matteo; Knudsen, Marie Trydeman; Bava, L.

    2013-01-01

    The environmental impact of 12 dairy farms in Denmark, Germany and Italy was evaluated using an LCA approach and the most important parameters influencing their environmental sustainability were identified. The farms represent different production methods (organic vs. conventional), summer feeding...... of conventional soymeal in the feed concentrate. There were strong and positive correlations between the four impact categories, and overall the results indicate that improving greenhouse gas emissions would improve the general environmental sustainability of the dairy farm. The land occupation was lowest...

  11. Early Site Permit Demonstration Program, plant parameters envelopes: Comparison with ranges of values for four hypothetical sites. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1992-09-01

    The purpose of this volume is to report the results of the comparison of the ALWR plan parameters envelope with values of site characteristics developed for our hypothetical sites that generally represent conditions encountered within the United States. This effort is not intended to identify or address the suitability of any existing site, site area, or region in the United States. Also included in this volume is Appendix F, SERCH Summaries Regarding Siting.

  12. The Effects of Hearing Aid Compression Parameters on the Short-Term Dynamic Range of Continuous Speech

    Science.gov (United States)

    Henning, Rebecca L. Warner; Bentler, Ruth A.

    2008-01-01

    Purpose: The purpose of this study was to evaluate and quantitatively model the independent and interactive effects of compression ratio, number of compression channels, and release time on the dynamic range of continuous speech. Method: A CD of the Rainbow Passage (J. E. Bernthal & N. W. Bankson, 1993) was used. The hearing aid was a…

  13. Biochemical and morphological characterization of mycobacteriophage R1.

    Science.gov (United States)

    Soloff, B L; Rado, T A; Henry, B E; Bates, J H

    1978-01-01

    Large-scale propagation of mycobacteriophage R1 in broth culture has allowed the isolation of quantities of virus sufficient for characterization of its nucleic acid and lipid components as well as investigation of its ultrastructural attributes. Analysis of R1 DNA indicates that it is double stranded and possesses a molecular weight of 2.5 X 10(7) and a guanine-plus-cytosine content of 65.7 +/- 0.5%. The lipid fraction of R1 accounts for 14% of the total dry weight of the virus, 20% of which was identified as free or esterified sterols. A rapid loss of viral titer occurred after seconds of exposure to organic solvents. This result suggests that the lipid fractions of R1 is essential for its infectivity. Electron microscopic investigation of solvent-extracted R1 showed extensive deterioration of its normal morphology, including nucleocapsid disintegration and base plate separation. Routine phosphotungstate preparations demonstrated a particle with an oval head and a noncontractile tail. Altering the pH of the phosphotungstate negative stain from neutrality damage the viral particles. Uranyl formate-contrasted specimens displayed an elongated hexagonal nucleocapsid with a neck region; the cross-striated tail possessed a starlike base plate. Images PMID:23439

  14. Full-range stress-strain behaviour of contemporary pipeline steels: Part II. Estimation of model parameters

    Energy Technology Data Exchange (ETDEWEB)

    Hertele, Stijn, E-mail: stijn.hertele@ugent.be [FWO Flanders Aspirant, Ghent University, Laboratory Soete, Sint-Pietersnieuwstraat 41, 9000 Gent (Belgium); De Waele, Wim; Denys, Rudi; Verstraete, Matthias [Ghent University, Laboratory Soete, Sint-Pietersnieuwstraat 41, 9000 Gent (Belgium)

    2012-04-15

    Contemporary pipeline steels with a yield-to-tensile ratio above 0.80 often show two-stages of strain hardening, which cannot be simultaneously described by the standardized Ramberg-Osgood model. A companion paper (Part I) showed that the recently developed UGent model provides more accurate descriptions than the Ramberg-Osgood model, as it succeeds in describing both strain hardening stages. However, it may be challenging to obtain an optimal model fit in absence of full stress-strain data. This paper discusses on how to find suited parameter values for the UGent model, given a set of measurable tensile test characteristics. The proposed methodology shows good results for an extensive set of investigated experimental stress-strain curves. Next to some common tensile test characteristics, the 1.0% proof stress is needed. The authors therefore encourage the acquisition of this stress during tensile tests. - Highlights: Black-Right-Pointing-Pointer An analytical procedure estimates UGent model parameters. Black-Right-Pointing-Pointer The procedure requires a set of tensile test characteristics. Black-Right-Pointing-Pointer The UGent model performs better than the Ramberg-Osgood model. Black-Right-Pointing-Pointer Apart from common characteristics, the 1.0% proof stress is required. Black-Right-Pointing-Pointer The authors encourage the acquisition of this 1.0% proof stress.

  15. Microstructure, a limiting parameter for determining the engineering range of compositions for light alloys: The Al-Cu-Si system

    Energy Technology Data Exchange (ETDEWEB)

    Plaza, D.; Pero-Sanz, J.A. [Univ. Politecnica, Madrid (Spain); Asensio, J.; Verdeja, J.I. [Univ. de Oviedo (Spain)

    1998-03-01

    Twelve as-cast alloys of the Al-Cu-Si ternary system were investigated. In all the cases, the microstructural phases observed were: {alpha} solid solution of Cu and Si in Al, CuAl{sub 2} ({theta} phase), and silicon crystals. The morphology and distribution of the {theta} and Si brittle constituents limit the percentages of Cu and Si added in the composition ranges of these commercial alloys.

  16. Joint inference of dominant scatterer locations and motion parameters of an extended target in high range-resolution radar

    CSIR Research Space (South Africa)

    De Freitas, A

    2015-06-01

    Full Text Available was modelled with a discrete almost constant angular velocity random acceleration model [22]. The motion model for each state is given by rc,k = rc,k−1 + pc,k, θc,k = θc,k−1 + ωk−1∆t+ 1 2 ∆t2qk, ωk = ωk−1 + ∆tqk, (4) where ∆t represents the constant time... that is elapsed between discrete time steps, and pc,k and qk represent zero- mean Gaussian random variables with respective standard deviations of σp and σq . Since the data is simulated, the dynamic noise parameters are chosen and hence σp and σq are place...

  17. Oracle BAM 11gR1 Handbook

    CERN Document Server

    Wang, Pete

    2012-01-01

    "Oracle BAM 11gR1 Handbook" is a practical best practices tutorial focused entirely on Oracle Business Activity Monitoring. An intermediate-to-advanced guide, step-by-step instructions and an accompanying demo project will help SOA report developers through application development and producing dashboards and reports. If you are a developer/report developer or SOA Architect who wants to learn valuable Oracle BAM best practices for monitoring your operations in real time, then "Oracle BAM 11gR1 Handbook" is for you. Administrators will also find the book useful. You should already be comfortabl

  18. Estudo sobre a dimensionalidade do teste R1 - Forma B Estudio sobre la dimensionalidad del test R1 - Forma B Studying the R-1 test - Form B unidimensionality

    Directory of Open Access Journals (Sweden)

    Fermino Fernandes Sisto

    2007-04-01

    Full Text Available O presente estudo objetivou utilizar o modelo de Rasch para analisar a possibilidade de unidimensionalidade do teste R1-Forma B, por meio da análise dos resíduos por componentes principais. Para tanto, foram investigados 745 estudantes que freqüentavam um curso para jovens e adultos, caracterizando pessoas com defasagem na escolaridade ou em fase de escolarização tardia. Desses, 50,3% eram do sexo feminino e 48,3% do masculino, com idade variando entre 15 e 75 anos. Os resultados sugeriram, entre outros aspectos, que o Teste R1 não é unidimensional e que apenas uma pontuação global no teste não é suficiente para descrever as condutas cognitivas usadas para resolvê-lo. No entanto, a análise dos fatores 1 e 2 indicaram unidimensionalidade para ambos. Sugere-se que novos estudos sejam realizados com amostras diferentes, a fim de que sejam ampliadas as investigações aqui propostas.El presente estudio tuvo el objetivo de utilizar el modelo de Rasch para analizar la posibilidad de unidimensionalidad del test R1-Forma B, por medio del análisis de los residuos por componentes principales. Para tanto, fueron investigados 745 estudiantes que frecuentaban un curso para jóvenes y adultos, caracterizando personas con retraso en la escolaridad o en fase de escolarización tardía. De esos, el 50,3% eran del sexo femenino y el 48,3% del masculino, con edad variando entre 15 y 75 años. Los resultados han sugerido, entre otros aspectos, que el Test R1 no es unidimensional y que tan sólo un puntaje global en el test no es suficiente para describir las conductas cognitivas usadas para resolverlo. Sin embargo, el análisis de los factores 1 y 2 indicaron unidimensionalidad para ambos. Se sugiere que nuevos estudios sean realizados con muestras distintas, a fin de que sean ampliadas las investigaciones propuestas aquí.The possibility of unidimensionality of R1-Forma B test was analyzed by the Rasch model through the principal residual component

  19. NPP Grassland: Central Plains Experimental Range (SGS), USA, 1939-1990, R1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set records the productivity of a semiarid shortgrass prairie steppe located in the Central Plains Experimental Reserve (CPER)/Pawnee National Grassland in...

  20. Effects of heavy ions on inactivation and DNA double strand breaks in Deinococcus radiodurans R1

    Science.gov (United States)

    Zimmermann, H.; Schäfer, M.; Schmitz, C.; Bücker, H.

    1994-10-01

    Inactivation and double strand break (dsb) induction after heavy ion irradiation were studied in stationary phase cells of the highly radiation resistant bacterium Deinococcus radiodurans R1. There is evidence that the radiation sensitivity of this bacterium is nearly independent on energy in the range of up to 15 MeV/u for lighter ions (Ar). The responses to dsb induction for charged particles show direct relationship between increasing radiation dose and residual intact DNA.

  1. Effects of heavy ions on inactivation and DNA double strand breaks in Deinococcus radiodurans R1.

    Science.gov (United States)

    Zimmermann, H; Schafer, M; Schmitz, C; Bucker, H

    1994-10-01

    Inactivation and double strand break (dsb) induction after heavy ion irradiation were studied in stationary phase cells of the highly radiation resistant bacterium Deinococcus radiodurans R1. There is evidence that the radiation sensitivity of this bacterium is nearly independent on energy in the range of up to 15 MeV/u for lighter ions (Ar). The responses to dsb induction for charged particles show direct relationship between increasing radiation dose and residual intact DNA.

  2. Somatic mutations of PIK3R1 promote gliomagenesis.

    Directory of Open Access Journals (Sweden)

    Steven N Quayle

    Full Text Available The phosphoinositide 3-kinase (PI3K pathway is targeted for frequent alteration in glioblastoma (GBM and is one of the core GBM pathways defined by The Cancer Genome Atlas. Somatic mutations of PIK3R1 are observed in multiple tumor types, but the tumorigenic activity of these mutations has not been demonstrated in GBM. We show here that somatic mutations in the iSH2 domain of PIK3R1 act as oncogenic driver events. Specifically, introduction of a subset of the mutations identified in human GBM, in the nSH2 and iSH2 domains, increases signaling through the PI3K pathway and promotes tumorigenesis of primary normal human astrocytes in an orthotopic xenograft model. Furthermore, we show that cells that are dependent on mutant P85α-mediated PI3K signaling exhibit increased sensitivity to a small molecule inhibitor of AKT. Together, these results suggest that GBM patients whose tumors carry mutant PIK3R1 alleles may benefit from treatment with inhibitors of AKT.

  3. A comparative study of short chain and long chain mercapto acids used in biosensor fabrication: A VEGF-R1-based immunosensor as a model system.

    Science.gov (United States)

    Bahadır, Elif Burcu; Sezgintürk, Mustafa Kemal

    2016-01-01

    A novel impedimetric biosensor utilizing a biological receptor, vascular endothelial growth factor receptor-1 (VEGF-R1), was developed for the determination of vascular endothelial growth factor (VEGF). VEGF-R1 was covalently immobilized by coupling with 11-mercaptoundecanoic acid, which formed a self-assembled monolayer on gold electrodes. Cyclic voltammetry and electrochemical impedance spectroscopy techniques were employed to characterize the immobilization process and to detect VEGF. To successfully construct the biosensor current, the experimental parameters were optimized. A Kramers-Kronig transform was performed on the experimental impedance data. The results obtained provided a linear response range from 1 to 6 ng/mL human VEGF. The applicability of the biosensor developed to determine VEGF in a spiked artificial human serum sample was tested. The important parameters related with the biosensors fabricated by using two different mercapto acids were compared in terms of the self-assembly processes, the activation conditions of -COOH ends, linear ranges obtained for VEGF, repeatabilities and reproducibilities, and cleaning procedures. The results of this study revealed that the length of the mercapto acids used for biosensor fabrication considerably affected the analytical performance and the practicability of the preparation of the biosensor.

  4. Seasonal Variations of the Ionosphere Scintillations Parameters Obtained from the Long Observations of the Power Cosmic Radio Sources at the Decameter Wave Range

    Science.gov (United States)

    Lytvynenko, O. A.; Panishko, S. K.

    Observations of the four power cosmic radio sources were carried out on the radio telescope (RT) URAN-4 during 1987-1990 and 1998-2007 at the frequencies 20 and 25 MHz. Effects of ionosphere and in particular existence of intensity fluctuations on the cosmic radio sources records, or scintillations, are essential at the decameter wave range. Long series of the ionosphere scintillations parameters such as indices, periods and spectrum slopes were obtained after observation data proceeding. Behavior of the seasonal variations was investigated on this data. Obtained dependencies were compared with the indices of the solar and geomagnetic activity.

  5. Combination of radiograph-based trabecular and geometrical parameters can discriminate cervical hip fractures from controls in individuals with BMD in non-osteoporotic range.

    Science.gov (United States)

    Pulkkinen, P; Partanen, J; Jalovaara, P; Nieminen, M T; Jämsä, T

    2011-08-01

    Majority of hip fractures occur in individuals with bone mineral density (BMD) in non-osteoporotic range. This suggests that factors other than BMD are associated with increased fracture risk in these individuals. The aim of this study was to investigate the combined ability of radiograph-based trabecular and geometrical parameters to discriminate cervical hip fractures from controls in individuals with non-osteoporotic BMD. A total of 39 postmenopausal females with non-pathologic cervical hip fracture were recruited to the study. Nineteen of the fracture patients (48.7%) had non-osteoporotic BMD and they constituted the fracture group. The control group consisted of 35 BMD-matched non-osteoporotic females. Several geometrical and trabecular parameters were extracted from plain pelvic radiographs, and their combined ability to discriminate fracture patients from controls was studied using a receiver operating characteristics (ROC) analysis. Significant differences in several radiograph-based geometrical and trabecular parameters were found between the fracture patients and controls, whereas no statistically significant difference in BMD was observed (p=0.92) between the groups. Area under the ROC curve was 0.993 (95% CI 0.977-1.008) for the combined multiple regression model, which included both trabecular and geometrical parameters as explanatory factors. Here, the sensitivity of 100% was achieved with the specificity of 94%. In a cross-validation of the model, 94.4% of the fracture patients, and 94.1% of the controls were classified correctly. The combination of radiograph-based trabecular and geometrical parameters was able to discriminate the cervical hip fracture cases from controls with similar BMD, showing that the method can provide additional information on bone structure and fracture risk beyond BMD. Copyright © 2011 Elsevier Inc. All rights reserved.

  6. Nonsynonymous single nucleotide polymorphisms in human tas1r1, tas1r3, and mGluR1 and individual taste sensitivity to glutamate

    National Research Council Canada - National Science Library

    Raliou, Mariam; Wiencis, Anna; Pillias, Anne-Marie; Planchais, Aurore; Eloit, Corinne; Boucher, Yves; Trotier, Didier; Montmayeur, Jean-Pierre; Faurion, Annick

    2009-01-01

    .... Our objective was to study possible relations between phenotype (sensitivity to glutamate) and genotype (polymorphisms in candidate glutamate taste receptors tas1r1, tas1r3, mGluR4, and mGluR1...

  7. Effects of cyclothiazide on GluR1/AMPA receptors.

    Science.gov (United States)

    Fucile, Sergio; Miledi, Ricardo; Eusebi, Fabrizio

    2006-02-21

    Cyclothiazide (CTZ), a positive allosteric modulator of ionotropic alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid (AMPA)-type glutamate receptors, is used frequently to block the desensitization of both native and heterologously expressed AMPA receptors. Specifically, CTZ is known to produce a fast inhibition of AMPA receptor desensitization and a much slower potentiation of the AMPA current. By using patch-clamp techniques, the effects of CTZ were studied in HEK 293 cells stably transfected with the rat flip GluR1 subunit. Upon CTZ treatment, we found an increased apparent affinity for the agonist, a slow whole-cell current potentiation, a fast inhibition of desensitization, and a lengthening of single-channel openings. Furthermore, we show that CTZ alters the channel gating events modifying the relative contribution of different single-channel classes of conductance (gamma), increasing and decreasing, respectively, the contributions of gammaM (medium) and gammaL (low) without altering that of the gammaH (high) conductance channels. We also present a kinetic model that predicts well all of the experimental findings of CTZ action. Finally, we suggest a protocol for standard cell treatment with CTZ to attain maximal efficacy of CTZ on GluR1 receptors.

  8. Sensitivity Analysis of the TRIGA IPR-R1 Reactor Models Using the MCNP Code

    Directory of Open Access Journals (Sweden)

    C. A. M. Silva

    2014-01-01

    Full Text Available In the process of verification and validation of code modelling, the sensitivity analysis including systematic variations in code input variables must be used to help identifying the relevant parameters necessary for a determined type of analysis. The aim of this work is to identify how much the code results are affected by two different types of the TRIGA IPR-R1 reactor modelling processes performed using the MCNP (Monte Carlo N-Particle Transport code. The sensitivity analyses included small differences of the core and the rods dimensions and different levels of model detailing. Four models were simulated and neutronic parameters such as effective multiplication factor (keff, reactivity (ρ, and thermal and total neutron flux in central thimble in some different conditions of the reactor operation were analysed. The simulated models presented good agreement between them, as well as in comparison with available experimental data. In this way, the sensitivity analyses demonstrated that simulations of the TRIGA IPR-R1 reactor can be performed using any one of the four investigated MCNP models to obtain the referenced neutronic parameters.

  9. (4R-4-[(1R-1,2-Dihydroxyethyl]-1-[(1R-1-phenylethyl]pyrrolidin-2-one

    Directory of Open Access Journals (Sweden)

    Peter D. W. Boyd

    2008-09-01

    Full Text Available The title compound, C14H19NO3, was obtained as one of the two isomers of a Sharpless asymmetric dihydroxylation reaction of (1S-1-[(1R-1-phenylethyl]-4-vinylpyrrolidin-2-one. The absolute stereochemistry of this isomer was determined from the known stereochemistry (R at the bridge C atom between the phenyl and pyrrolidine rings. The molecules form one-dimensional tapes along the b axis via hydrogen bonding between the carbonyl O atom and the alcohol groups of neighbouring molecules. These assemble into sheets via interdigitative stacking of the phenyl rings and C—H...O interactions.

  10. Evaluation of R1-6 gateway treatment alternatives for pedestrian crossings : final report.

    Science.gov (United States)

    2016-02-01

    A series of studies evaluated the Gateway configuration of R1-6 in-street signs. A Gateway configuration consists of an R1-6 sign on the centerline, an R1-6 signs on both edges of the roadway, and R1-6 signs on the lane lines if it is a multilane roa...

  11. Evaluation of R1-6 gateway treatment alternatives for pedestrian crossings.

    Science.gov (United States)

    2016-02-01

    A series of studies evaluated the Gateway configuration of R1-6 in-street signs. A : Gateway configuration consists of an R1-6 sign on the centerline, an R1-6 signs on both edges of : the roadway, and R1-6 signs on the lane lines if it is a multilane...

  12. Molecular characterization of the Jatropha curcas JcR1MYB1 gene encoding a putative R1-MYB transcription factor

    Directory of Open Access Journals (Sweden)

    Hui-Liang Li

    2014-09-01

    Full Text Available The cDNA encoding the R1-MYB transcription factor, designated as JcR1MYB1, was isolated from Jatropha curcas using rapid amplification of cDNA ends. JcR1MYB1 contains a 951 bp open reading frame that encodes 316 amino acids. The deduced JcR1MYB1 protein was predicted to possess the conserved, 56-amino acid-long DNA-binding domain, which consists of a single helix-turn-helix module and usually occurs in R1-MYBs. JcR1MYB1 is a member of the R1-MYB transcription factor subfamily. A subcellular localization study confirmed the nuclear localization of JcR1MYB1. Expression analysis showed that JcR1MYB1 transcripts accumulated in various examined tissues, with high expression levels in the root and low levels in the stem. JcR1MYB1 transcription was up-regulated by polyethylene glycol, NaCl, and cold treatments, as well as by abscisic acid, jasmonic acid, and ethylene treatment. Analysis of transgenic tobacco plants over-expressing JcR1MYB1 indicates an inportant function for this gene in salt stress.

  13. From micro to macro: access to long-range Li+ diffusion parameters in solids via microscopic (6, 7) Li spin-alignment echo NMR spectroscopy.

    Science.gov (United States)

    Wilkening, Martin; Heitjans, Paul

    2012-01-16

    The development of highly conductive solids is a rapidly growing research area in materials science. In particular, the study of Li-ion conductors is driven by the ambitious effort to design powerful lithium-ion batteries. A deeper understanding of Li dynamics in solids requires the availability of a large set of complementary techniques to probe Li self-diffusion on different length and time-scales. We report on (7)Li as well as (6)Li spin-alignment echo (SAE) nuclear magnetic resonance (NMR) spectroscopy, which is capable of probing long-range diffusion parameters from a microscopic, that is, atomic-scale, point of view. So far, variable-temperature SAE NMR spectroscopy has been applied to a number of polycrystalline and glassy Li-ion conductors. The materials investigated serve as model systems to unravel the interesting features of the technique in determining reliable Li jump rates and hopping activation energies. In particular, the latter are compared with those probed by macroscopic techniques such as dc-conductivity measurements that are sensitive to long-range translational motions. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Association between mild cognitive impairment and trajectory-based spatial parameters during timed up and go test using a laser range sensor.

    Science.gov (United States)

    Nishiguchi, Shu; Yorozu, Ayanori; Adachi, Daiki; Takahashi, Masaki; Aoyama, Tomoki

    2017-08-08

    The Timed Up and Go (TUG) test may be a useful tool to detect not only mobility impairment but also possible cognitive impairment. In this cross-sectional study, we used the TUG test to investigate the associations between trajectory-based spatial parameters measured by laser range sensor (LRS) and cognitive impairment in community-dwelling older adults. The participants were 63 community-dwelling older adults (mean age, 73.0 ± 6.3 years). The trajectory-based spatial parameters during the TUG test were measured using an LRS. In each forward and backward phase, we calculated the minimum distance from the marker, the maximum distance from the x-axis (center line), the length of the trajectories, and the area of region surrounded by the trajectory of the center of gravity and the x-axis (center line). We measured mild cognitive impairment using the Mini-Mental State Examination score (26/27 was the cut-off score for defining mild cognitive impairment). Compared with participants with normal cognitive function, those with mild cognitive impairment exhibited the following trajectory-based spatial parameters: short minimum distance from the marker (p = 0.044), narrow area of center of gravity in the forward phase (p = 0.012), and a large forward/whole phase ratio of the area of the center of gravity (p = 0.026) during the TUG test. In multivariate logistic regression analyses, a short minimum distance from the marker (odds ratio [OR]: 0.82, 95% confidence interval [CI]: 0.69-0.98), narrow area of the center of gravity in the forward phase (OR: 0.01, 95% CI: 0.00-0.36), and large forward/whole phase ratio of the area of the center of gravity (OR: 0.94, 95% CI: 0.88-0.99) were independently associated with mild cognitive impairment. In conclusion, our results indicate that some of the trajectory-based spatial parameters measured by LRS during the TUG test were independently associated with cognitive impairment in older adults. In particular, older adults with

  15. Normal ranges and test-retest reproducibility of flow and velocity parameters in intracranial arteries measured with phase-contrast magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Correia de Verdier, Maria; Wikstroem, Johan [Uppsala University Hospital, Department of Radiology, Uppsala University, Uppsala (Sweden)

    2016-05-15

    The purpose of the present study was to investigate normal ranges and test-retest reproducibility of phase-contrast MRI (PC-MRI)-measured flow and velocity parameters in intracranial arteries. Highest flow (HF), lowest flow (LF), peak systolic velocity (PSV), and end diastolic velocity (EDV) were measured at two dates in the anterior (ACA), middle (MCA), and posterior (PCA) cerebral arteries of 30 healthy volunteers using two-dimensional PC-MRI at 3 T. Least detectable difference (LDD) was calculated. In the left ACA, HF was (mean (range, LDD)) 126 ml/min (36-312, 59 %), LF 61 ml/min (0-156, 101 %), PSV 64 cm/s (32-141, 67 %), and EDV 35 cm/s (18-55, 42 %); in the right ACA, HF was 154 ml/min (42-246, 49 %), LF 77 ml/min (0-156, 131 %), PSV 75 cm/s (26-161, 82 %), and EDV 39 cm/s (7-59, 67 %). In the left MCA, HF was 235 ml/min (126-372, 35 %), LF 116 ml/min (42-186, 48 %), PSV 90 cm/s (55-183, 39 %), and EDV 46 cm/s (20-66, 28 %); in the right MCA, HF was 238 ml/min (162-342, 44 %), LF 120 ml/min (72-216, 48 %), PSV 88 cm/s (55-141, 35 %), and EDV 45 cm/s (26-67, 23 %). In the left PCA, HF was 108 ml/min (42-168, 54 %), LF 53 ml/min (18-108, 64 %), PSV 50 cm/s (24-77, 63 %), and EDV 28 cm/s (14-40, 45 %); in the right PCA, HF was 98 ml/min (30-162, 49 %), LF 49 ml/min (12-84, 55 %), PSV 47 cm/s (27-88, 59 %), and EDV 27 cm/s (16-41, 45 %). PC-MRI-measured flow and velocity parameters in the main intracranial arteries have large normal ranges. Reproducibility is highest in MCA. (orig.)

  16. Microarray analysis in the archaeon Halobacterium salinarum strain R1.

    Directory of Open Access Journals (Sweden)

    Jens Twellmeyer

    Full Text Available BACKGROUND: Phototrophy of the extremely halophilic archaeon Halobacterium salinarum was explored for decades. The research was mainly focused on the expression of bacteriorhodopsin and its functional properties. In contrast, less is known about genome wide transcriptional changes and their impact on the physiological adaptation to phototrophy. The tool of choice to record transcriptional profiles is the DNA microarray technique. However, the technique is still rarely used for transcriptome analysis in archaea. METHODOLOGY/PRINCIPAL FINDINGS: We developed a whole-genome DNA microarray based on our sequence data of the Hbt. salinarum strain R1 genome. The potential of our tool is exemplified by the comparison of cells growing under aerobic and phototrophic conditions, respectively. We processed the raw fluorescence data by several stringent filtering steps and a subsequent MAANOVA analysis. The study revealed a lot of transcriptional differences between the two cell states. We found that the transcriptional changes were relatively weak, though significant. Finally, the DNA microarray data were independently verified by a real-time PCR analysis. CONCLUSION/SIGNIFICANCE: This is the first DNA microarray analysis of Hbt. salinarum cells that were actually grown under phototrophic conditions. By comparing the transcriptomics data with current knowledge we could show that our DNA microarray tool is well applicable for transcriptome analysis in the extremely halophilic archaeon Hbt. salinarum. The reliability of our tool is based on both the high-quality array of DNA probes and the stringent data handling including MAANOVA analysis. Among the regulated genes more than 50% had unknown functions. This underlines the fact that haloarchaeal phototrophy is still far away from being completely understood. Hence, the data recorded in this study will be subject to future systems biology analysis.

  17. International benchmark study of advanced thermal hydraulic safety analysis codes against measurements on IEA-R1 research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Hainoun, A., E-mail: pscientific2@aec.org.sy [Atomic Energy Commission of Syria (AECS), Nuclear Engineering Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Doval, A. [Nuclear Engineering Department, Av. Cmdt. Luis Piedrabuena 4950, C.P. 8400 S.C de Bariloche, Rio Negro (Argentina); Umbehaun, P. [Centro de Engenharia Nuclear – CEN, IPEN-CNEN/SP, Av. Lineu Prestes 2242-Cidade Universitaria, CEP-05508-000 São Paulo, SP (Brazil); Chatzidakis, S. [School of Nuclear Engineering, Purdue University, West Lafayette, IN 47907 (United States); Ghazi, N. [Atomic Energy Commission of Syria (AECS), Nuclear Engineering Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Park, S. [Research Reactor Design and Engineering Division, Basic Science Project Operation Dept., Korea Atomic Energy Research Institute (Korea, Republic of); Mladin, M. [Institute for Nuclear Research, Campului Street No. 1, P.O. Box 78, 115400 Mioveni, Arges (Romania); Shokr, A. [Division of Nuclear Installation Safety, Research Reactor Safety Section, International Atomic Energy Agency, A-1400 Vienna (Austria)

    2014-12-15

    Highlights: • A set of advanced system thermal hydraulic codes are benchmarked against IFA of IEA-R1. • Comparative safety analysis of IEA-R1 reactor during LOFA by 7 working teams. • This work covers both experimental and calculation effort and presents new out findings on TH of RR that have not been reported before. • LOFA results discrepancies from 7% to 20% for coolant and peak clad temperatures are predicted conservatively. - Abstract: In the framework of the IAEA Coordination Research Project on “Innovative methods in research reactor analysis: Benchmark against experimental data on neutronics and thermal hydraulic computational methods and tools for operation and safety analysis of research reactors” the Brazilian research reactor IEA-R1 has been selected as reference facility to perform benchmark calculations for a set of thermal hydraulic codes being widely used by international teams in the field of research reactor (RR) deterministic safety analysis. The goal of the conducted benchmark is to demonstrate the application of innovative reactor analysis tools in the research reactor community, validation of the applied codes and application of the validated codes to perform comprehensive safety analysis of RR. The IEA-R1 is equipped with an Instrumented Fuel Assembly (IFA) which provided measurements for normal operation and loss of flow transient. The measurements comprised coolant and cladding temperatures, reactor power and flow rate. Temperatures are measured at three different radial and axial positions of IFA summing up to 12 measuring points in addition to the coolant inlet and outlet temperatures. The considered benchmark deals with the loss of reactor flow and the subsequent flow reversal from downward forced to upward natural circulation and presents therefore relevant phenomena for the RR safety analysis. The benchmark calculations were performed independently by the participating teams using different thermal hydraulic and safety

  18. Biophysical and functional characterization of the N-terminal domain of the cat T1R1 umami taste receptor expressed in Escherichia coli.

    Science.gov (United States)

    Belloir, Christine; Savistchenko, Jimmy; Neiers, Fabrice; Taylor, Andrew J; McGrane, Scott; Briand, Loïc

    2017-01-01

    Umami taste perception is mediated by the heterodimeric G-protein coupled receptors (GPCRs), formed by the assembly of T1R1 and T1R3 subunits. T1R1 and T1R3 subunits are class C GPCRs whose members share common structural homologies including a long N-terminal domain (NTD) linked to a seven transmembrane domain by a short cysteine-rich region. The NTD of the T1R1 subunit contains the primary binding site for umami stimuli, such as L-glutamate (L-Glu) for humans. Inosine-5'-monophosphate (IMP) binds at a location close to the opening of the T1R1-NTD "flytrap", thus creating the observed synergistic response between L-Glu and IMP. T1R1/T1R3 binding studies have revealed species-dependent differences. While human T1R1/T1R3 is activated specifically by L-Glu, the T1R1/T1R3 in other species is a broadly tuned receptor, sensitive to a range of L-amino acids. Because domestic cats are obligate carnivores, they display strong preferences for some specific amino acids. To better understand the structural basis of umami stimuli recognition by non-human taste receptors, we measured the binding of selected amino acids to cat T1R1/T1R3 (cT1R1/cT1R3) umami taste receptor. For this purpose, we expressed cT1R1-NTD in bacteria as inclusion bodies. After purification, refolding of the protein was achieved. Circular dichroism spectroscopic studies revealed that cT1R1-NTD was well renatured with evidence of secondary structures. Using size-exclusion chromatography coupled to light scattering, we found that the cT1R1-NTD behaves as a monomer. Ligand binding quantified by intrinsic tryptophan fluorescence showed that cT1R1-NTD is capable of binding L-amino acids with Kd values in the micromolar range. We demonstrated that IMP potentiates L-amino acid binding onto renatured cT1R1-NTD. Interestingly, our results revealed that IMP binds the extracellular domain in the absence of L-amino acids. Thus, this study demonstrates that the feasibility to produce milligram quantities of cT1R1-NTD

  19. Biophysical and functional characterization of the N-terminal domain of the cat T1R1 umami taste receptor expressed in Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Christine Belloir

    Full Text Available Umami taste perception is mediated by the heterodimeric G-protein coupled receptors (GPCRs, formed by the assembly of T1R1 and T1R3 subunits. T1R1 and T1R3 subunits are class C GPCRs whose members share common structural homologies including a long N-terminal domain (NTD linked to a seven transmembrane domain by a short cysteine-rich region. The NTD of the T1R1 subunit contains the primary binding site for umami stimuli, such as L-glutamate (L-Glu for humans. Inosine-5'-monophosphate (IMP binds at a location close to the opening of the T1R1-NTD "flytrap", thus creating the observed synergistic response between L-Glu and IMP. T1R1/T1R3 binding studies have revealed species-dependent differences. While human T1R1/T1R3 is activated specifically by L-Glu, the T1R1/T1R3 in other species is a broadly tuned receptor, sensitive to a range of L-amino acids. Because domestic cats are obligate carnivores, they display strong preferences for some specific amino acids. To better understand the structural basis of umami stimuli recognition by non-human taste receptors, we measured the binding of selected amino acids to cat T1R1/T1R3 (cT1R1/cT1R3 umami taste receptor. For this purpose, we expressed cT1R1-NTD in bacteria as inclusion bodies. After purification, refolding of the protein was achieved. Circular dichroism spectroscopic studies revealed that cT1R1-NTD was well renatured with evidence of secondary structures. Using size-exclusion chromatography coupled to light scattering, we found that the cT1R1-NTD behaves as a monomer. Ligand binding quantified by intrinsic tryptophan fluorescence showed that cT1R1-NTD is capable of binding L-amino acids with Kd values in the micromolar range. We demonstrated that IMP potentiates L-amino acid binding onto renatured cT1R1-NTD. Interestingly, our results revealed that IMP binds the extracellular domain in the absence of L-amino acids. Thus, this study demonstrates that the feasibility to produce milligram quantities

  20. Influence of life-history parameters on organochlorine concentrations in free-ranging killer whales (Orcinus orca) from Prince William Sound, AK.

    Science.gov (United States)

    Ylitalo, G M; Matkin, C O; Buzitis, J; Krahn, M M; Jones, L L; Rowles, T; Stein, J E

    2001-12-17

    Certain populations of killer whales (Orcinus orca) have been extensively studied over the past 30 years, including populations that use Puget Sound, WA, the inside waters of British Columbia, Southeastern Alaska and Kenai Fjords/Prince William Sound, Alaska. Two eco-types of killer whales, 'transient' and 'resident', occur in all of these regions. These eco-types are genetically distinct and differ in various aspects of morphology, vocalization patterns, diet and habitat use. Various genetic and photo-identification studies of eastern North Pacific killer whales have provided information on the male-female composition of most of these resident pods and transient groups, as well as the approximate ages, reproductive status and putative recruitment order (birth order) of the individual whales. Biopsy blubber samples of free-ranging resident and transient killer whales from the Kenai Fjords/Prince William Sound, AK region were acquired during the 1994-1999 field seasons and analyzed for selected organochlorines (OCs), including dioxin-like CB congeners and DDTs. Concentrations of OCs in transient killer whales (marine mammal-eating) were much higher than those found in resident animals (fish-eating) apparently due to differences in diets of these two killer whale eco-types. Certain life-history parameters such as sex, age and reproductive status also influenced the concentrations of OCs in the Alaskan killer whales. Reproductive female whales contained much lower levels of OCs than sexually immature whales or mature male animals in the same age class likely due to transfer of OCs from the female to her offspring during gestation and lactation. Recruitment order also influenced the concentrations of OCs in the Alaskan killer whales. In adult male residents, first-recruited whales contained much higher OC concentrations than those measured in non-first-recruited (e.g. second recruited, third recruited) resident animals in the same age group. This study provides

  1. Calculation of absorption parameters for selected narcotic drugs in the energy range from 1 keV to 100 GeV

    Science.gov (United States)

    Akman, Ferdi; Kaçal, Mustafa Recep; Akdemir, Fatma; Araz, Aslı; Turhan, Mehmet Fatih; Durak, Rıdvan

    2017-04-01

    The total mass attenuation coefficients (μ/ρ), total molecular (σt,m), atomic (σt,a) and electronic (σt,e) cross sections, effective atomic numbers (Zeff) and electron density (NE) were computed in the wide energy region from 1 keV to 100 GeV for the selected narcotic drugs such as morphine, heroin, cocaine, ecstasy and cannabis. The changes of μ/ρ, σt,m, σt,a, σt,e, Zeff and NE with photon energy for total photon interaction shows the dominance of different interaction process in different energy regions. The variations of μ/ρ, σt,m, σt,a, σt,e, Zeff and NE depend on the atom number, photon energy and chemical composition of narcotic drugs. Also, these parameters change with number of elements, the range of atomic numbers in narcotic drugs and total molecular weight. These data can be useful in the field of forensic sciences and medical diagnostic.

  2. Study of neutronic flux in IPR-R1 reactor with MCNPX; Estudo do fluxo neutronico no reator IPR-R1 com o MCNPX

    Energy Technology Data Exchange (ETDEWEB)

    Melo, J.A.S.; Castrillo, L.S., E-mail: julio.angelo@poli.br, E-mail: lazara@poli.br [Universidade de Pernambuco (UPE), Recife, PE (Brazil). Escola Politecnica; Oliveira, R.M.B.M., E-mail: romero.matias@educacao.pe.gov.br [Secretaria Executiva de Educacao do Estado de Pernambuco (SEE), Recife, PE (Brazil)

    2016-11-01

    MCNPX computer code, one of the latest versions of code MCNP transport were used to study the flux distribution and its neutronic fluence as a function of energy in two research reactor irradiation IPR-R1. The model developed was validated with research conducted by Dalle (2005). Initially, in the simulation is considered fresh fuel whose core configuration contained three neutron rods control, being two of them 100% ejected while the other inserted 3,1 x 10{sup -1} m deep, as adopted in the literature situation. The neutron source used was the critical type, through KSRC card. The results of the neutron flow and neutronic fluence were obtained in the central tube and the turntable on a range of energy spectrum that ranged from 1.0 x 10{sup -9} MeV to 10 MeV, showing good correlations with the model used in validation. Finally, a hypothetical situation wherein the three reactor control rods are ejected simultaneously was simulated. The simulation results showed an increase in the neutron flux of 7% in the central tube and 5% on the turntable.

  3. 26 CFR 1.414(r)-1 - Requirements applicable to qualified separate lines of business.

    Science.gov (United States)

    2010-04-01

    ... lines of business. 1.414(r)-1 Section 1.414(r)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Plans, Etc. § 1.414(r)-1 Requirements applicable to qualified separate lines of business. (a) In general. Section 414(r) prescribes the conditions under which an employer is treated as operating qualified...

  4. Influence of Dietary Zinc and Vitamin C Supplementation on Some Blood Biochemical Parameters and Egg Production in Free-Range Laying Hens

    Directory of Open Access Journals (Sweden)

    Vasko GERZILOV

    2015-03-01

    Full Text Available The study aimed to follow out the effect of antistress dietary supplements Zinteral 35 and vitamin C on the levels of some blood biochemical parameters (corticosterone, total cholesterol, glucose, total protein and creatinine and egg production in laying hens during cold (7o C, thermoneutral (19o C and hot (31o C periods. The fowls were divided in three groups (26 females and 3 males in each group. They were reared in a free-range management system with elements of organic production. The experimental treatments were as followed: first (control group without dietary supplement, second group with 100 mg Zinteral 35 per kg diet containing 35 mg/kg zinc oxide, third group with the same amount of Zinteral 35 together with 250 mg vitamin C per kg diet. During the three periods with different ambient temperature, the hens supplemented either with zinc alone (second group or co-administered zinc + vitamin C (third group had significantly lower levels of plasma corticosterone (P<0.001, serum cholesterol (P<0.05 and glucose (P<0.05 than those from the first (control group. The differences between the third and the first groups were bigger versus those between the second and the first groups. For the entire period (March 1 and June 21, egg production was higher by 2.22 % and 4.60 % in the second and third groups respectively in comparison to the first group. The combination of 100 mg Zinteral 35 and 250 mg vitamin C per 1 kg diet exhibited a synergistic effect in reducing cold and heat stress in laying hens and increased their egg production.

  5. BubR1 insufficiency impairs angiogenesis in aging and in experimental critical limb ischemic mice.

    Science.gov (United States)

    Okadome, Jun; Matsumoto, Takuya; Yoshiya, Keiji; Matsuda, Daisuke; Tamada, Kouji; Onimaru, Mitsuho; Nakano, Kaku; Egashira, Kensuke; Yonemitsu, Yoshikazu; Maehara, Yoshihiko

    2017-09-30

    Budding uninhibited by benzimidazole-related 1 (BubR1), a cell cycle-related protein, is an essential component of the spindle checkpoint that regulates cell division. Mice in which BubR1 expression is reduced to 10% of the normal level display the phenotypic features of progeria. However, the role of BubR1 in vascular diseases and angiogenesis remains unknown. To investigate the influence of BubR1 on angiogenesis, we generated a low-null-BubR1-expressing (BubR1L/-) mouse strain with reduced BubR1 expression as low as 15% of the normal level without any abnormalities in appearance. To elucidate the role of BubR1 in angiogenesis, we used a hind limb ischemia model induced in BubR1L/- mice and age-matched wild-type (WT) littermates. To evaluate the pathologic influence of BubR1 on angiogenesis, we measured the blood flow before and after hind limb ischemia surgery, and the expression of typical angiogenic factors in vivo and in vitro. In WT mice, blood flow in the ischemic left limb gradually recovered to approximately 80%, 14 days after surgery. Conversely, in the BubR1L/- group, blood flow in the left ischemic limb recovered to at most 30% (14 days after surgery, P calf muscles from BubR1L/- mice, regenerated muscle bundles, granulation tissue, and inflammatory cell invasion were more evident than in calf muscles from WT mice at 14 days after surgery. All WT mice at 14 days after surgery had complete limb salvage, but loss of limbs was observed in approximately 70% of BubR1L/- mice (P muscles was lower in BubR1L/- mice compared with WT mice (P muscle cells treated with BubR1 knockdown siRNA were lower compared with scramble siRNA under hypoxic conditions (P muscles after hind limb ischemia surgery were also significantly lower in BubR1L/- mice compared with WT mice (P < .05). BubR1 insufficiency impairs angiogenesis and results in limb loss in ischemic hind limbs. BubR1 may be a crucial angiogenic factor and might be beneficial for the treatment of limb

  6. Taste responses in mice lacking taste receptor subunit T1R1

    Science.gov (United States)

    Kusuhara, Yoko; Yoshida, Ryusuke; Ohkuri, Tadahiro; Yasumatsu, Keiko; Voigt, Anja; Hübner, Sandra; Maeda, Katsumasa; Boehm, Ulrich; Meyerhof, Wolfgang; Ninomiya, Yuzo

    2013-01-01

    The T1R1 receptor subunit acts as an umami taste receptor in combination with its partner, T1R3. In addition, metabotropic glutamate receptors (brain and taste variants of mGluR1 and mGluR4) are thought to function as umami taste receptors. To elucidate the function of T1R1 and the contribution of mGluRs to umami taste detection in vivo, we used newly developed knock-out (T1R1−/−) mice, which lack the entire coding region of the Tas1r1 gene and express mCherry in T1R1-expressing cells. Gustatory nerve recordings demonstrated that T1R1−/− mice exhibited a serious deficit in inosine monophosphate-elicited synergy but substantial residual responses to glutamate alone in both chorda tympani and glossopharyngeal nerves. Interestingly, chorda tympani nerve responses to sweeteners were smaller in T1R1−/− mice. Taste cell recordings demonstrated that many mCherry-expressing taste cells in T1R1+/− mice responded to sweet and umami compounds, whereas those in T1R1−/− mice responded to sweet stimuli. The proportion of sweet-responsive cells was smaller in T1R1−/− than in T1R1+/− mice. Single-cell RT-PCR demonstrated that some single mCherry-expressing cells expressed all three T1R subunits. Chorda tympani and glossopharyngeal nerve responses to glutamate were significantly inhibited by addition of mGluR antagonists in both T1R1−/− and T1R1+/− mice. Conditioned taste aversion tests demonstrated that both T1R1−/− and T1R1+/− mice were equally capable of discriminating glutamate from other basic taste stimuli. Avoidance conditioned to glutamate was significantly reduced by addition of mGluR antagonists. These results suggest that T1R1-expressing cells mainly contribute to umami taste synergism and partly to sweet sensitivity and that mGluRs are involved in the detection of umami compounds. PMID:23339178

  7. Effects of free-range access on production parameters and meat quality, composition and taste in slow-growing broiler chickens

    NARCIS (Netherlands)

    Stadig, Lisanne M.; Rodenburg, Bas; Reubens, Bert; Aerts, Johan; Duquenne, Barbara; Tuyttens, Frank A.M.

    2016-01-01

    Demand for meat from free-range broiler chickens is increasing in several countries. Consumers are motivated by better animal welfare and other product attributes such as quality and taste. However, scientific literature is not unanimous about whether free-range access influences quality,

  8. Cloning and Expression of Ama r 1, as a Novel Allergen of Amaranthus retroflexus Pollen

    Directory of Open Access Journals (Sweden)

    Payam Morakabati

    2016-01-01

    Full Text Available Sensitisation to Amaranthus retroflexus pollen is very common in tropical and subtropical countries. In this study we aimed to produce a recombinant allergenic Ole e 1-like protein from the pollen of this weed. To predict cross-reactivity of this allergen (Ama r 1 with other members of the Ole e 1-like protein family, the nucleotide sequence homology of the Ama r 1 was investigated. The expression of Ama r 1 in Escherichia coli was performed by using a pET-21b(+ vector. The IgE-binding potential of recombinant Ama r 1 (rAma r 1 was evaluated by immunodetection and inhibition assays using 26 patients’ sera sensitised to A. retroflexus pollen. The coding sequence of the Ama r 1 cDNA indicated an open reading frame of 507 bp encoding for 168 amino acid residues which belonged to the Ole e 1-like protein family. Of the 26 serum samples, 10 (38.46% had significant specific IgE levels for rAma r 1. Immunodetection and inhibition assays revealed that the purified rAma r 1 might be the same as that in the crude extract. Ama r 1, the second allergen from the A. retroflexus pollen, was identified as a member of the family of Ole e 1-like protein.

  9. Resolving model parameter values from carbon and nitrogen stock measurements in a wide range of tropical mature forests using nonlinear inversion and regression trees

    Science.gov (United States)

    Shuguang Liua; Pamela Anderson; Guoyi Zhoud; Boone Kauffman; Flint Hughes; David Schimel; Vicente Watson; Joseph. Tosi

    2008-01-01

    Objectively assessing the performance of a model and deriving model parameter values from observations are critical and challenging in landscape to regional modeling. In this paper, we applied a nonlinear inversion technique to calibrate the ecosystem model CENTURY against carbon (C) and nitrogen (N) stock measurements collected from 39 mature tropical forest sites in...

  10. Effects of free-range access on production parameters and meat quality, composition and taste in slow-growing broiler chickens.

    Science.gov (United States)

    Stadig, Lisanne M; Rodenburg, T Bas; Reubens, Bert; Aerts, Johan; Duquenne, Barbara; Tuyttens, Frank A M

    2016-12-01

    Demand for meat from free-range broiler chickens is increasing in several countries. Consumers are motivated by better animal welfare and other product attributes such as quality and taste. However, scientific literature is not unanimous about whether free-range access influences quality, composition, and taste of the meat. Because chickens normally do not use free-range areas optimally, it is possible that provision of more suitable shelter will lead to more pronounced differences between chickens raised indoors and outdoors. In this study, an experiment with 2 production rounds of 600 slow-growing broilers each was performed. In each round, 200 chickens were raised indoors (IN), 200 had free-range access to grassland with artificial shelter (AS), and 200 had free-range access to short-rotation coppice with willow (SRC). Free-range use, feed intake, and growth were monitored, and after slaughter (d72) meat quality, composition, and taste were assessed. Free-range use was higher in SRC than in AS chickens (42.8 vs. 35.1%, P < 0.001). IN chickens were heavier at d70 than AS and SRC chickens (2.79 vs. 2.66 and 2.68 kg, P = 0.005). However, feed intake and conversion did not differ. Breast meat of chickens with free-range access was darker (P = 0.021) and yellower (P = 0.001) than that of IN chickens. Ultimate pH was lower (5.73 vs. 5.79; P = 0.006) and drip loss higher (1.29 vs. 1.09%; P = 0.05) in IN versus AS chickens. The percentage of polyunsaturated fatty acids was higher in AS than in IN meat (35.84 vs. 34.59%; P = 0.021). The taste panel judged breast meat of SRC chickens to be more tender (P = 0.003) and less fibrous (P = 0.013) compared to that of AS and IN chickens, and juicier compared to the IN chickens (P = 0.017). Overall, free-range access negatively affected slaughter weight, but positively affected meat quality, taste, and composition. Only a few differences between AS and SRC were found, possibly due to limited differences in

  11. Two functionally distinct kinetochore pools of BubR1 ensure accurate chromosome segregation

    DEFF Research Database (Denmark)

    Zhang, Gang; Mendez, Blanca Lopez; Sedgwick, Garry G

    2016-01-01

    The BubR1/Bub3 complex is an important regulator of chromosome segregation as it facilitates proper kinetochore-microtubule interactions and is also an essential component of the spindle assembly checkpoint (SAC). Whether BubR1/Bub3 localization to kinetochores in human cells stimulates SAC signa...

  12. PLA2R1 mediates tumor suppression by activating JAK2.

    Science.gov (United States)

    Vindrieux, David; Augert, Arnaud; Girard, Christophe A; Gitenay, Delphine; Lallet-Daher, Helene; Wiel, Clotilde; Le Calvé, Benjamin; Gras, Baptiste; Ferrand, Mylène; Verbeke, Stéphanie; de Launoit, Yvan; Leroy, Xavier; Puisieux, Alain; Aubert, Sébastien; Perrais, Michael; Gelb, Michael; Simonnet, Hélène; Lambeau, Gérard; Bernard, David

    2013-10-15

    Little is known about the physiological role of the phospholipase A2 receptor (PLA2R1). PLA2R1 has been described as regulating the replicative senescence, a telomerase-dependent proliferation arrest. The downstream PLA2R1 signaling and its role in cancer are currently unknown. Senescence induction in response to activated oncogenes is a failsafe program of tumor suppression that must be bypassed for tumorigenesis. We now present evidence that PLA2R1 functions in vitro as a tumor suppressor, the depletion of which is sufficient to escape oncogene-induced senescence (OIS), thereby facilitating oncogenic cell transformation. Furthermore, mice that are genetically deficient in PLA2R1 display increased sensitivity to RAS-induced tumorigenesis by facilitating OIS escape, highlighting its physiological role as a tumor suppressor. Unexpectedly, PLA2R1 activated JAK2 and its effector signaling, with PLA2R1-mediated inhibition of cell transformation largely reverted in JAK2-depleted cells. This finding was unexpected as the JAK2 pathway has been associated mainly with protumoral functions and several inhibitors are currently in clinical trials. Taken together, our findings uncover an unanticipated tumor suppressive role for PLA2R1 that is mediated by targeting downstream JAK2 effector signaling. ©2013 AACR.

  13. Determination of taste receptor type 1 member 1 (TAS1R1) gene ...

    African Journals Online (AJOL)

    Jane

    2011-10-10

    Oct 10, 2011 ... L-glutamate sense, the functional variations of TAS1R1 gene may affect thermoregulation and energy homeostasis of goat. In this study, the coding and flanking region of TAS1R1 gene was screened in three goat populations for SSCP polymorphism and SNPs, and the association of SSCP genotypes with ...

  14. Tumor suppressor miR-1 inhibits tumor growth and metastasis by simultaneously targeting multiple genes

    Science.gov (United States)

    Liu, Cuilian; Zhang, Song; Wang, Qizhi; Zhang, Xiaobo

    2017-01-01

    Cancer progression depends on tumor growth and metastasis, which are activated or suppressed by multiple genes. An individual microRNA may target multiple genes, suggesting that a miRNA may suppress tumor growth and metastasis via simultaneously targeting different genes. However, thus far, this issue has not been explored. In the present study, the findings showed that miR-1 could simultaneously inhibit tumor growth and metastasis of gastric and breast cancers by targeting multiple genes. The results indicated that miR-1 was significantly downregulated in cancer tissues compared with normal tissues. The miR-1 overexpression led to cell cycle arrest in the G1 phase in gastric and breast cancer cells but not in normal cells. Furthermore, the miR-1 overexpression significantly inhibited the metastasis of gastric and breast cancer cells. An analysis of the underlying mechanism revealed that the simultaneous inhibition of tumor growth and metastasis mediated by miR-1 was due to the synchronous targeting of 6 miR-1 target genes encoding cyclin dependent kinase 4, twinfilin actin binding protein 1, calponin 3, coronin 1C, WAS protein family member 2 and thymosin beta 4, X-linked. In vivo assays demonstrated that miR-1 efficiently inhibited tumor growth and metastasis of gastric and breast cancers in nude mice. Therefore, our study contributed novel insights into the miR-1′s roles in tumorigenesis of gastric and breast cancers. PMID:28159933

  15. The phylogenetic and geographic structure of Y-chromosome haplogroup R1a.

    Science.gov (United States)

    Underhill, Peter A; Poznik, G David; Rootsi, Siiri; Järve, Mari; Lin, Alice A; Wang, Jianbin; Passarelli, Ben; Kanbar, Jad; Myres, Natalie M; King, Roy J; Di Cristofaro, Julie; Sahakyan, Hovhannes; Behar, Doron M; Kushniarevich, Alena; Sarac, Jelena; Saric, Tena; Rudan, Pavao; Pathak, Ajai Kumar; Chaubey, Gyaneshwer; Grugni, Viola; Semino, Ornella; Yepiskoposyan, Levon; Bahmanimehr, Ardeshir; Farjadian, Shirin; Balanovsky, Oleg; Khusnutdinova, Elza K; Herrera, Rene J; Chiaroni, Jacques; Bustamante, Carlos D; Quake, Stephen R; Kivisild, Toomas; Villems, Richard

    2015-01-01

    R1a-M420 is one of the most widely spread Y-chromosome haplogroups; however, its substructure within Europe and Asia has remained poorly characterized. Using a panel of 16 244 male subjects from 126 populations sampled across Eurasia, we identified 2923 R1a-M420 Y-chromosomes and analyzed them to a highly granular phylogeographic resolution. Whole Y-chromosome sequence analysis of eight R1a and five R1b individuals suggests a divergence time of ∼25,000 (95% CI: 21,300-29,000) years ago and a coalescence time within R1a-M417 of ∼5800 (95% CI: 4800-6800) years. The spatial frequency distributions of R1a sub-haplogroups conclusively indicate two major groups, one found primarily in Europe and the other confined to Central and South Asia. Beyond the major European versus Asian dichotomy, we describe several younger sub-haplogroups. Based on spatial distributions and diversity patterns within the R1a-M420 clade, particularly rare basal branches detected primarily within Iran and eastern Turkey, we conclude that the initial episodes of haplogroup R1a diversification likely occurred in the vicinity of present-day Iran.

  16. Engineering assessment and certification of integrity of the 141-R1U1 tank system

    Energy Technology Data Exchange (ETDEWEB)

    Graser, D.A. (Science Applications International Corp. (USA))

    1990-09-01

    This Engineering Assessment and Certification of Integrity of retention tank 141-R1U1 is in response to the requirements of 40 CFR 265.191 for an existing tank system that stores hazardous waste and does not have secondary containment. This technical assessment has been reviewed by an independent, qualified, California registered professional engineer, who has certified the tank system to be adequately designed and compatible with the stored waste so that it will not collapse rupture, or fail. This document will be kept on file at the facility. Onground retention tanks 141-R1O1 and 141-R1O2, which are also part of the 141-R1 retention tank system, do not have secondary containment; consequently, certification documentation for these tanks is not included in this assessment. A discussion of the onground tanks, however, is included in this report to provide a complete description of the 141-R1 retention tank system. 8 refs., 7 figs.

  17. Caracemide, a site-specific irreversible inhibitor of protein R1 of Escherichia coli ribonucleotide reductase

    DEFF Research Database (Denmark)

    Larsen, I. K.; Cornett, Claus; Karlsson, M.

    1992-01-01

    The anticancer drug caracemide, N-acetyl-N,O-di(methylcarbamoyl)hydroxylamine, and one of its degradation products, N-acetyl-O-methylcarbamoyl-hydroxylamine, were found to inhibit the enzyme ribonucleotide reductase of Escherichia coli by specific interaction with its larger component protein R1....... No effect on the smaller protein R2 was observed. The effect of the degradation product was about 30 times lower than that of caracemide itself. The caracemide inactivation of R1 is irreversible, with an apparent second-order rate constant of 150 M-1 s-1. The R1R2 holoenzyme was approximately 30 times more...... inactivation. These results indicate that caracemide inactivates R1 by covalent modification at the substrate-binding site. By analogy with the known interaction between caracemide and acetylcholinesterase or choline acetyltransferase, we propose that the modification of R1 occurs at an activated cysteine...

  18. Determining the solubility parameter and the cross-link density of medical grade silicones: effect of increasing the range of swelling liquids.

    Science.gov (United States)

    Mahomed, Aziza; Kocharian, Areg

    2015-01-01

    Four samples of four medical grade silicones were swollen in six "good" liquids (i.e. those with a good swelling ability, in which silicones swell appreciably) at 25°C, until they reached constant mass (i.e. equilibrium). The volume fraction, ϕ, of the silicone in the swollen sample was calculated for each grade of silicone. Using a combination of the six ϕ values obtained in this study and four of those obtained in a previous study, for each silicone grade, ϕ was plotted against δl, the liquid solubility parameter for the ten liquids used. Using a curve fitting technique a second-order polynomial was plotted through the data points; the minimum in this polynomial provided a value for δp (the polymer solubility parameter). Furthermore, the results showed that the δp values obtained in this study (using ten liquids) were slightly but significantly greater (p<0.05) than those obtained in a previous study (using four liquids), for grade C6-165 only. Similarly, the χ and υ values obtained in the two studies were only significantly different (p<0.05) from each other, for grade C6-165.

  19. The peculiarity of the construction of an optical-electronic system for measurement of geometrical parameters of objects in the micrometer range

    Science.gov (United States)

    Markina, Olga M.; Markin, Maksym O.; Filippova, Maryna V.; Harasim, Damian; Mussabekov, Kanat; Annabayev, Azamat

    2017-08-01

    The optical-electronic system for measuring of geometrical parameters of micrometrical objects is a difficult process that requires the observance of certain features designing or improvement. The observance of that will provide a higher measurement accuracy compared with the accuracy metrics of measurement that were developed without compliance with these design features. Every feature of the design reduces the error of the functioning of individual nodes of the system or errors in nodes under the influence of various internal or external factors. When reducing or eliminating each factor of occurrence of the error, respectively, will increase the overall measurement accuracy. In this work, the result of introducing measurement error for each factor is determined experimentally and proved the correctness of such actions. Experimental researches of the measurement error to the stage of compliance with subtleties in the improvement of the opto-electronic system was 10 ± 1.5 μm, and after improvement with considering of the specifics of the design measurement error of geometrical parameters was 10 ± 0,33 μm.

  20. Establishing Age-Adjusted Reference Ranges for Iris-Related Parameters in Open Angle Eyes with Anterior Segment Optical Coherence Tomography.

    Directory of Open Access Journals (Sweden)

    Jeffrey R Peterson

    Full Text Available Define criteria for iris-related parameters in an adult open angle population as measured with swept source Fourier domain anterior segment optical coherence tomography (ASOCT.Ninety-eight eyes of 98 participants with open angles were included and stratified into 5 age groups (18-35, 36-45, 46-55, 56-65, and 66-79 years. ASOCT scans with 3D mode angle analysis were taken with the CASIA SS-1000 (Tomey Corporation, Nagoya, Japan and analyzed using the Anterior Chamber Analysis and Interpretation software. Anterior iris surface length (AISL, length of scleral spur landmark (SSL to pupillary margin (SSL-to-PM, iris contour ratio (ICR = AISL/SSL-to-PM, pupil radius, radius of iris centroid (RICe, and iris volume were measured. Outcome variables were summarized for all eyes and age groups, and mean values among age groups were compared using one-way analysis of variance. Stepwise regression analysis was used to investigate demographic and ocular characteristic factors that affected each iris-related parameter.Mean (±SD values were 2.24 mm (±0.46, 4.06 mm (±0.27, 3.65 mm (±0.48, 4.16 mm (±0.47, 1.14 (±0.04, 1.51 mm2 (±0.23, and 38.42 μL (±4.91 for pupillary radius, RICe, SSL-to-PM, AISL, ICR, iris cross-sectional area, and iris volume, respectively. Both pupillary radius (P = 0.002 and RICe (P = 0.027 decreased with age, while SSL-to-PM (P = 0.002 and AISL increased with age (P = 0.001. ICR (P = 0.54 and iris volume (P = 0.49 were not affected by age.This study establishes reference values for iris-related parameters in an adult open angle population, which will be useful for future studies examining the role of iris changes in pathologic states.

  1. NCoR1 and SMRT play unique roles in thyroid hormone action in vivo.

    Science.gov (United States)

    Shimizu, Hiroaki; Astapova, Inna; Ye, Felix; Bilban, Martin; Cohen, Ronald N; Hollenberg, Anthony N

    2015-02-01

    NCoR1 (nuclear receptor corepressor) and SMRT (silencing mediator of retinoid and thyroid hormone receptors; NCoR2) are well-recognized coregulators of nuclear receptor (NR) action. However, their unique roles in the regulation of thyroid hormone (TH) signaling in specific cell types have not been determined. To accomplish this we generated mice that lacked function of either NCoR1, SMRT, or both in the liver only and additionally a global SMRT knockout model. Despite both corepressors being present in the liver, deletion of SMRT in either euthyroid or hypothyroid animals had little effect on TH signaling. In contrast, disruption of NCoR1 action confirmed that NCoR1 is the principal mediator of TH sensitivity in vivo. Similarly, global disruption of SMRT, unlike the global disruption of NCoR1, did not affect TH levels. While SMRT played little role in TH-regulated pathways, when disrupted in combination with NCoR1, it greatly accentuated the synthesis and storage of hepatic lipid. Taken together, these data demonstrate that corepressor specificity exists in vivo and that NCoR1 is the principal regulator of TH action. However, both corepressors collaborate to control hepatic lipid content, which likely reflects their cooperative activity in regulating the action of multiple NRs including the TH receptor (TR). Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  2. The involvement of MiR-1-clathrin pathway in the regulation of phagocytosis.

    Directory of Open Access Journals (Sweden)

    Cuilian Liu

    Full Text Available Phagocytosis, one of the most powerful immune responses, is a complicated process regulated by many factors. However the regulation of phagocytosis mediated by microRNAs has not been extensively investigated. To address this issue, the regulation of phagocytosis by miR-1 was characterized in this study. The results showed that miR-1 played an important role in the phagocytosis regulation in shrimp in vivo. The sequence analysis indicated that miR-1 was highly conserved from invertebrates to mammals, suggesting that miR-1 might share the similar or same functions in phagocytosis of shrimp hemocytes and mammalian macrophages. The data presented that miR-1 was significantly downregulated in cancerous macrophage RAW264.7 cells compared with those in the isolated murine macrophage and in the immortalized macrophage ANA-1. The findings showed that miR-1 had a great effect on the regulation of phagocytosis in cancerous macrophage by the inhibition of clathrin heavy chain 1 (CLTC1 gene. Therefore our study presented a novel miR-1-mediated regulation of phagocytosis both in invertebrate and in vertebrate.

  3. A compilation of correlation parameters for predicting the enthalpy and thermal conductivity of solid foods within the temperature range of -40 C to +40 C

    Energy Technology Data Exchange (ETDEWEB)

    Amos, N.D. [Comvita New Zealand Limited, Private Bag 1, Te Puke 3153 (New Zealand); Willix, J.; North, M.F. [AgResearch Limited, MIRINZ Centre, Ruakura Campus, East Street, Private Bag 3123, Hamilton (New Zealand); Chadderton, T. [Crop and Food Research Ltd, PO Box 5114, Nelson (New Zealand)

    2008-11-15

    This paper presents thermal conductivity data for 40 foods, enthalpy data for 58 foods and density data for nine foods, along with the compositions of the foods. Measurements cover a range of solid food types (including meats, fats, offal, fish, dairy products and horticultural products). Some measurements reported are for foods that have never before been studied, others have been published elsewhere, but are included here for convenience. Thermal conductivity was measured using a guarded hot-plate apparatus, enthalpy using an adiabatic calorimeter and density using a water displacement meter. Thermal conductivity and enthalpy values were measured within the temperature range of -40 C to +40 C. (author) [French] Cette publication presente des donnes sur la conductivite thermique, l'enthalpie et la densite respectivement de 40, 58 et 9 produits alimentaires, ainsi que leurs compositions. Les mesures couvrent une variete de types de produits alimentaires (viande, matieres grasses, abats, poisson, produits laitiers, produits horticoles). Certaines sont rapportees pour des produits qui n 'ant jamais ete etudie auparavant, d'autres ant ete publie ailleurs mais sont aussi inclues pour plus de commodite. La conductivite thermique a ete mesure avec un appareil a plaque electrique protegee, l'enthalpie avec un calorimetre adiabatique et la densite avec un appareil mesurant Ie deplacement d'eau. La conductivite thermique et l'enthalpie ont ete toutes les mesures pour une fourchette de temperatures allant de -40 C a 40 C. (orig.)

  4. Genome of Herbaspirillum seropedicae strain SmR1, a specialized diazotrophic endophyte of tropical grasses.

    Directory of Open Access Journals (Sweden)

    Fábio O Pedrosa

    2011-05-01

    Full Text Available The molecular mechanisms of plant recognition, colonization, and nutrient exchange between diazotrophic endophytes and plants are scarcely known. Herbaspirillum seropedicae is an endophytic bacterium capable of colonizing intercellular spaces of grasses such as rice and sugar cane. The genome of H. seropedicae strain SmR1 was sequenced and annotated by The Paraná State Genome Programme--GENOPAR. The genome is composed of a circular chromosome of 5,513,887 bp and contains a total of 4,804 genes. The genome sequence revealed that H. seropedicae is a highly versatile microorganism with capacity to metabolize a wide range of carbon and nitrogen sources and with possession of four distinct terminal oxidases. The genome contains a multitude of protein secretion systems, including type I, type II, type III, type V, and type VI secretion systems, and type IV pili, suggesting a high potential to interact with host plants. H. seropedicae is able to synthesize indole acetic acid as reflected by the four IAA biosynthetic pathways present. A gene coding for ACC deaminase, which may be involved in modulating the associated plant ethylene-signaling pathway, is also present. Genes for hemagglutinins/hemolysins/adhesins were found and may play a role in plant cell surface adhesion. These features may endow H. seropedicae with the ability to establish an endophytic life-style in a large number of plant species.

  5. Intelligence and Information-Sharing Elements of S.4 and H.R. 1

    National Research Council Canada - National Science Library

    Masse, Todd

    2007-01-01

    Title I of S.4 and Title VII of H.R. 1 include corresponding measures related to enhancing information and intelligence sharing, both horizontally within the Federal Government and vertically between the Federal Government and state...

  6. Data of evolutionary structure change: 1DV6R-1AIGM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DV6R-1AIGM 1DV6 1AIG R M -----------------ALLSFERKYRVPGGTLV--GGNLFDFWVGPFYVGFFGVA...WQWWVKLPWWANIPGGING YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSLFSGLMWFFT...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM VGPFSTLLGWFG...1AIG M 1AIGM YGLSFAAPLKE

  7. Data of evolutionary structure change: 1DV3R-1AIGM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DV3R-1AIGM 1DV3 1AIG R M -----------------ALLSFERKYRVPGGTLV--GGNLFDFWVGPFYVGFFGVA...WQWWVKLPWWANIPGGING YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVLSLFSGLMWFFT...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM VGPFSTLLGWFG...1AIG M 1AIGM YGLSFAAPLKE

  8. Minocycline increases phosphorylation and membrane insertion of neuronal GluR1 receptors

    OpenAIRE

    Imbesi, Marta; Uz, Tolga; Manev, Radmila; Sharma, Rajiv P.; Manev, Hari

    2008-01-01

    The tetracycline antibiotic minocycline beneficially affects neuronal functioning and also inhibits the enzyme 5-lipoxygenase (5-LOX). We hypothesized that similar to 5-LOX inhibitors, minocycline may increase phosphorylation and membrane insertion of the glutamate receptor GluR1. The experiments were performed in primary cultures of mouse striatal neurons and in the prefrontal cortex and striatum of minocycline-treated mice. Invitro, low micromolar minocycline concentrations increased GluR1 ...

  9. Closure report for underground storage tank 161-R1U1 and its associated underground piping

    Energy Technology Data Exchange (ETDEWEB)

    Mallon, B.J.; Blake, R.G.

    1994-05-01

    Underground storage tank (UST) 161-31 R at the Lawrence Livermore National Laboratory (LLNL) was registered with the State Water Resources Control Board on June 27, 1984. UST 161-31R was subsequently renamed UST 161-R1U1 (Fig. A-1, Appendix A). UST 161-R1U1 was installed in 1976, and had a capacity of 383 gallons. This tank system consisted of a fiberglass reinforced plastic tank, approximately 320 feet of polyvinyl chloride (PVC) underground piping from Building 161, and approximately 40 feet of PVC underground piping from Building 160. The underground piping connected laboratory drains and sinks inside Buildings 160 and 161 to UST 161-R1U1. The wastewater collected in UST 161-R1U1, contained organic solvents, metals, inorganic acids, and radionuclides, most of which was produced within Building 161. On June 28, 1989, the UST 161-R1U1 piping system.around the perimeter of Building 161 failed a precision test performed by Gary Peters Enterprises (Appendix B). The 161-R1U1 tank system was removed from service after the precision test. In July 1989, additional hydrostatic tests and helium leak detection tests were performed (Appendix B) to determine the locations of the piping failures in the Building 161 piping system. The locations of the piping system failures are shown in Figure A-2 (Appendix A). On July 11, 1989, LLNL submitted an Unauthorized Release Report to Alameda County Department of Environmental Health (ACDEH), Appendix C.

  10. Transcriptome analysis of comb and testis from Rose-comb Silky chicken (R1/R1) and Beijing Fatty wild type chicken (r/r).

    Science.gov (United States)

    Wang, Y; Li, J; Feng, C; Zhao, Y; Hu, X; Li, N

    2017-06-01

    Rose-comb was one of the chicken comb-variants first used by Bateson and Punnet in 1902 to demonstrate Mendelian inheritance in animals. Rose-comb is a monogenic trait that has been widely described in chickens. It is caused by a large structural rearrangement that leads to mis-expression of transcription factor MNR2 on chromosome 7. Rose-comb has pleiotropic effects in homozygous roosters, which is associated with poor sperm mobility. It was postulated that this is caused by the disruption of the CCDC108 gene located at the distal inversion breakpoint. In this study, we did the transcriptional profiling of combs and testes from Rose-comb Silky (RS) (R1/R1) and Beijing Fatty (BF) wild type chickens (r/r) using RNA-seq. We obtained 68,694,797 unique mapped reads and over 80% of the chicken genes were covered for each sample. In combs, we found that differentially expressed genes (DEGs) were significantly enriched in the retinol metabolism (RPE65, CYP26A1, and CYP26C1) and hedgehog-signaling pathway (PTCH1, GLI1, and HHIP), while genes related to cell differentiation and morphogenesis were down-regulated in R1/R1 chickens, suggesting that the transient expression of MNR2 might affect the expression of these genes and influence the development of comb tissue. For testes, DEGs were significantly enriched in the GO terms of binding activates and mitochondrial oxidation-reduction reactions. Our results suggested that the CCDC108 might be functionally related with mitochondrial oxidation-reduction reactions and caused subfertility of roosters. Compared with the genome average, the degree of expression variations within the inversion region did not show significant differences. However, DEGs near the breakpoints showed greater expression variance. Our results demonstrated that the large-scale rearrangements affected the gene expression only around the breakpoint in this case. © 2017 Poultry Science Association Inc.

  11. Alterations in CD200-CD200R1 System during EAE Already Manifest at Presymptomatic Stages

    Directory of Open Access Journals (Sweden)

    Tony Valente

    2017-05-01

    Full Text Available In the brain of patients with multiple sclerosis, activated microglia/macrophages appear in active lesions and in normal appearing white matter. However, whether they play a beneficial or a detrimental role in the development of the pathology remains a controversial issue. The production of pro-inflammatory molecules by chronically activated microglial cells is suggested to contribute to the progression of neurodegenerative processes in neurological disease. In the healthy brain, neurons control glial activation through several inhibitory mechanisms, such as the CD200-CD200R1 interaction. Therefore, we studied whether alterations in the CD200-CD200R1 system might underlie the neuroinflammation in an experimental autoimmune encephalomyelitis (EAE model of multiple sclerosis. We determined the time course of CD200 and CD200R1 expression in the brain and spinal cord of an EAE mouse model from presymptomatic to late symptomatic stages. We also assessed the correlation with associated glial activation, inflammatory response and EAE severity. Alterations in CD200 and CD200R1 expression were mainly observed in spinal cord regions in the EAE model, mostly a decrease in CD200 and an increase in CD200R1 expression. A decrease in the expression of the mRNA encoding a full CD200 protein was detected before the onset of clinical signs, and remained thereafter. A decrease in CD200 protein expression was observed from the onset of clinical signs. By contrast, CD200R1 expression increased at EAE onset, when a glial reaction associated with the production of pro- and anti-inflammatory markers occurred, and continued to be elevated during the pathology. Moreover, the magnitude of the alterations correlated with severity of the EAE mainly in spinal cord. These results suggest that neuronal-microglial communication through CD200-CD200R1 interaction is compromised in EAE. The early decreases in CD200 expression in EAE suggest that this downregulation might also

  12. Inhibition of CD200R1 expression by C/EBP beta in reactive microglial cells

    Directory of Open Access Journals (Sweden)

    Dentesano Guido

    2012-07-01

    Full Text Available Abstract Background In physiological conditions, it is postulated that neurons control microglial reactivity through a series of inhibitory mechanisms, involving either cell contact-dependent, soluble-factor-dependent or neurotransmitter-associated pathways. In the current study, we focus on CD200R1, a microglial receptor involved in one of these cell contact-dependent mechanisms. CD200R1 activation by its ligand, CD200 (mainly expressed by neurons in the central nervous system,is postulated to inhibit the pro-inflammatory phenotype of microglial cells, while alterations in CD200-CD200R1 signalling potentiate this phenotype. Little is known about the regulation of CD200R1 expression in microglia or possible alterations in the presence of pro-inflammatory stimuli. Methods Murine primary microglial cultures, mixed glial cultures from wild-type and CCAAT/enhancer binding protein β (C/EBPβ-deficient mice, and the BV2 murine cell line overexpressing C/EBPβ were used to study the involvement of C/EBPβ transcription factor in the regulation of CD200R1 expression in response to a proinflammatory stimulus (lipopolysaccharide (LPS. Binding of C/EBPβ to the CD200R1 promoter was determined by quantitative chromatin immunoprecipitation (qChIP. The involvement of histone deacetylase 1 in the control of CD200R1 expression by C/EBPβ was also determined by co-immunoprecipitation and qChIP. Results LPS treatment induced a decrease in CD200R1 mRNA and protein expression in microglial cells, an effect that was not observed in the absence of C/EBPβ. C/EBPβ overexpression in BV2 cells resulted in a decrease in basal CD200R1 mRNA and protein expression. In addition, C/EBPβ binding to the CD200R1 promoter was observed in LPS-treated but not in control glial cells, and also in control BV2 cells overexpressing C/EBPβ. Finally, we observed that histone deacetylase 1 co-immunoprecipitated with C/EBPβ and showed binding to a C/EBPβ consensus sequence of the CD

  13. Application of nondestructive methods for qualification of high density fuels in the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Jose E.R.; Silva, Antonio T.; Domingos, Douglas B.; Terremoto, Luis A.A., E-mail: jersilva@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    IPEN/CNEN-SP manufactures fuels to be used in its research reactor - the IEA-R1. To qualify those fuels, it is necessary to check if they have a good performance under irradiation. As Brazil still does not have nuclear research reactors with high neutron fluxes, or suitable hot cells for carrying out post-irradiation examination of nuclear fuels, IPEN/CNEN-SP has conducted a fuel qualification program based on the use of uranium compounds (U{sub 3}O{sub 8} and U{sub 3}Si{sub 2} dispersed in Al matrix) internationally tested and qualified to be used in research reactors, and has attained experience in the technological development stages for the manufacturing of fuel plates, irradiation and non-destructive post-irradiation testing. Fuel elements containing low volume fractions of fuel in the dispersion were manufactured and irradiated successfully directly in the core of the IEA-R1. However, there are plans at IPEN/CNEN-SP to increase the uranium density of the fuels. Ten fuel miniplates (five containing U{sub 3}O{sub 8}-Al and five containing U{sub 3}Si{sub 2}-Al), with densities of 3.2 gU/cm{sup 3} and 4.8 gU/cm{sup 3} respectively, are being irradiated inside an irradiation device placed in a peripheral position of the IEA-R1 core. Non-destructive methods will be used to evaluate irradiation performance of the fuel miniplates after successive cycles of irradiation, by means: monitoring the reactor parameters during operation; periodic underwater visual inspection of fuel miniplates, eventual sipping test for fuel miniplates suspected of leakage and underwater measuring of the miniplate thickness for assessment of the fuel miniplate swelling. (author)

  14. C3a Enhances the Formation of Intestinal Organoids through C3aR1

    Directory of Open Access Journals (Sweden)

    Naoya Matsumoto

    2017-09-01

    Full Text Available C3a is important in the regulation of the immune response as well as in the development of organ inflammation and injury. Furthermore, C3a contributes to liver regeneration but its role in intestinal stem cell function has not been studied. We hypothesized that C3a is important for intestinal repair and regeneration. Intestinal organoid formation, a measure of stem cell capacity, was significantly limited in C3-deficient and C3a receptor (C3aR 1-deficient mice while C3a promoted the growth of organoids from normal mice by supporting Wnt-signaling but not from C3aR1-deficient mice. Similarly, the presence of C3a in media enhanced the expression of the intestinal stem cell marker leucine-rich repeat G-protein-coupled receptor 5 (Lgr5 and of the cell proliferation marker Ki67 in organoids formed from C3-deficient but not from C3aR1-deficient mice. Using Lgr5.egfp mice we showed significant expression of C3 in Lgr5+ intestinal stem cells whereas C3aR1 was expressed on the surface of various intestinal cells. C3 and C3aR1 expression was induced in intestinal crypts in response to ischemia/reperfusion injury. Finally, C3aR1-deficient mice displayed ischemia/reperfusion injury comparable to control mice. These data suggest that C3a through interaction with C3aR1 enhances stem cell expansion and organoid formation and as such may have a role in intestinal regeneration.

  15. Characteristics of dibenzothiophene desulfurization by Rhodococcus erythropolis R1 and its Dsz-negative mutant

    Directory of Open Access Journals (Sweden)

    Zahra Etemadifar

    2014-01-01

    Full Text Available Introduction: Biodesulfurization is used as a selective method for lowering the sulfur content of petroleum products. Materials and methods: A sulfur-oxidation bacterial strain named Rhodococcus erythropolis R1 (NCBI GenBank Accession No. GU570564 was used in this study for desulfurization of dibenzothiophene (DBT. Results: The induced culture of strain R1 was able to produce 2-hydroxybiphenyl (2- HBP from DBT followed 4S pathway without further degrading carbon backbone. This process confirmed by gas chromatography (GC analysis. The specific activity of DBT desulfurization by R1 was 45 µM (g dry wt-1 h-1. The addition of Tween 80 as surfactant and glycerol as carbon source determines a 100% rate of DBT-desulfurization during 3 days. The heavy plasmid detected in R1 strain carries dsz genes responsible for biodesulfurization of DBT that was shown by PCR reaction. The mutant strains which had lost this plasmid also had lost desulfurization phenotype. Both mutant and wild strain were sensitive to high concentration of 2-HBP and some antibiotics. Discussion and conclusion: Strain R1 desulfurize DBT through the sulfur-specific degradation pathway or 4S pathway with the selective cleavage of carbon-sulfur (C-S bonds without reducing the energy content. Addition of surfactant enhanced the desulfurization of DBT by increasing its bioavailability and also could improve the growth and desulfurization rate. The location of desulfurization genes was on a heavy plasmid in strain R1. Based on the results of this study, R. erythropolis R1 could serve as a model system for efficient biodesulfurization of petroleum oil without reducing the energy value.

  16. Pseudorapidity Distribution of Charged Particles and Square Speed of Sound Parameter in p-p or p-p- Collisions over an Energy Range from 0.053 to 7 TeV

    Directory of Open Access Journals (Sweden)

    Ya-Qin Gao

    2014-01-01

    Full Text Available Pseudorapidity distributions of charged particles produced in proton-proton (p-p or proton-antiproton (p-p- collisions over an energy range from 0.053 to 7 TeV are studied by using the four-component Landau hydrodynamic model. The results calculated by the model are in agreement with the experimental data of the UA5, PHOBOS, UA1, P238, CDF, ALICE, and CMS Collaborations which present orderly from low to high energies. According to the distribution widths of different components, the values and some features of square speed of sound parameter cs2 for “participant” and “spectator” quark components are obtained. It is shown that the speed of sound for “participant” quark components agrees approximately with that for “spectator” quark components in the error ranges. The present work is useful for studying nucleus-nucleus collisions in the related energy range.

  17. [Effect of Silencing SET Gene on Acute Promyelocytic Leukemia NB4-R1 Cells].

    Science.gov (United States)

    Wang, Yuan; Zhang, Mei; He, Peng-Cheng; Qi, Jun; Liu, Yan-Feng; Zhu, Hua-Chao

    2016-02-01

    To investigate the effect of silencing SET gene on the biological characteristics of acute promyelocytic leukemia NB4-R1 cells. The expression vector of pGCSIL containing SET-shRNA were transfected into 293T cells by using other packaging plasmids. The supernatant of the 293T cells was harvested for lentivirus. The SET-shRNA lentiviral vector was transfected into acute promyelocytic leukemia NB4-R1 cells and a stably transfected cell line was established. Real-time quantitative PCR and Western blot were used to assay the silencing efficiency on SET gene and the expression of PP2A. The cell cycle distribution was tested by flow cytometry. The expression of SET in experimental group statistically decreased as compared with that of the control group. The expression of PP2A was obviously raised at the level of mRNA and protein. The percentage of NB4-R1 cells in G0/G1 phase significantly increased, while the percentage of cells in S phase significantly decreased. The silencing gene in acute promyelocytic leukemia NB4-R1 cells using SET-shRNA lentiviral vector can increase the expression of PP2A and interfere of the cell cycle in NB4-R1 cells. This study has laid a experimental base for targed therapy of patients with acute promyelocytic leukemia.

  18. Hematopoietic stem cell gene therapy for IFNγR1 deficiency protects mice from mycobacterial infections.

    Science.gov (United States)

    Hetzel, Miriam; Mucci, Adele; Blank, Patrick; Nguyen, Ariane Hai Ha; Schiller, Jan; Halle, Olga; Kühnel, Mark-Philipp; Billig, Sandra; Meineke, Robert; Brand, Daniel; Herder, Vanessa; Baumgärtner, Wolfgang; Bange, Franz-Christoph; Goethe, Ralph; Jonigk, Danny; Förster, Reinhold; Gentner, Bernhard; Casanova, Jean-Laurent; Bustamante, Jacinta; Schambach, Axel; Kalinke, Ulrich; Lachmann, Nico

    2017-12-12

    Mendelian Susceptibility to Mycobacterial Disease (MSMD) is a rare primary immunodeficiency, characterized by severe infections caused by weakly virulent mycobacteria. Bi-allelic null mutations in genes encoding interferon gamma (IFNγ) receptor 1 or -2 (IFNGR1, IFNGR2) result in a life-threatening disease phenotype in early childhood. Recombinant IFNγ therapy is inefficient and hematopoietic stem cell transplantation (HSCT) has a poor prognosis. Thus, we developed a HSC gene therapy approach using lentiviral vectors expressing Ifnγr1 either constitutively or myeloid-specifically. Transduction of mouse Ifnγr1-/- HSCs led to stable IFNγR1 expression on macrophages, which rescued their cellular responses to IFNγ. As a consequence, genetically corrected HSC-derived macrophages were able to suppress T-cell activation and showed restored anti-mycobacterial activity against Mycobacterium avium and Mycobacterium bovis Bacillus-Calmette-Guérin (BCG) in vitro Transplantation of genetically corrected HSC into Ifnγr1-/- mice prior BCG infection prevented manifestations of severe BCG disease and maintained lung and spleen organ integrity, which was accompanied by a reduced mycobacterial burden in lung and spleen and a prolonged overall survival of transplanted animals. In summary, we demonstrate an HSC-based gene therapy approach for IFNγR1 deficiency, which protects mice from severe mycobacterial infections, thereby laying the foundation for a new therapeutic intervention in the corresponding human patients. Copyright © 2017 American Society of Hematology.

  19. Protein-Nanocrystal Conjugates Support a Single Filament Polymerization Model in R1 Plasmid Segregation

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Charina L.; Claridge, Shelley A.; Garner, Ethan C.; Alivisatos, A. Paul; Mullins, R. Dyche

    2008-07-15

    To ensure inheritance by daughter cells, many low-copy number bacterial plasmids, including the R1 drug-resistance plasmid, encode their own DNA segregation systems. The par operon of plasmid R1 directs construction of a simple spindle structure that converts free energy of polymerization of an actin-like protein, ParM, into work required to move sister plasmids to opposite poles of rod-shaped cells. The structures of individual components have been solved, but little is known about the ultrastructure of the R1 spindle. To determine the number of ParM filaments in a minimal R1 spindle, we used DNA-gold nanocrystal conjugates as mimics of the R1 plasmid. Wefound that each end of a single polar ParM filament binds to a single ParR/parC-gold complex, consistent with the idea that ParM filaments bind in the hollow core of the ParR/parC ring complex. Our results further suggest that multifilament spindles observed in vivo are associated with clusters of plasmidssegregating as a unit.

  20. Structure of IL-22 Bound to Its High-Affinity IL-22R1 Chain

    Energy Technology Data Exchange (ETDEWEB)

    Jones, B.C.; Logsdon, N.J.; Walter, M.R. (UAB)

    2008-09-29

    IL-22 is an IL-10 family cytokine that initiates innate immune responses against bacterial pathogens and contributes to immune disease. IL-22 biological activity is initiated by binding to a cell-surface complex composed of IL-22R1 and IL-10R2 receptor chains and further regulated by interactions with a soluble binding protein, IL-22BP, which shares sequence similarity with an extracellular region of IL-22R1 (sIL-22R1). IL-22R1 also pairs with the IL-20R2 chain to induce IL-20 and IL-24 signaling. To define the molecular basis of these diverse interactions, we have determined the structure of the IL-22/sIL-22R1 complex. The structure, combined with homology modeling and surface plasmon resonance studies, defines the molecular basis for the distinct affinities and specificities of IL-22 and IL-10 receptor chains that regulate cellular targeting and signal transduction to elicit effective immune responses.

  1. General requirements for protein secretion by the F-like conjugation system R1.

    Science.gov (United States)

    Lang, Silvia; Zechner, Ellen L

    2012-03-01

    Bacterial conjugation disseminates genes among bacteria via a process requiring direct cell contact. The cell envelope spanning secretion apparatus involved belongs to the type IV family of bacterial secretion systems, which transport protein as well as nucleoprotein substrates. This study aims to understand mechanisms leading to the initiation of type IV secretion using conjugative plasmid paradigm R1. We analyze the general requirements for plasmid encoded conjugation proteins and DNA sequence within the origin of transfer (oriT) for protein secretion activity using a Cre recombinase reporter system. We find that similar to conjugative plasmid DNA strand transfer, activation of the R1 system for protein secretion depends on binding interactions between the multimeric, ATP-binding coupling protein and the R1 relaxosome including an intact oriT. Evidence for DNA independent protein secretion was not found. Copyright © 2012 Elsevier Inc. All rights reserved.

  2. Biohydrogen production from cellobiose in phenol and cresol-containing medium using Clostridium sp. R1

    Energy Technology Data Exchange (ETDEWEB)

    Ho, Kuo-Ling; Chen, Yu-You; Lee, Duu-Jong [Department of Chemical Engineering, National Taiwan University, Taipei 10617 (China)

    2010-10-15

    Cellobiose fermentation in batch test using an isolated strain, Clostridium sp. R1, was investigated. The Clostridium sp. R1 achieved a maximum hydrogen yield of 3.5 mol H{sub 2} mol{sup -1} cellobiose at pH 6 and 30 C, higher than most yields reported in literature. This strain can generate hydrogen from a number of carbohydrates, including galactose, glucose, mannose, maltose, sucrose, and starch. This strain can also convert cellobiose to hydrogen in the presence of toxic phenol or cresol. The inhibition effects of phenolic compounds on strain R1 activity followed phenol >p-cresol >o-cresol >m-cresol. Co-culturing with another strain, Clostridium butyricum, can co-degrade some of the phenol as substrates. The new isolated strain can yield hydrogen from phenol-containing wastewaters. (author)

  3. Neutron Resonance Parameters of 238U and the Calculated Cross Sections from the Reich-Moore Analysis of Experimental Data in the Neutron Energy Range from 0 keV to 20 keV

    Energy Technology Data Exchange (ETDEWEB)

    Derrien, H

    2005-12-05

    The neutron resonance parameters of {sup 238}U were obtained from a SAMMY analysis of high-resolution neutron transmission measurements and high-resolution capture cross section measurements performed at the Oak Ridge Electron Linear Accelerator (ORELA) in the years 1970-1990, and from more recent transmission and capture cross section measurements performed at the Geel Linear Accelerator (GELINA). Compared with previous evaluations, the energy range for this resonance analysis was extended from 10 to 20 keV, taking advantage of the high resolution of the most recent ORELA transmission measurements. The experimental database and the method of analysis are described in this report. The neutron transmissions and the capture cross sections calculated with the resonance parameters are compared with the experimental data. A description is given of the statistical properties of the resonance parameters and of the recommended values of the average parameters. The new evaluation results in a slight decrease of the effective capture resonance integral and improves the prediction of integral thermal benchmarks by 70 pcm to 200 pcm.

  4. 2-Heteroaryl Benzimidazole Derivatives as Melanin Concentrating Hormone Receptor 1 (MCH-R1) Antagonists

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Chae Jo; Kim, Jeong Young; Lee, Byung Ho; Oh, Kwangseok; Yi, Kyu Yang [Korea Research Institute of Chemical Technology, Daejeon (Korea, Republic of)

    2013-08-15

    A novel series of 2-heteroaryl substituted benzimidazole derivatives, containing the piperidinylphenyl acetamide group at the 1-position, were synthesized and evaluated as MCH-R1 antagonists. Extensive SAR investigation probing the effects of C-2 heteroaryl group led to the identification of 2-[2-(pyridin-3-yl)ethyl] analog 3o, which exhibits highly potent MCH-R1 binding activity with an IC{sub 50} value of 1 nM. This substance 3o also has low hERG binding activity, good metabolic stability, and favorable pharmacokinetic properties.

  5. Crystal structure of human cytomegalovirus IL-10 bound to soluble human IL-10R1

    OpenAIRE

    Jones, Brandi C.; Logsdon, Naomi J.; Josephson, Kristopher; Cook, Jennifer; Barry, Peter A.; Walter, Mark R.

    2002-01-01

    Human IL-10 (hIL-10) modulates critical immune and inflammatory responses by way of interactions with its high- (IL-10R1) and low-affinity (IL-10R2) cell surface receptors. Human cytomegalovirus exploits the IL-10 signaling pathway by expressing a functional viral IL-10 homolog (cmvIL-10), which shares only 27% sequence identity with hIL-10 yet signals through IL-10R1 and IL-10R2. To define the molecular basis of this virus–host interaction, we determined the 2.7-Å crysta...

  6. Dansyl chloride labeling of Pseudomonas aeruginosa treated with pyocin R1: change in permeability of the cell envelope.

    OpenAIRE

    Uratani, Y

    1982-01-01

    Pyocin R1, a bacteriocin of Pseudomonas aeruginosa, caused an increase in binding of fluorescent label, 1-dimethylaminonaphthalene-5-sulfonyl chloride (dansyl chloride), to sensitive cells. In pyocin R1-treated cells, cytoplasmic soluble proteins and crude ribosomes as well as cell envelopes were labeled by dansyl chloride. The amount of bound dye was proportional to the multiplicity of pyocin R1 and reached a maximal level at high multiplicity. In addition, pyocin R1 rapidly caused an increa...

  7. Beryllium irradiation element analysis in the IEA-R1m reactor; Analise do elemento de irradiacao de berilio no reator IEA-R1m

    Energy Technology Data Exchange (ETDEWEB)

    Ricci Filho, Walter

    1998-07-01

    The IEA-R1 reactor at IPEN-Sao Paulo has undergone a modernization to increase its operating power to 5 MW, in order to allow a more efficient production of the {sup 99} Mo radioisotope. An irradiation element made of Be was acquired for the reactor and studies have been carried out to determine its performance when compared to other irradiators available in the reactor namely, the water and graphite irradiation elements. The results obtained showed some advantages of the Beryllium irradiation element for producing {sup 99} Mo: the epithermal neutron flux in the Be irradiation element is approximately 22% greater than that in the graphite irradiation element and 12% greater than that of the water irradiation element; the neutron reaction rate in molybdenum wires inside in irradiation capsule filled with Mo O{sub 3} 10,6% greater them that in the water irradiation element in the same conditions; the negative reactivity introduced in the reactor by the Be irradiation element it substantially smaller than the those introduced by the other elements: -1636 pcm for the Be irradiator, -2977 for the water irradiator and -2568 pcm for the graphite irradiator. It is possible to conclude that the production of the {sup 99} Mo radioisotope with the Be irradiation element can be increased by 12 to 15% in the IEA-R1m reactor. It also requires less fuel for the reactor operation due to the smaller negative reactivity introduced in the reactor core. (author)

  8. 26 CFR 31.3402(r)-1 - Withholding on distributions of Indian gaming profits to tribal members.

    Science.gov (United States)

    2010-04-01

    ... profits to tribal members. 31.3402(r)-1 Section 31.3402(r)-1 Internal Revenue INTERNAL REVENUE SERVICE... TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3402(r)-1 Withholding on distributions of Indian gaming profits to tribal members. (a) (1) General rule. Section 3402(r...

  9. Two Mutations Preventing PDZ-Protein Interactions of GluR1 Have Opposite Effects on Synaptic Plasticity

    Science.gov (United States)

    Boehm, Jannic; Ehrlich, Ingrid; Hsieh, Helen; Malinow, Roberto

    2006-01-01

    The regulated trafficking of GluR1 contributes significantly to synaptic plasticity, but studies addressing the function of the GluR1 C-terminal PDZ-ligand domain in this process have produced conflicting results. Here, we resolve this conflict by showing that apparently similar C-terminal mutations of the GluR1 PDZ-ligand domain result in…

  10. A novel echinocandin MIG0310 with anticandida activity from newly isolated Fusarium sp. strain MS-R1.

    Science.gov (United States)

    Masaphy, S

    2014-06-01

    To isolate and identify an anticandida compound from newly isolated Fusarium strain MS-R1 and characterization of its activity against standard and clinical strains of Candida. The fungal strain, Fusarium strain MS-R1, was isolated from soil. Molecular identification according to the internal transcribed spacer region of the rRNA gene sequence showed the strain to be strongly related to Fusarium brachygibbosum complex. Successive extractions of the active compound showed activity against Candida albicans, including clinical strains. Inhibition of a clinical strain of Candida tropicalis, but not Candida krusei and Candida glabrata, was also shown as tested by the broth microdilution assay. The compound was purified by liquid chromatography coupled with thin-layer chromatography and bioautography and characterized by nuclear magnetic resonance spectroscopy. It was confirmed to have the molecular formula C(48)H(66)O(18) and was identified as an echinocandin with a novel structure. A novel echinocandin-type antifungal metabolite, MIG0310, was isolated and characterized. This is a second echinocandin reported from a Fusarium species, indicating this genus to have wider range of echinocandin compounds. The new compound may lead to new anticandidal drugs, broadening the treatment opportunities for Candida species, including those that are resistant to the current antifungal drugs. © 2014 The Society for Applied Microbiology.

  11. Purification, characterization, and properties of an alkaline protease produced by Serratia marcescens S3-R1 inhabiting Korean ginseng rhizosphere.

    Science.gov (United States)

    Nam, Myoung Soo; Whang, Kyung Sook; Choi, Seong Hyun; Bae, Hyoung Churl; Kim, Yoo Kyeong; Park, Young W

    2013-12-01

    An alkaline protease produced by the Serratia marcescens S3-R1 which inhabits in the Korean ginseng rhizosphere was investigated. The purposes of this study were to characterize and purify the bacterial enzyme by four different purification steps: precipitation of enzyme fraction by ammonium sulfate, loading the enzyme pellets on a DEAE-Sepharose anion-exchange chromatograph, separation of the fraction containing enzyme activity by fast protein liquid Mono Q chromatography and identification of the single-band fraction by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, and then quantification of the single-band fraction by reverse-phase high-performance liquid chromatography. The molecular weight of the purified protease was estimated as 50 308 Da by matrix-assisted laser desorption ionization time-of-flight analysis. The N-terminal amino acid sequence of the protease was identified as Ala-Val-Thr-Ile-Glu-Asp-Ala-Val-Asp-Asp, and the enzyme belongs to the metalloprotease family. The optimal activities of the protease occurred at pH 7-9 and a temperature 40 °C. The ranges of pH and thermal stability of the enzyme were at 7-10 and 30-40 °C, respectively. The alkaline protease was successfully purified and characterized from the bacterium Serratia marcescens S3-R1, which has potential for industrial application, including milk protein hydrolysates. © 2013 Society of Chemical Industry.

  12. Interaction between umami peptide and taste receptor T1R1/T1R3.

    Science.gov (United States)

    Dang, Yali; Gao, Xinchang; Xie, Aiying; Wu, Xueqian; Ma, Fumin

    2014-12-01

    The umami taste receptor is a heterodimer composed of two members of the T1R taste receptor family: T1R1 and T1R3. The homology models of the ligand binding domains of the human umami receptor have been constructed based on crystallographic structures of the taste receptor of the central nervous system. Furthermore, the molecular simulations of the ligand binding domain show that the likely conformation was that T1R1 protein exists in the closed conformation, and T1R3 in the open conformation in the heterodimer. The molecular docking study of T1R1 and T1R3 in complex with four peptides, including Lys-Gly-Asp-Glu-Ser-Leu-Leu-Ala, Ser-Glu-Glu, G1u-Ser, and Asp-Glu-Ser, displayed that the amino acid residue of SER146 and Glu277 in T1R3 may play great roles in the synergism of umami taste. This docking result further validated the robustness of the model. In the paper, binding of umami peptide and the T1R1/T1R3 receptor was first described and the interaction is the base of umami activity theory.

  13. JESS-D-16-00657 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00657 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  14. JESS-D-16-00428 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00428 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  15. JESS-D-16-00405 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00405 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  16. JESS-D-16-00457 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00457 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  17. JESS-D-16-00485 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00485 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. New Fellows and Honorary Fellow. Posted on 1 January 2018.

  18. JESS-D-16-00170 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00170 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  19. Characterization of the putative replisome organizer of the lactococcal bacteriophage r1t

    NARCIS (Netherlands)

    Zuniga, M; Franke-Fayard, B; Venema, G; Kok, J; Nauta, A

    2002-01-01

    Analysis of the nucleotide sequence of the genome of the lactococcal bacteriophage r1t showed that it may encode at least two proteins involved in DNA replication. On the basis of its similarity with the G38P protein encoded by the Bacillus subtilis phage SPP1, the product of orf11 (Pro11) is

  20. JESS-D-16-00377 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00377 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  1. Isolation and characterization of the solvent-tolerant Bacillus cereus strain R1

    NARCIS (Netherlands)

    Matsumoto, M.; Bont, de J.A.M.; Isken, S.

    2002-01-01

    Toluene-tolerant gram-positive bacteria were isolated and identified to belong to the genus Bacillus. They grew in a medium containing yeast extract and in the presence of a separate phase of toluene or other hydrocarbons, but not when aliphatic alcohols were present. The isolate Bacillus cereus R1

  2. CUG-BP1 regulates RyR1 ASI alternative splicing in skeletal muscle atrophy.

    Science.gov (United States)

    Tang, Yinglong; Wang, Huiwen; Wei, Bin; Guo, Yuting; Gu, Lei; Yang, Zhiguang; Zhang, Qing; Wu, Yanyun; Yuan, Qi; Zhao, Gang; Ji, Guangju

    2015-11-04

    RNA binding protein is identified as an important mediator of aberrant alternative splicing in muscle atrophy. The altered splicing of calcium channels, such as ryanodine receptors (RyRs), plays an important role in impaired excitation-contraction (E-C) coupling in muscle atrophy; however, the regulatory mechanisms of ryanodine receptor 1 (RyR1) alternative splicing leading to skeletal muscle atrophy remains to be investigated. In this study we demonstrated that CUG binding protein 1 (CUG-BP1) was up-regulated and the alternative splicing of RyR1 ASI (exon70) was aberrant during the process of neurogenic muscle atrophy both in human patients and mouse models. The gain and loss of function experiments in vivo demonstrated that altered splicing pattern of RyR1 ASI was directly mediated by an up-regulated CUG-BP1 function. Furthermore, we found that CUG-BP1 affected the calcium release activity in single myofibers and the extent of atrophy was significantly reduced upon gene silencing of CUG-BP1 in atrophic muscle. These findings improve our understanding of calcium signaling related biological function of CUG-BP1 in muscle atrophy. Thus, we provide an intriguing perspective of involvement of mis-regulated RyR1 splicing in muscular disease.

  3. JESS-D-16-00571 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00571 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  4. JESS-D-16-00345 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00345 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Theory Of Evolution. Posted on 23 January 2018. Joint Statement by the ...

  5. Identifying the Proteins that Mediate the Ionizing Radiation Resistance of Deinococcus Radiodurans R1

    Energy Technology Data Exchange (ETDEWEB)

    Battista, John R

    2010-02-22

    The primary objectives of this proposal was to define the subset of proteins required for the ionizing radiation (IR) resistance of Deinococcus radiodurans R1, characterize the activities of those proteins, and apply what was learned to problems of interest to the Department of Energy.

  6. Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex

    Energy Technology Data Exchange (ETDEWEB)

    Logsdon, Naomi J.; Allen, Christopher E.; Rajashankar, Kanagalaghatta R.; Walter, Mark R. (Cornell); (UAB)

    2012-02-08

    Interleukin-20 (IL-20) is an IL-10-family cytokine that regulates innate and adaptive immunity in skin and other tissues. In addition to protecting the host from various external pathogens, dysregulated IL-20 signaling has been shown to contribute to the pathogenesis of human psoriasis. IL-20 signals through two cell-surface receptor heterodimers, IL-20R1-IL-20R2 and IL-22R1-IL-20R2. In this report, crystals of the IL-20-IL-20R1-IL-20R2 ternary complex have been grown from polyethylene glycol solutions. The crystals belonged to space group P4{sub 1}2{sub 1}2 or P4{sub 3}2{sub 1}2, with unit-cell parameters a = 111, c = 135 {angstrom}, and diffracted X-rays to 3 {angstrom} resolution. The crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54%.

  7. Coordinated movement of cytoplasmic and transmembrane domains of RyR1 upon gating.

    Directory of Open Access Journals (Sweden)

    Montserrat Samsó

    2009-04-01

    Full Text Available Ryanodine receptor type 1 (RyR1 produces spatially and temporally defined Ca2+ signals in several cell types. How signals received in the cytoplasmic domain are transmitted to the ion gate and how the channel gates are unknown. We used EGTA or neuroactive PCB 95 to stabilize the full closed or open states of RyR1. Single-channel measurements in the presence of FKBP12 indicate that PCB 95 inverts the thermodynamic stability of RyR1 and locks it in a long-lived open state whose unitary current is indistinguishable from the native open state. We analyzed two datasets of 15,625 and 18,527 frozen-hydrated RyR1-FKBP12 particles in the closed and open conformations, respectively, by cryo-electron microscopy. Their corresponding three-dimensional structures at 10.2 A resolution refine the structure surrounding the ion pathway previously identified in the closed conformation: two right-handed bundles emerging from the putative ion gate (the cytoplasmic "inner branches" and the transmembrane "inner helices". Furthermore, six of the identifiable transmembrane segments of RyR1 have similar organization to those of the mammalian Kv1.2 potassium channel. Upon gating, the distal cytoplasmic domains move towards the transmembrane domain while the central cytoplasmic domains move away from it, and also away from the 4-fold axis. Along the ion pathway, precise relocation of the inner helices and inner branches results in an approximately 4 A diameter increase of the ion gate. Whereas the inner helices of the K+ channels and of the RyR1 channel cross-correlate best with their corresponding open/closed states, the cytoplasmic inner branches, which are not observed in the K+ channels, appear to have at least as important a role as the inner helices for RyR1 gating. We propose a theoretical model whereby the inner helices, the inner branches, and the h1 densities together create an efficient novel gating mechanism for channel opening by relaxing two right

  8. Posible presencia de un gen R1 en germoplasma de Solanum tuberosum Grupo Phureja

    Directory of Open Access Journals (Sweden)

    Ballesteros Diana carolina

    2010-08-01

    Full Text Available Phytophthora infestans causa la gota, que es la enfermedad en la papa de mayor importancia económica a nivel mundial. La obtención de cultivares resistentes al patógeno es una estrategia necesaria para su control, por lo cual la identificación de genes de resistencia a P. infestans (Rpi es fundamental para apoyar los programas de mejoramiento. La introgresión de Rpi desde especies silvestres o nativas dentro de cultivares es una vía para desarrollar cultivares con resistencia. S. phureja tiene notables características culinarias y nutricionales, e igualmente ha sido identificada como una fuente de resistencia a la gota, lo cual la sitúa en una posición de interés desde el punto de vista de recurso genético con fines de mejoramiento. Se caracterizaron genotípicamente 88 accesiones de S. phureja con marcadores moleculares tipo SCAR, el gen R1 de resistencia a P. infestans, el gen candidato StAOS2 y un marcador tipo CAPS ligados a loci para resistencia a P. infestans en Solanum tuberosum. Se presentó polimorfismo en los marcadores Prp1 y R1. La amplificación del marcador R1 mostró el alelo de 1.400 pb, característico del gen R1 en 17 accesiones de la colección de S. phureja, lo cual sugiere que estas accesiones posiblemente podrían tener un gen homólogo al gen R1 identificado en S. demissum.

  9. Ghrelin receptor (GHS-R1A) agonists show potential as interventive agents during aging.

    Science.gov (United States)

    Smith, Roy G; Sun, Yuxiang; Jiang, Hong; Albarran-Zeckler, Rosie; Timchenko, Nikolai

    2007-11-01

    Administration of an orally active agonist (MK-0677) of the growth hormone secretagogue receptor (GHS-R1a) to elderly subjects restored the amplitude of endogenous episodic growth hormone (GH) release to that of young adults. Functional benefits include increased lean mass and bone density and modest improvements in strength. In old mice, a similar agonist partially restored function to the thymus and reduced tumor cell growth and metastasis. Treatment of old mice with the endogenous GHS-R1a agonist ghrelin restored a young liver phenotype. The mechanism involves inhibition of cyclin D3:cdk4/cdk6 activity and increased protein phosphatase-2A (PP2A) activity in liver nuclei, which stabilizes the dephosphorylated form of the transcription factor C/EBPalpha preventing the age-dependent formation of the C/EBPalpha-Rb-E2F4-Brm nuclear complex. By inhibiting formation of this complex, repression of E2F target genes is de-repressed and C/EBPalpha regulated expression of Pepck, a regulator of gluconeogenesis, is normalized, thereby restoring a young liver phenotype. In the brain, aging is associated with decline in dopamine function. We investigated the potential neuromodulatory role of GHS-R1a on dopamine action. Neurons were identified in the hippocampus, cortex, substantia nigra, and ventral tegmental areas that coexpressed GHS-R1a and dopamine receptor subtype-1 (D1R). Cell culture studies showed that, in the presence of ghrelin and dopamine, GHS-R and D1R form heterodimers, which modified G-protein signal transduction resulting in amplification of dopamine signaling. We speculate that aging is associated with deficient endogenous ghrelin signaling that can be rescued by intervention with GHS-R1a agonists to improve quality of life and maintain independence.

  10. Transport of UF{sub 6} in compliance with TS-R-1

    Energy Technology Data Exchange (ETDEWEB)

    Dekker, B.G. [World Nuclear Transport Inst., London (United Kingdom)

    2004-07-01

    The IAEA Regulations TS-R-1 (ST-1, Revised) 1996 Edition include requirements for packages containing uranium hexafluoride (UF{sub 6}); these are the first and only substance specific requirements in the IAEA Regulations. These requirements already have particularly affected, and will further affect, the transport of non-fissile and fissile excepted UF6 and the packages used for these transports. Non-fissile and fissile excepted UF{sub 6} (ASTM C 787) has been transported worldwide for decades in a safe and reliable manner, using internationally standardised packages. Under the auspices of the World Nuclear Transport Institute (WNTI), an industry working group has been evaluating the existing packages against the requirements in TS-R-1. As new requirements came into effect, there were new challenges for the use of these standard packages, including the free drop test and the thermal requirements. In close cooperation with the WNTI HEXT Industry Working Group, a consortium of UF6 producers/users has worked together on the design and development, testing and certification of technical solutions for modification and optimisation of the existing packages to comply with TS-R-1. This paper reviews the existing standard packages against the requirements in TS-R-1. The paper further provides an update to describe the enhancements to the standard packages that have been designed and developed recently. The paper also describes how these solutions have been tested and certified, as well as the status of implementation. Finally, the paper reviews the options that are available internationally to transport UF{sub 6} in compliance with TS-R-1.

  11. Lateral Thalamic Eminence: A Novel Origin for mGluR1/Lot Cells.

    Science.gov (United States)

    Ruiz-Reig, Nuria; Andrés, Belén; Huilgol, Dhananjay; Grove, Elizabeth A; Tissir, Fadel; Tole, Shubha; Theil, Thomas; Herrera, Eloisa; Fairén, Alfonso

    2017-05-01

    A unique population of cells, called "lot cells," circumscribes the path of the lateral olfactory tract (LOT) in the rodent brain and acts to restrict its position at the lateral margin of the telencephalon. Lot cells were believed to originate in the dorsal pallium (DP). We show that Lhx2 null mice that lack a DP show a significant increase in the number of mGluR1/lot cells in the piriform cortex, indicating a non-DP origin of these cells. Since lot cells present common developmental features with Cajal-Retzius (CR) cells, we analyzed Wnt3a- and Dbx1-reporter mouse lines and found that mGluR1/lot cells are not generated in the cortical hem, ventral pallium, or septum, the best characterized sources of CR cells. Finally, we identified a novel origin for the lot cells by combining in utero electroporation assays and histochemical characterization. We show that mGluR1/lot cells are specifically generated in the lateral thalamic eminence and that they express mitral cell markers, although a minority of them express ΔNp73 instead. We conclude that most mGluR1/lot cells are prospective mitral cells migrating to the accessory olfactory bulb (OB), whereas mGluR1+, ΔNp73+ cells are CR cells that migrate through the LOT to the piriform cortex and the OB. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  12. Neutrons characterization of the nuclear reactor Ian-R1 of Colombia; Caracterizacion de los neutrones del reactor nuclear IAN-R1 de Colombia

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez P, L. X.; Martinez O, S. A. [Universidad Pedagogica y Tecnologica de Colombia, Grupo de Fisica Nuclear Aplicada y Simulacion, Carretera Central del Norte Km. 1, Via Paipa, 150003 Tunja, Boyaca (Colombia); Vega C, H. R., E-mail: s.agustin.martinez@uptc.edu.co [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-08-15

    By means of Monte Carlo methods, with the code MCNPX, the neutron characteristics of the research nuclear reactor Ian-R1 of Colombia, in power off but with the neutrons source in their start position, have been valued. The neutrons spectra, the total flow and their average power were calculated in the irradiation spaces inside the graphite reflector, as well as in the cells with air. Also the spectra, the total flow and the absorbed dose were calculated in several places distributed along the radial shaft inside the water moderator. The neutrons total flow was also considered to the long of the axial shaft. The characteristics of the neutrons spectra vary depending on their position regarding the source and the material that surrounds to the cell where the calculation was made. (Author)

  13. Experimental study of the temperature distribution in the TRIGA IPR-R1 Brazilian research reactor; Investigacao experimental da distribuicao de temperaturas no reator nuclear de pesquisa TRIGA IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Amir Zacarias

    2005-07-01

    The TRIGA-IPR-R1 Research Nuclear Reactor has completed 44 years in operation in November 2004. Its initial nominal thermal power was 30 kW. In 1979 its power was increased to 100 kW by adding new fuel elements to the reactor. Recently some more fuel elements were added to the core increasing the power to 250 kW. The TRIGA-IPR-R1 is a pool type reactor with a natural circulation core cooling system. Although the large number of experiments had been carried out with this reactor, mainly on neutron activation analysis, there is not many data on its thermal-hydraulics processes, whether experimental or theoretical. So a number of experiments were carried out with the measurement of the temperature inside the fuel element, in the reactor core and along the reactor pool. During these experiments the reactor was set in many different power levels. These experiments are part of the CDTN/CNEN research program, and have the main objective of commissioning the TRIGA-IPR-R1 reactor for routine operation at 250 kW. This work presents the experimental and theoretical analyses to determine the temperature distribution in the reactor. A methodology for the calibration and monitoring the reactor thermal power was also developed. This methodology allowed adding others power measuring channels to the reactor by using thermal processes. The fuel thermal conductivity and the heat transfer coefficient from the cladding to the coolant were also experimentally valued. lt was also presented a correlation for the gap conductance between the fuel and the cladding. The experimental results were compared with theoretical calculations and with data obtained from technical literature. A data acquisition and processing system and a software were developed to help the investigation. This system allows on line monitoring and registration of the main reactor operational parameters. The experiments have given better comprehension of the reactor thermal-fluid dynamics and helped to develop numerical

  14. Influence of ionic radius on magnetic phase transition in R1-xSrxMnO3 perovskites

    Science.gov (United States)

    Sakthipandi, K.; Arunachalam, M.; Thamilmaran, P.; Sivabharathy, M.; Sankarrajan, S.

    2017-05-01

    R.1-xSrxMnO3 (R-Rare earth elements such as La, Pr, Sm and Nd) perovskite materials were prepared employing solid state reaction technique. On-line measurement of ultrasonic longitudinal velocity was carried out on the prepared perovskites over a wide range of temperature at a fundamental frequency of 5 MHz employing through transmission method. The phase transition temperature is explored based on the variation in observed anomaly in ultrasonic velocity. The obtained transition width and height at Curie temperature (i.e., transition from ferro to para magnetic phase) in the measured ultrasonic velocity were used to explore the physiochemical properties of the perovskites. The transition width and height of anomalous peak in measured ultrasonic velocity are also correlated with the ionic radius of the trivalent element. The results reveal that an increase in ionic radius of the trivalent elements leads to a decrease in double exchange interaction.

  15. Reinvestigation of the elementary chemical kinetics of the reaction C2H5(•) + HBr (HI) → C2H6 + Br(•) (I(•)) in the range 293-623 K and its implication on the thermochemical parameters of C2H5(•) free radical.

    Science.gov (United States)

    Leplat, N; Wokaun, A; Rossi, M J

    2013-11-14

    A reinvestigation of the absolute rate constants of the metathesis reactions C2H5• + HBr → C2H6 + Br• (R1) and C2H5• + HI → C2H6 + I• (R2) has been performed and led to the following Arrhenius expressions: k1 = 3.69(±0.95) × 10–11 exp(−10.62(±0.66)/RT), k2 = 1.20(±0.38) × 10–11 exp(−7.12(±1.059)/RT) in the temperature range 293–623 K (A/cm3 molecule–1 s–1, Ea/kJ mol–1). The study has been performed using a Knudsen reactor coupled to single-photon (VUV) photoionization mass spectrometer (SPIMS). Hydrocarbon free radicals have been generated externally before admission into the Knudsen reactor according to two different chemical schemes, enabling the generation of thermalized C2H5• free radicals. A minor correction to k1 and k2 for the wall loss of C2H5• (kw) has been applied throughout the temperature range. The obtained results are consistent regarding both the disappearance of C2H5• and the formation of closed shell products (n-C4H10, C2H4, C2H6), indicating that the chemical mechanism is largely understood and complete. Thermochemical parameters for C2H5• free radical resulting from the present kinetic measurements are discussed and point toward a slightly lower value for the standard heat of formation ΔfH298°(C2H5•) compared to some presently recommended values. On the basis of the present results and suitable data on the reverse reaction taken from the literature, we recommend ΔfH298°(C2H5•) = 117.3 ± 3.1 kJ/mol resulting from an average of “third law” evaluations using S298°(C2H5•) = 242.9 ± 4.6 J/K mol. The present work yields a standard heat of formation in satisfactory agreement with the results obtained by W. Tsang (ΔfH298°(C2H5•) = 119 ± 2 kJ/mol) despite using two very different experimental techniques.

  16. Crystal Structure of Human Interferon-[lamda]1 in Complex with Its High-Affinity Receptor Interferon-[lamda]R1

    Energy Technology Data Exchange (ETDEWEB)

    Miknis, Zachary; Magracheva, Eugenia; Li, Wei; Zdanov, Alexander; Kotenko, Sergei V.; Wlodawer, Alexander (NJMS); (NCI)

    2010-12-01

    Interferon (IFN)-{lambda}1 [also known as interleukin (IL)-29] belongs to the recently discovered group of type III IFNs. All type III IFNs initiate signaling processes through formation of specific heterodimeric receptor complexes consisting of IFN-{lambda}R1 and IL-10R2. We have determined the structure of human IFN-{lambda}1 complexed with human IFN-{lambda}R1, a receptor unique to type III IFNs. The overall structure of IFN-{lambda}1 is topologically similar to the structure of IL-10 and other members of the IL-10 family of cytokines. IFN-{lambda}R1 consists of two distinct domains having fibronectin type III topology. The ligand-receptor interface includes helix A, loop AB, and helix F on the IFN site, as well as loops primarily from the N-terminal domain and inter-domain hinge region of IFN-{lambda}R1. Composition and architecture of the interface that includes only a few direct hydrogen bonds support an idea that long-range ionic interactions between ligand and receptor govern the process of initial recognition of the molecules while hydrophobic interactions finalize it.

  17. Differential radio-tolerance of nutrition-induced morphotypes of Deinococcus radiodurans R1.

    Science.gov (United States)

    Shukla, Sudhir K; Sankar, G Gomathi; Paraneeiswaran, A; Rao, T Subba

    2014-02-01

    Deinococcus radiodurans R1 is a highly radio-tolerant bacterium. Depending on the nutrient availability D. radiodurans R1 exists in three morphologies viz. monococcal, diplococcal and tetracoccal. In this study, we examined whether nutrition-induced morphotypes of D. radiodurans showed similar DNA damage upon gamma radiation exposure. Total DNA damage after radiation exposure was estimated by comparing percent double-strand breaks (DSBs) in genomic DNA. It was found that all three morphotypes exhibited different radiation tolerances which were also dependent on the radiation dose given. Monococcal forms were found to be most radio-tolerant at most of the tested radiation doses. Results showed that these nutrient-starved-condition induced morphotypes show lesser DNA DSBs upon irradiation, hence show higher radio-tolerance.

  18. DNA microarray fabrication of deinococcus radiodurans R1 for a global gene expression profiling

    Energy Technology Data Exchange (ETDEWEB)

    Joe, Min Ho; Lim, Sang Young; Jung, Sun Wook; Choi, Young Ji; Lee, Bo Young; Song, Bu Sub; Jung, Jin Woo; Kim, Dong Ho [Radiation Research Center for Biotechnology, Korea Atomic Energy Research Institute, Jeongeup (Korea, Republic of); Chae, Sung Hwa [Research Institute of GnC BIO Co. Ltd., Daejeon (Korea, Republic of)

    2008-05-15

    DNA microarray technology is an extraordinarily powerful technique, which has revolutionized the world of science and technology more profoundly than any other recent major advance. In this study, we fabricated a DNA microarray chip of Deinococcus radiodurans R1 to get the comprehensive information of this organism responding to diverse conditions. Among 3,187 open reading frames (ORFs), the PCR products representing 3,116 ORFs were obtained by using polymerase chain reactions (PCRs) with gene-specific primer sets. The PCR products were spotted in duplicate onto a slide and immobilized successfully. Hybridization experiment showed an enough sensitivity and reliability of the DNA chip to analyze global gene expression of D. radiodurans R1. Finally, a clone library of the PCR products was constructed for convenience in later use. The success rate of the library construction was about 95%, meaning that 3,031 ORFs were cloned into a vector.

  19. Repression of PLA2R1 by c-MYC and HIF-2alpha promotes cancer growth.

    Science.gov (United States)

    Vindrieux, David; Devailly, Guillaume; Augert, Arnaud; Le Calvé, Benjamin; Ferrand, Mylène; Pigny, Pascal; Payen, Léa; Lambeau, Gérard; Perrais, Michael; Aubert, Sébastien; Simonnet, Hélène; Dante, Robert; Bernard, David

    2014-02-28

    Loss of secreted phospholipase A2 receptor (PLA2R1) has recently been found to render human primary cells more resistant to senescence whereas increased PLA2R1 expression is able to induce cell cycle arrest, cancer cell death or blockage of cancer cell transformation in vitro, suggesting that PLA2R1 displays tumor suppressive activities. Here we report that PLA2R1 expression strongly decreases in samples of human renal cell carcinoma (RCC). Knockdown of PLA2R1 increases renal cancer cell tumorigenicity supporting a role of PLA2R1 loss to promote in vivo RCC growth. Most RCC result from Von Hippel-Lindau (VHL) tumor suppressor loss-of-function and subsequent gain-of-function of the oncogenic HIF-2alpha/c-MYC pathway. Here, by genetically manipulating VHL, HIF-2alpha and c-MYC, we demonstrate that loss of VHL, stabilization of HIF-2alpha and subsequent increased c-MYC activity, binding and transcriptional repression, through induction of PLA2R1 DNA methylation closed to PLA2R1 transcriptional start site, results in decreased PLA2R1 transcription. Our results describe for the first time an oncogenic pathway leading to PLA2R1 transcriptional repression and the importance of this repression for tumor growth.

  20. Core calculations for the upgrading of the IEA-R1 research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Adimir dos; Perrotta, Jose A.; Bastos, Jose Luis F.; Yamaguchi, Mitsuo; Umbehaun, Pedro E. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mail: asantos@net.ipen.br; perrotta@net.ipen.br; mitsuo@net.ipen.br

    1998-07-01

    The IEA-R1 Research Reactor is a multipurpose reactor. It has been used for basic and applied research in the nuclear area, training and radioisotopes production since 1957. In 1995, the Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP) took the decision to modernize and upgrade the power from 2 to 5 MW and increase the operational cycle. This work presents the design requirements and the calculations effectuated to reach this goal. (author)

  1. JESS-D-16-00082 R1.pdf | forthcoming | jess | Volumes | public ...

    Indian Academy of Sciences (India)

    Home; public; Volumes; jess; forthcoming; JESS-D-16-00082 R1.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. 83rd Annual Meeting. Posted on 25 October 2017. 3 - 5 November 2017 ...

  2. HCN observations of comets C/2013 R1 (Lovejoy) and C/2014 Q2 (Lovejoy)

    Science.gov (United States)

    Wirström, E. S.; Lerner, M. S.; Källström, P.; Levinsson, A.; Olivefors, A.; Tegehall, E.

    2016-04-01

    HCN J = 1-0 emission from the long-period comet C/2013 R1 (Lovejoy) was observed from the Onsala Space Observatory on multiple occasions during the month before its perihelion passage on December 22, 2013. We report detections for seven different dates, spanning heliocentric distances (Rh) decreasing from 0.94 to 0.82 au. Estimated HCN production rates are generally higher than previously reported for the same time period, but the implied increase in production rate with heliocentric distance, QHCN ∝ Rh-3.2, represent well the overall documented increase since it was first observed at Rh = 1.35. The implied mean HCN abundance relative to water in R1 Lovejoy is 0.2%. We also report on a detection of HCN with the new 3 mm receiver system at Onsala Space Observatory in comet C/2014 Q2 (Lovejoy) on January 14, 2015, when its heliocentric distance was 1.3 au. Relative to comet C/2013 R1 (Lovejoy), the HCN production rate of C/2014 Q2 (Lovejoy) was more than 5 times higher at similar heliocentric distances, and the implied HCN abundance relative to water 0.09%.

  3. AHR prevents human IL-1R1hi ILC3 differentiation to natural killer cells

    Science.gov (United States)

    Hughes, Tiffany; Briercheck, Edward L.; Freud, Aharon G.; Trotta, Rossana; McClory, Susan; Scoville, Steven D.; Keller, Karen; Deng, Youcai; Cole, Jordan; Harrison, Nicholas; Mao, Charlene; Zhang, Jianying; Benson, Don M.; Yu, Jianhua; Caligiuri, Michael A.

    2014-01-01

    SUMMARY Accumulating evidence indicates that human natural killer (NK) cells develop in secondary lymphoid tissue (SLT) through a so-called “stage 3” developmental intermediate minimally characterized by a CD34-CD117+CD94- immunophenotype that lacks mature NK cell function. This stage 3 population is heterogeneous, potentially composed of functionally distinct innate lymphoid cell (ILC) types that includes interleukin-1 receptor (IL-1R1) positive, IL-22-producing ILC3s. Whether human ILC3s are developmentally related to NK cells is a subject of ongoing investigation. Here we show that antagonism of the aryl hydrocarbon receptor (AHR) or silencing of AHR gene expression promotes differentiation of tonsillar IL-22-producing IL-1R1hi human ILC3s to CD56brightCD94+ IFN-gamma-producing cytolytic mature NK cells expressing eomesodermin (EOMES) and T-Box Protein 21 (TBX21 or TBET). Hence, AHR is a transcription factor that prevents human IL-1R1hi ILC3s from differentiating into NK cells. PMID:24953655

  4. Structurally simple azo based chromogenic R1 for the selective sensing of cyanide ion in aqueous medium

    Science.gov (United States)

    Kalpana, Palanisamy; Suganya, Sivalingam; Velmathi, Sivan

    2017-01-01

    Structurally simple azo linked Schiff base R1 was synthesized and characterized using IR, 1H NMR and mass spectroscopic techniques. The selective sensing of cyanide anion over other anions such as fluoride, chloride, bromine, iodide, acetate, nitrate, hydrogen sulphate and dihydrogenphosphate was revealed by naked-eye color change and UV-vis spectra. Addition of CN- ions to the R1 showed a dramatic change in color from pale yellow to intense yellow along with the formation of a new band at 415 nm in the absorption spectrum even in 100% aqueous medium. The interaction between R1 and cyanide was also investigated using 1H NMR titration study. The R1 showed limit of detection (LOD) up to micromolar level at 2.72 × 10- 6 M. Job's plot reveals the existing binding mode of R1 and CN- ion in molar ratio of 1:1 (R1:CN-).

  5. Correlation of receptor occupancy of metabotropic glutamate receptor subtype 1 (mGluR1) in mouse brain with in vivo activity of allosteric mGluR1 antagonists.

    Science.gov (United States)

    Suzuki, Gentaroh; Kawagoe-Takaki, Hiroko; Inoue, Takao; Kimura, Toshifumi; Hikichi, Hirohiko; Murai, Takashi; Satow, Akio; Hata, Mikiko; Maehara, Shunsuke; Ito, Satoru; Kawamoto, Hiroshi; Ozaki, Satoshi; Ohta, Hisashi

    2009-07-01

    The aim of this study was to clarify the relationship between receptor occupancy and in vivo pharmacological activity of mGluR1 antagonists. The tritiated mGluR1-selective allosteric antagonist [(3)H]FTIDC (4-[1-(2-fluoropyridin-3-yl)-5-methyl-1H-1,2,3-triazol-4-yl]-N-isopropyl-N-methyl-3,6-dihydropyridine-1(2H)-carboxamide) was identified as a radioligand having high affinity for mGluR1-expressing CHO cells (K(D) = 2.1 nM) and mouse cerebellum (K(D) = 3.7 nM). [(3)H]FTIDC bound to mGluR1 was displaced by structurally unrelated allosteric antagonists, suggesting there is a mutual binding pocket shared with different allosteric antagonists. The binding specificity of [(3)H]FTIDC for mGluR1 in brain sections was demonstrated by the lack of significant binding to brain sections prepared from mGluR1-knockout mice. Ex vivo receptor occupancy with [(3)H]FTIDC revealed that the receptor occupancy level by FTIDC correlated well with FTIDC dosage and plasma concentration. Intracerebroventricular administration of (S)-3,5-dihydroxyphenylglycine is known to elicit face washing behavior that is mainly mediated by mGluR1. Inhibition of this behavioral change by FTIDC correlated with the receptor occupancy level of mGluR1 in the brain. A linear relationship between the receptor occupancy and in vivo activity was also demonstrated using structurally diverse mGluR1 antagonists. The receptor occupancy assays could help provide guidelines for selecting appropriate doses of allosteric mGluR1 antagonist for examining the function of mGluR1 in vivo.

  6. A practical method to calculate the R1 index of waste-to-energy facilities.

    Science.gov (United States)

    Viganò, Federico

    2018-03-01

    According to Directive 98/2008/EC, the operation carried out by an incinerator of Municipal Solid Waste (MSW) is classified either as energy recovery (R1) or as disposal (D10) depending on the result achieved by the application of the R1 formula. In 2011 the DG Environment of the European Commission (EC) issued some non-binding guidelines on the interpretation of such a formula that clarified many aspects related to its application. A point not fully clarified by the EC guidelines is the determination of the energy contained in the treated waste (E W ). For this term of the formula, reference is made to the indirect method for the calculation of boiler thermal efficiency, as defined by the norm EN 12952-15. However, the application of such a norm to an entire year of operation of a Waste-to-Energy (WtE) boiler is not immediate. Therefore, a practical method for the calculation of the E W term has been developed in the framework of a collaboration between the MatER Study Centre and the Lombardy Region (Italy). The method is based on: (i) the identification of the most reliable data available from the Distributed Control System (DCS) of the plant; (ii) the definition of a control volume around the boiler(s) also based on the availability of data; (iii) the closure of the mass balance for such a control volume; (iv) the energy balance of the same control volume that gives, thus, the E W term of the R1 formula. The method has been applied in 2015-2016 to nine plants, generating a number of interesting data reported and discussed in this work, such as R1 index values, Lower Heating Values (LHV) of the treated wastes, main sources of energy losses in WtE boilers, etc. For one case study, discussed in detail in this work, the law of propagation of uncertainties has been applied according to the ISO/IEC Guide 98-3, leading to the assessment of the accuracy of the method, which resulted in ±2.4% with a confidence level of circa 95%. Copyright © 2017 Elsevier Ltd. All

  7. BDNF activates mTOR to regulate GluR1 expression required for memory formation.

    Directory of Open Access Journals (Sweden)

    Leandro Slipczuk

    Full Text Available BACKGROUND: The mammalian target of Rapamycin (mTOR kinase plays a key role in translational control of a subset of mRNAs through regulation of its initiation step. In neurons, mTOR is present at the synaptic region, where it modulates the activity-dependent expression of locally-translated proteins independently of mRNA synthesis. Indeed, mTOR is necessary for different forms of synaptic plasticity and long-term memory (LTM formation. However, little is known about the time course of mTOR activation and the extracellular signals governing this process or the identity of the proteins whose translation is regulated by this kinase, during mnemonic processing. METHODOLOGY/PRINCIPAL FINDINGS: Here we show that consolidation of inhibitory avoidance (IA LTM entails mTOR activation in the dorsal hippocampus at the moment of and 3 h after training and is associated with a rapid and rapamycin-sensitive increase in AMPA receptor GluR1 subunit expression, which was also blocked by intra-hippocampal delivery of GluR1 antisense oligonucleotides (ASO. In addition, we found that pre- or post-training administration of function-blocking anti-BDNF antibodies into dorsal CA1 hampered IA LTM retention, abolished the learning-induced biphasic activation of mTOR and its readout, p70S6K and blocked GluR1 expression, indicating that BDNF is an upstream factor controlling mTOR signaling during fear-memory consolidation. Interestingly, BDNF ASO hindered LTM retention only when given into dorsal CA1 1 h after but not 2 h before training, suggesting that BDNF controls the biphasic requirement of mTOR during LTM consolidation through different mechanisms: an early one involving BDNF already available at the moment of training, and a late one, happening around 3 h post-training that needs de novo synthesis of this neurotrophin. CONCLUSIONS/SIGNIFICANCE: IN CONCLUSION, OUR FINDINGS DEMONSTRATE THAT: 1 mTOR-mediated mRNA translation is required for memory consolidation during

  8. Crystallization and preliminary X-ray diffraction studies of the carbohydrate-recognition domain of SIGN-R1, a receptor for microbial polysaccharides and sialylated antibody on splenic marginal zone macrophages.

    Science.gov (United States)

    Silva-Martin, Noella; Schauer, Joseph D; Park, Chae Gyu; Hermoso, Juan A

    2009-12-01

    SIGN-R1, or CD209b, is a mouse C-type lectin receptor that is expressed at high levels on macrophages in lymphoid tissues, especially within the marginal zone of the spleen. SIGN-R1 can bind and mediate the uptake of various microbial polysaccharides, including dextrans, lipopolysaccharides and pneumococcal capsular polysaccharides. It has been shown that SIGN-R1 mediates the clearance of encapsulated pneumococcus, complement fixation via binding C1q independent of antibody and innate resistance to pneumococcal infection. Recently, SIGN-R1 has also been demonstrated to bind sialylated antibody and mediate its activity to suppress autoimmunity. The carbohydrate-recognition domain (CRD) of SIGN-R1 has been cloned and overexpressed in a soluble secretory form in mammalian Chinese hamster ovary (CHO) cells. The CRD protein of SIGN-R1 was purified from CHO cell-culture supernatant and concentrated for crystallization using the hanging-drop vapour-diffusion method at 291 K. Crystals grew from a mixture of 2 M ammonium sulfate in 0.1 M bis-tris pH 5.5. Single crystals, which belonged to the monoclinic space group C2 with unit-cell parameters a = 146.72, b = 92.77, c = 77.06 A, beta = 121.66 degrees , allowed the collection of a full X-ray data set to a maximum resolution of 1.87 A.

  9. Cartilage quality in rheumatoid arthritis: comparison of T2* mapping, native T1 mapping, dGEMRIC, {delta}R1 and value of pre-contrast imaging

    Energy Technology Data Exchange (ETDEWEB)

    Buchbender, Christian; Scherer, Axel; Kroepil, Patric; Quentin, Michael; Reichelt, Dorothea C.; Lanzman, Rotem S.; Mathys, Christian; Blondin, Dirk; Wittsack, Hans-Joerg; Antoch, Gerald; Miese, Falk [University Duesseldorf, Department of Diagnostic and Interventional Radiology, Medical Faculty, Duesseldorf (Germany); Koerbl, Birthe [Heinrich-Heine-University, Department of Endocrinology, Diabetology and Rheumatology, Medical Faculty, Duesseldorf (Germany); Heinrich-Heine-University, Leibniz Centre for Diabetes Research, Institute of Biometrics and Epidemiology, German Diabetes Centre, Duesseldorf (Germany); Bittersohl, Bernd; Zilkens, Christoph [Heinrich-Heine-University, Department of Orthopaedics, Medical Faculty, Duesseldorf (Germany); Hofer, Matthias [Heinrich-Heine-University, Medical Education Group, Medical School, Duesseldorf (Germany); Schneider, Matthias; Ostendorf, Benedikt [Heinrich-Heine-University, Department of Endocrinology, Diabetology and Rheumatology, Medical Faculty, Duesseldorf (Germany)

    2012-06-15

    To prospectively evaluate four non-invasive markers of cartilage quality - T2* mapping, native T1 mapping, dGEMRIC and {delta}R1 - in healthy volunteers and rheumatoid arthritis (RA) patients. Cartilage of metacarpophalangeal (MCP) joints II were imaged in 28 consecutive subjects: 12 healthy volunteers [9 women, mean (SD) age 52.67 (9.75) years, range 30-66] and 16 RA patients with MCP II involvement [12 women, mean (SD) age 58.06 (12.88) years, range 35-76]. Sagittal T2* mapping was performed with a multi-echo gradient-echo on a 3 T MRI scanner. For T1 mapping the dual flip angle method was applied prior to native T1 mapping and 40 min after gadolinium application (delayed gadolinium-enhanced MRI of cartilage, dGEMRIC, T1{sub Gd}). The difference in the longitudinal relaxation rate induced by gadolinium ({delta}R1) was calculated. The area under the receiver operating characteristic curve (AROC) was used to test for differentiation of RA patients from healthy volunteers. dGEMRIC (AUC 0.81) and {delta}R1 (AUC 0.75) significantly differentiated RA patients from controls. T2* mapping (AUC 0.66) and native T1 mapping (AUC 0.66) were not significantly different in RA patients compared to controls. The data support the use of dGEMRIC for the assessment of MCP joint cartilage quality in RA. T2* and native T1 mapping are of low diagnostic value. Pre-contrast T1 mapping for the calculation of {delta}R1 does not increase the diagnostic value of dGEMRIC. (orig.)

  10. Structural evaluation of IEA-R1 primary system pump nozzles

    Energy Technology Data Exchange (ETDEWEB)

    Fainer, Gerson; Faloppa, Altair A.; Oliveira, Carlos A. de; Mattar Neto, Miguel, E-mail: gfainer@ipen.br, E-mail: afaloppa@ipen.br, E-mail: calberto@ipen.br, E-mail: mmattar@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2017-11-01

    The IEA-R1 pumps of the primary coolant system may be required to withstand design and operational conditions. IEA-R1 nuclear research reactor is an open pool type reactor operated by IPEN since 1957. The reactor can be operated up to 5MW heating power since it was upgraded in a modernization program conducted by IPEN. The primary coolant system is composed by the piping system, decay tank, two heat pumps and two heat exchangers. In the latest arrangement upgrade of the primary system, conducted in 2014 as part of an aging management program, a partial replacement of the coolant piping and total replacement of piping and pump supports were done. As consequence, reviewed loads in the pump nozzles were obtained demanding a new evaluation of them. The aim of this report is to present the structural evaluation of the pump nozzles, considering the new loads coming from the new piping layout, according to: API 610 code verification, Supplier loads and structural analysis applying finite element method, by using the ANSYS computer program, regarding ASME VIII Div 1 & 2 recommendations. (author)

  11. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  12. Practical considerations for investigation of protein conformational dynamics by 15N R 1ρ relaxation dispersion.

    Science.gov (United States)

    Walinda, Erik; Morimoto, Daichi; Shirakawa, Masahiro; Sugase, Kenji

    2017-03-01

    It is becoming increasingly apparent that proteins are not static entities and that their function often critically depends on accurate sampling of multiple conformational states in aqueous solution. Accordingly, the development of methods to study conformational states in proteins beyond their ground-state structure ("excited states") has crucial biophysical importance. Here we investigate experimental schemes for optimally probing chemical exchange processes in proteins on the micro- to millisecond timescale by 15N R 1ρ relaxation dispersion. The schemes use selective Hartmann-Hahn cross-polarization (CP) transfer for excitation, and derive peak integrals from 1D NMR spectra (Korzhnev et al. in J Am Chem Soc 127:713-721, 2005; Hansen et al. in J Am Chem Soc 131:3818-3819, 2009). Simulation and experiment collectively show that in such CP-based schemes care has to be taken to achieve accurate suppression of undesired off-resonance coherences, when using weak spin-lock fields. This then (i) ensures that relaxation dispersion profiles in the absence of chemical exchange are flat, and (ii) facilitates extraction of relaxation dispersion profiles in crowded regions of the spectrum. Further improvement in the quality of the experimental data is achieved by recording the free-induction decays in an interleaved manner and including a heating-compensation element. The reported considerations will particularly benefit the use of CP-based R 1ρ relaxation dispersion to analyze conformational exchange processes in larger proteins, where resonance line overlap becomes the main limiting factor.

  13. Upper Campanian-Maastrichtian chronostratigraphy of the Skælskør-1 core, Denmark

    DEFF Research Database (Denmark)

    Thibault, Nicolas Rudolph; Anderskouv, Kresten; Bjerager, Morten

    2015-01-01

    The lithostratigraphy, calcareous nannofossil biostratigraphy, carbon- and oxygen-isotope stratigraphy and gamma-ray profile are presented for the Skælskør-1 core, eastern Denmark. The correlation of carbon isotopes to Gubbio (Italy) and ODP Site 762C (Indian Ocean) provides the chronostratigrahi......The lithostratigraphy, calcareous nannofossil biostratigraphy, carbon- and oxygen-isotope stratigraphy and gamma-ray profile are presented for the Skælskør-1 core, eastern Denmark. The correlation of carbon isotopes to Gubbio (Italy) and ODP Site 762C (Indian Ocean) provides......-Maastrichtian interval by combining carbon-isotope and gamma-ray variations. Significant dissimilarities in the gamma-ray profiles of the Danish Basin cores preclude the sole use of this tool for basin-scale correlations. Bulk oxygen-isotopes and semi-quantitative abundance changes in the warm-water calcareous...... nannofossil Watznaueria barnesiae and the cool-water Kamptnerius magnificus highlight the following past changes in sea-surface temperatures (SSTs): relatively warm late Campanian SSTs, cooling across the Campanian-Maastrichtian boundary and through the early Maastrichtian, warming across the early...

  14. Dansyl chloride labeling of Pseudomonas aeruginosa treated with pyocin R1: change in permeability of the cell envelope.

    Science.gov (United States)

    Uratani, Y

    1982-01-01

    Pyocin R1, a bacteriocin of Pseudomonas aeruginosa, caused an increase in binding of fluorescent label, 1-dimethylaminonaphthalene-5-sulfonyl chloride (dansyl chloride), to sensitive cells. In pyocin R1-treated cells, cytoplasmic soluble proteins and crude ribosomes as well as cell envelopes were labeled by dansyl chloride. The amount of bound dye was proportional to the multiplicity of pyocin R1 and reached a maximal level at high multiplicity. In addition, pyocin R1 rapidly caused an increase in fluorescence intensity of the hydrophobic probes N-phenyl-1-naphthylamine, pyrene, and perylene, which were mixed with cells. These results show that pyocin R1 damages locally a cell envelope barrier to hydrophobic solutes and allows dyes to penetrate into the intracellular space across the barrier. PMID:6799489

  15. Two Distinct Determinants of Ligand Specificity in T1R1/T1R3 (the Umami Taste Receptor)*

    OpenAIRE

    Toda, Yasuka; Nakagita, Tomoya; Hayakawa, Takashi; Okada, Shinji; Narukawa, Masataka; Imai, Hiroo; Ishimaru, Yoshiro; Misaka, Takumi

    2013-01-01

    Umami taste perception in mammals is mediated by a heteromeric complex of two G-protein-coupled receptors, T1R1 and T1R3. T1R1/T1R3 exhibits species-dependent differences in ligand specificity; human T1R1/T1R3 specifically responds to l-Glu, whereas mouse T1R1/T1R3 responds more strongly to other l-amino acids than to l-Glu. The mechanism underlying this species difference remains unknown. In this study we analyzed chimeric human-mouse receptors and point mutants of T1R1/T1R3 and identified 1...

  16. Optimization of the irradiation beam in the BNCT research facility at IEA-R1 reactor; Otimizacao do feixe de irradiacao na instalacao para estudos em BNCT junto ao reator IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Vinicius Alexandre de

    2014-07-01

    Boron Neutron Capture Therapy (BNCT) is a radiotherapeutic technique for the treatment of some types of cancer whose useful energy comes from a nuclear reaction that occurs when thermal neutron impinges upon a Boron-10 atom. In Brazil there is a research facility built along the beam hole number 3 of the IEA-R1 research reactor at IPEN, which was designed to perform BNCT research experiments. For a good performance of the technique, the irradiation beam should be mostly composed of thermal neutrons with a minimum as possible gamma and above thermal neutron components. This work aims to monitor and evaluate the irradiation beam on the sample irradiation position through the use of activation detectors (activation foils) and also to propose, through simulation using the radiation transport code, MCNP, new sets of moderators and filters which shall deliver better irradiation fields at the irradiation sample position In this work, a simulation methodology, based on a MCNP card, known as wwg (weight window generation) was studied, and the neutron energy spectrum has been experimentally discriminated at 5 energy ranges by using a new set o activation foils. It also has been concluded that the BNCT research facility has the required thermal neutron flux to perform studies in the area and it has a great potential for improvement for tailoring the irradiation field. (author)

  17. [Blockade of the alpha3alpha4 N-cholinoreceptors and GluR1 AMPA receptors eliminates clonic-tonic nicotinic and kainate seizures].

    Science.gov (United States)

    Serdiuk, S E; Gmiro, V E

    2008-01-01

    Monoammonium N-alkyl derivative of decylamine (IEM-1678), which blocks alpha3beta4 N-cholinoreceptors (but does not block GluR1 AMPA receptors), in doses of 1.0 - 3.0 mg/kg produces a 4-fold decrease in the frequency and lethality of nicotinic clonic-tonic seizures. However, even in the maximum dose of 3 mg/kg, IEM-1678 only slightly decreases kainate clonic-tonic seizures. Bis-ammonium compound IEM-1460 (containing adamantyl radical), which blocks both GluR1 AMPA receptors and alpha3beta4 N-cholinoreceptors, in a range of doses 0.1 - 3 mg/kg produces a 5- to 8-fold decrease in the frequency and virtually completely eliminates lethality of both clonic-tonic nicotinic and kainate seizures. Hence, the complete elimination of generalized kainate and nicotinic seizures requires combined blockade GluR1 AMPA and alpha3beta4 N-cholinoreceptors.

  18. The interaction of the Eco R1 restriction enzyme E.coli with nucleotides

    Energy Technology Data Exchange (ETDEWEB)

    Hollis, Donald F. [Univ. of California, Berkeley, CA (United States)

    1979-11-01

    The Eco R1 restriction enzyme can be shown to be inhibited by nucleotides which correspond to any part of its known site of phosphodiesterase activity. A series of di-, tetra-, and hexa-nucleotide fragments were synthesized and their effect on the activity of the enzyme upon superhelical Co1 E1 DNA studied. The inhibition caused by the individual mononucleotides were also studied. In general all the nucleotide fragments showed some form of interaction with the enzyme system. Tetranucleotides were stronger inhibitors than dinucleotides, which in turn were stronger inhibitors than the mononucleotides. Within each category of inhibitors, those containing the phosphodiester bond which is acted upon by the enzyme were the strongest inhibitors. Only those fragments which were consistent with the enzymes site of activity showed competitive inhibition kinetics. Nucleotides which do not fit within the site of phosphodiesterase activity show non-competitive inhibition kinetics.

  19. BubR1 Promotes Bub3-Dependent APC/C Inhibition during Spindle Assembly Checkpoint Signaling.

    Science.gov (United States)

    Overlack, Katharina; Bange, Tanja; Weissmann, Florian; Faesen, Alex C; Maffini, Stefano; Primorac, Ivana; Müller, Franziska; Peters, Jan-Michael; Musacchio, Andrea

    2017-10-09

    The spindle assembly checkpoint (SAC) prevents premature sister chromatid separation during mitosis. Phosphorylation of unattached kinetochores by the Mps1 kinase promotes recruitment of SAC machinery that catalyzes assembly of the SAC effector mitotic checkpoint complex (MCC). The SAC protein Bub3 is a phospho-amino acid adaptor that forms structurally related stable complexes with functionally distinct paralogs named Bub1 and BubR1. A short motif ("loop") of Bub1, but not the equivalent loop of BubR1, enhances binding of Bub3 to kinetochore phospho-targets. Here, we asked whether the BubR1 loop directs Bub3 to different phospho-targets. The BubR1 loop is essential for SAC function and cannot be removed or replaced with the Bub1 loop. BubR1 loop mutants bind Bub3 and are normally incorporated in MCC in vitro but have reduced ability to inhibit the MCC target anaphase-promoting complex (APC/C), suggesting that BubR1:Bub3 recognition and inhibition of APC/C requires phosphorylation. Thus, small sequence differences in Bub1 and BubR1 direct Bub3 to different phosphorylated targets in the SAC signaling cascade. Copyright © 2017 The Author(s). Published by Elsevier Ltd.. All rights reserved.

  20. How the nuclear safety team conducts emergency exercises at the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Vaz, Antonio C.A.; Silva, Davilson G.; Toyoda, Eduardo Y.; Santia, Paulo S.; Conti, Thadeu N.; Semmler, Renato; Carvalho, Ricardo N., E-mail: acavaz@ipen.br, E-mail: dgsilva@ipen.br, E-mail: eytoyoda@ipen.br, E-mail: psantia@ipen.br, E-mail: tnconti@ipen.br, E-mail: rsemmler@ipen.b, E-mail: rncarval@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2015-07-01

    This work introduces the Diagram of Emergency Exercise Coordination designed by the Nuclear Safety Team for better Emergency Exercise coordination. The Nuclear Safety Team was created with the mission of avoiding, preventing and mitigating the causes and effects of accidents at the IEA-R1. The facility where we conduct our work is located in an area of a huge population, what increases the responsibility of our mission: conducting exercises and training are part of our daily activities. During the Emergency Exercise, accidents ranked 0-4 on INES (International Nuclear Events Scale) are simulated and involve: Police Department, Fire Department, workers, people from the community, and others. In the last exercise held in June 2014, the scenario contemplated a terrorist organization action that infiltrated in a group of students who were visiting the IEA-R1, tried to steal fresh fuel element to fabricate a dirty bomb. Emergency procedures and plans, timeline and metrics of the actions were applied to the Emergency Exercise evaluation. The next exercise will be held in November, with the simulation of the piping of the primary cooling circuit rupture, causing the emptying of the pool and the lack of cooling of the fuel elements in the reactor core: this will be the scenario. The skills acquired and the systems improvement have been very important tools for the reactor operation safety and the Nuclear Safety Team is making technical efforts so that these Emergency Exercises may be applied to other nuclear and radiological facilities. Equally important for the process of improving nuclear safety is the emphasis placed on implementing quality improvements to the human factor in the nuclear safety area, a crucial element that is often not considered by those outside the nuclear sector. Surely, the Diagram of Emergency Exercise Coordination application will improve and facilitate the organization, coordination and evaluation tasks. (author)

  1. Protein and DNA Effectors Control the TraI Conjugative Helicase of Plasmid R1

    Science.gov (United States)

    Sut, Marta V.; Mihajlovic, Sanja; Lang, Silvia; Gruber, Christian J.; Zechner, Ellen L.

    2009-01-01

    The mechanisms controlling progression of conjugative DNA processing from a preinitiation stage of specific plasmid strand cleavage at the transfer origin to a stage competent for unwinding the DNA strand destined for transfer remain obscure. Linear heteroduplex substrates containing double-stranded DNA binding sites for plasmid R1 relaxosome proteins and various regions of open duplex for TraI helicase loading were constructed to model putative intermediate structures in the initiation pathway. The activity of TraI was compared in steady-state multiple turnover experiments that measured the net production of unwound DNA as well as transesterase-catalyzed cleavage at nic. Helicase efficiency was enhanced by the relaxosome components TraM and integration host factor. The magnitude of stimulation depended on the proximity of the specific protein binding sites to the position of open DNA. The cytoplasmic domain of the R1 coupling protein, TraDΔN130, stimulated helicase efficiency on all substrates in a manner consistent with cooperative interaction and sequence-independent DNA binding. Variation in the position of duplex opening also revealed an unsuspected autoinhibition of the unwinding reaction catalyzed by full-length TraI. The activity reduction was sequence dependent and was not observed with a truncated helicase, TraIΔN308, lacking the site-specific DNA binding transesterase domain. Given that transesterase and helicase domains are physically tethered in the wild-type protein, this observation suggests that an intramolecular switch controls helicase activation. The data support a model where protein-protein and DNA ligand interactions at the coupling protein interface coordinate the transition initiating production and uptake of the nucleoprotein secretion substrate. PMID:19767439

  2. Conjugative DNA transfer is enhanced by plasmid R1 partitioning proteins

    Directory of Open Access Journals (Sweden)

    Christian J. Gruber

    2016-07-01

    Full Text Available Bacterial conjugation is a form of type IV secretion used to transport protein and DNA directly to recipient bacteria. The process is cell contact-dependent, yet the mechanisms enabling extracellular events to trigger plasmid transfer to begin inside the cell remain obscure. In this study of plasmid R1 we investigated the role of plasmid proteins in the initiation of gene transfer. We find that TraI, the central regulator of conjugative DNA processing, interacts physically and functionally with the plasmid partitioning proteins ParM and ParR. These interactions stimulate TraI catalyzed relaxation of plasmid DNA in vivo and in vitro and increase ParM ATPase activity. ParM also binds the coupling protein TraD and VirB4-like channel ATPase TraC. Together, these protein-protein interactions probably act to co-localize the transfer components intracellularly and promote assembly of the conjugation machinery. Importantly these data also indicate that the continued association of ParM and ParR at the conjugative pore is necessary for plasmid transfer to start efficiently. Moreover, the conjugative pilus and underlying secretion machinery assembled in the absence of Par proteins mediate poor biofilm formation and are completely dysfunctional for pilus specific R17 bacteriophage uptake. Thus, functional integration of Par components at the interface of relaxosome, coupling protein and channel ATPases appears important for an optimal conformation and effective activation of the transfer machinery. We conclude that low copy plasmid R1 has evolved an active segregation system that optimizes both its vertical and lateral modes of dissemination.

  3. Protein and DNA effectors control the TraI conjugative helicase of plasmid R1.

    Science.gov (United States)

    Sut, Marta V; Mihajlovic, Sanja; Lang, Silvia; Gruber, Christian J; Zechner, Ellen L

    2009-11-01

    The mechanisms controlling progression of conjugative DNA processing from a preinitiation stage of specific plasmid strand cleavage at the transfer origin to a stage competent for unwinding the DNA strand destined for transfer remain obscure. Linear heteroduplex substrates containing double-stranded DNA binding sites for plasmid R1 relaxosome proteins and various regions of open duplex for TraI helicase loading were constructed to model putative intermediate structures in the initiation pathway. The activity of TraI was compared in steady-state multiple turnover experiments that measured the net production of unwound DNA as well as transesterase-catalyzed cleavage at nic. Helicase efficiency was enhanced by the relaxosome components TraM and integration host factor. The magnitude of stimulation depended on the proximity of the specific protein binding sites to the position of open DNA. The cytoplasmic domain of the R1 coupling protein, TraDDeltaN130, stimulated helicase efficiency on all substrates in a manner consistent with cooperative interaction and sequence-independent DNA binding. Variation in the position of duplex opening also revealed an unsuspected autoinhibition of the unwinding reaction catalyzed by full-length TraI. The activity reduction was sequence dependent and was not observed with a truncated helicase, TraIDeltaN308, lacking the site-specific DNA binding transesterase domain. Given that transesterase and helicase domains are physically tethered in the wild-type protein, this observation suggests that an intramolecular switch controls helicase activation. The data support a model where protein-protein and DNA ligand interactions at the coupling protein interface coordinate the transition initiating production and uptake of the nucleoprotein secretion substrate.

  4. Conjugative DNA Transfer Is Enhanced by Plasmid R1 Partitioning Proteins.

    Science.gov (United States)

    Gruber, Christian J; Lang, Silvia; Rajendra, Vinod K H; Nuk, Monika; Raffl, Sandra; Schildbach, Joel F; Zechner, Ellen L

    2016-01-01

    Bacterial conjugation is a form of type IV secretion used to transport protein and DNA directly to recipient bacteria. The process is cell contact-dependent, yet the mechanisms enabling extracellular events to trigger plasmid transfer to begin inside the cell remain obscure. In this study of plasmid R1 we investigated the role of plasmid proteins in the initiation of gene transfer. We find that TraI, the central regulator of conjugative DNA processing, interacts physically, and functionally with the plasmid partitioning proteins ParM and ParR. These interactions stimulate TraI catalyzed relaxation of plasmid DNA in vivo and in vitro and increase ParM ATPase activity. ParM also binds the coupling protein TraD and VirB4-like channel ATPase TraC. Together, these protein-protein interactions probably act to co-localize the transfer components intracellularly and promote assembly of the conjugation machinery. Importantly these data also indicate that the continued association of ParM and ParR at the conjugative pore is necessary for plasmid transfer to start efficiently. Moreover, the conjugative pilus and underlying secretion machinery assembled in the absence of Par proteins mediate poor biofilm formation and are completely dysfunctional for pilus specific R17 bacteriophage uptake. Thus, functional integration of Par components at the interface of relaxosome, coupling protein, and channel ATPases appears important for an optimal conformation and effective activation of the transfer machinery. We conclude that low copy plasmid R1 has evolved an active segregation system that optimizes both its vertical and lateral modes of dissemination.

  5. Proposed design for the PGAA facility at the TRIGA IPR-R1 research reactor.

    Science.gov (United States)

    Guerra, Bruno T; Jacimovic, Radojko; Menezes, Maria Angela Bc; Leal, Alexandre S

    2013-01-01

    This work presents an initial proposed design of a Prompt Gamma Activation Analysis (PGAA) facility to be installed at the TRIGA IPR-R1, a 60 years old research reactor of the Centre of Development of Nuclear Technology (CDTN) in Brazil. The basic characteristics of the facility and the results of the neutron flux are presented and discussed. The proposed design is based on a quasi vertical tube as a neutron guide from the reactor core, inside the reactor pool, 6 m below the room's level where shall be located the rack containing the set sample/detector/shielding. The evaluation of the thermal and epithermal neutron flux in the sample position was done considering the experimental data obtained from a vertical neutron guide, already existent in the reactor, and the simulated model for the facility. The experimental determination of the neutron flux was obtained through the standard procedure of using Au monitors in different positions of the vertical tube. In order to validate both, this experiment and calculations of the simulated model, the flux was also determined in different positions in the core used for sample irradiation. The model of the system was developed using the Monte Carlo code MCNP5. The preliminary results suggest the possibility of obtaining a beam with minimum thermal flux of magnitude 10(6) cm(-2) s(-1), which confirm the technical feasibility of the installation of PGAA at the TRIGA IPR-R1 reactor. This beam would open new possibilities for enhancing the applications using the reactor.

  6. Unexpected dependence of RyR1 splice variant expression in human lower limb muscles on fiber-type composition.

    Science.gov (United States)

    Willemse, Hermia; Theodoratos, Angelo; Smith, Paul N; Dulhunty, Angela F

    2016-02-01

    The skeletal muscle ryanodine receptor Ca(2+) release channel (RyR1), essential for excitation-contraction (EC) coupling, demonstrates a known developmentally regulated alternative splicing in the ASI region. We now find unexpectedly that the expression of the splice variants is closely related to fiber type in adult human lower limb muscles. We examined the distribution of myosin heavy chain isoforms and ASI splice variants in gluteus minimus, gluteus medius and vastus medialis from patients aged 45 to 85 years. There was a strong positive correlation between ASI(+)RyR1 and the percentage of type 2 fibers in the muscles (r = 0.725), and a correspondingly strong negative correlation between the percentages of ASI(+)RyR1 and percentage of type 1 fibers. When the type 2 fiber data were separated into type 2X and type 2A, the correlation with ASI(+)RyR1 was stronger in type 2X fibers (r = 0.781) than in type 2A fibers (r = 0.461). There was no significant correlation between age and either fiber-type composition or ASI(+)RyR1/ASI(-)RyR1 ratio. The results suggest that the reduced expression of ASI(-)RyR1 during development may reflect a reduction in type 1 fibers during development. Preferential expression of ASI(-) RyR1, having a higher gain of in Ca(2+) release during EC coupling than ASI(+)RyR1, may compensate for the reduced terminal cisternae volume, fewer junctional contacts and reduced charge movement in type 1 fibers.

  7. Synthesis, crystal structures and properties of cis- and trans-isomers of [Pt{C 6H 4-4R 1-1-[C 8H 4N-3'-NOMe]}Cl 2(dmso)] (R 1 = H or Cl)

    Science.gov (United States)

    López, Concepción; Moya, Carlos; Basu, Pradipta K.; González, Asensio; Solans, Xavier; Font-Bardía, Mercè; Calvet, Teresa; Lalinde, Elena; Teresa Moreno, M.

    2011-07-01

    The study of the reactivity of the 3-methoxyimino-2-phenyl-3 H-indoles C 6H 4-4R 1-1-[C 8H 4N-3'-NOMe] [R 1 = Cl ( 1a) or H ( 1b)] with cis-[PtCl 2(dmso) 2] has allowed the isolation of trans-[Pt{C 6H 4-4R 1-1-[C 8H 4N-3'-NOMe]}Cl 2(dmso)] [R 1 = Cl ( 2a) or H ( 2b)] and cis-[Pt{C 6H 4-4R 1-1-[C 8H 4N-3'-NOMe]}Cl 2(dmso)]·CH 2Cl 2 [R 1 = Cl ( 3a) or H ( 3b)]. Their crystal structures confirm: (a) the existence of a Pt sbnd N indole bond, (b) the relative arrangement of the Cl - ligands ( trans in 2a and 2b or cis in 3a and 3b) and (c) the anti- ( E) configuration of the oxime. A comparative study of the spectroscopic and photo-optical properties of ligands and their platinum(II) complexes ( 2a, 2b, 3a and 3b) is also reported.

  8. L-Theanine elicits umami taste via the T1R1 + T1R3 umami taste receptor.

    Science.gov (United States)

    Narukawa, Masataka; Toda, Yasuka; Nakagita, Tomoya; Hayashi, Yukako; Misaka, Takumi

    2014-06-01

    L-Theanine is a unique amino acid present in green tea. It elicits umami taste and has a considerable effect on tea taste and quality. We investigated L-theanine activity on the T1R1 + T1R3 umami taste receptor. L-Theanine activated T1R1 + T1R3-expressing cells and showed a synergistic response with inosine 5'-monophosphate. The site-directed mutagenesis analysis revealed that L-theanine binds to L-amino acid binding site in the Venus flytrap domain of T1R1. This study shows that L-theanine elicits an umami taste via T1R1 + T1R3.

  9. Optimised k0-instrumental neutron activation method using the TRIGA MARK I IPR-R1 reactor at CDTN/CNEN, Belo Horizonte, Brazil

    Science.gov (United States)

    Menezes, M. Â. B. C.; Jaćimović, R.

    2006-08-01

    The Nuclear Technology Development Centre/Brazilian Commission for Nuclear Energy, CDTN/CNEN, is the only Brazilian Institution to apply the k0-standardisation method of instrumental neutron activation technique determining elements using its own nuclear reactor, TRIGA MARK I IPR-R1. After changes in the reactor core configuration, the reactor neutron flux distribution in typical irradiation channels had to be updated, as well as the parameters f and α, needed to apply the k0-method of neutron activation analysis. The neutron flux distribution in the rotary rack was evaluated through the specific count rate of 198Au and the parameters f and α, were determined in five selected channels applying the "Cd-ratio for multi-monitor" method, using a set of Al-(0.1%)Au and Zr (99.8%) monitors. Several reference materials were analysed, indicating the effectiveness of the improved method.

  10. NCoR1-independent mechanism plays a role in the action of the unliganded thyroid hormone receptor.

    Science.gov (United States)

    Mendoza, Arturo; Astapova, Inna; Shimizu, Hiroaki; Gallop, Molly R; Al-Sowaimel, Lujain; MacGowan, S M Dileas; Bergmann, Tim; Berg, Anders H; Tenen, Danielle E; Jacobs, Christopher; Lyubetskaya, Anna; Tsai, Linus; Hollenberg, Anthony N

    2017-10-03

    Nuclear receptor corepressor 1 (NCoR1) is considered to be the major corepressor that mediates ligand-independent actions of the thyroid hormone receptor (TR) during development and in hypothyroidism. We tested this by expressing a hypomorphic NCoR1 allele (NCoR1ΔID), which cannot interact with the TR, in Pax8-KO mice, which make no thyroid hormone. Surprisingly, abrogation of NCoR1 function did not reverse the ligand-independent action of the TR on many gene targets and did not fully rescue the high mortality rate due to congenital hypothyroidism in these mice. To further examine NCoR1's role in repression by the unliganded TR, we deleted NCoR1 in the livers of euthyroid and hypothyroid mice and examined the effects on gene expression and enhancer activity measured by histone 3 lysine 27 (H3K27) acetylation. Even in the absence of NCoR1 function, we observed strong repression of more than 43% of positive T3 (3,3',5-triiodothyronine) targets in hypothyroid mice. Regulation of approximately half of those genes correlated with decreased H3K27 acetylation, and nearly 80% of these regions with affected H3K27 acetylation contained a bona fide TRβ1-binding site. Moreover, using liver-specific TRβ1-KO mice, we demonstrate that hypothyroidism-associated changes in gene expression and histone acetylation require TRβ1. Thus, many of the genomic changes mediated by the TR in hypothyroidism are independent of NCoR1, suggesting a role for additional signaling modulators in hypothyroidism.

  11. Impaired associative fear learning in mice with complete loss or haploinsufficiency of AMPA GluR1 receptors

    Directory of Open Access Journals (Sweden)

    Michael Feyder

    2007-12-01

    Full Text Available There is compelling evidence that L-alpha-amino-3-hydroxy-5-methylisoxazole-4-propionate (AMPA glutamate receptors containing the GluR1 subunit contribute to the molecular mechanisms associated with learning. AMPA GluR1 glutamate receptor knockout mice (KO exhibit abnormal hippocampal and amygdala plasticity, and deficits on various assays for cognition including Pavlovian fear conditioning. Here we examined associative fear learning in mice with complete absence (KO or partial loss (heterozygous mutant, HET of GluR1 on multiple fear conditioning paradigms. After multi-trial delay or trace conditioning, KO displayed impaired tone and context fear recall relative to WT, whereas HET were normal. After one-trial delay conditioning, both KO and HET showed impaired tone and context recall. HET and KO showed normal nociceptive sensitivity in the hot plate and tail flick tests. These data demonstrate that the complete absence of GluR1 subunit-containing receptors prevents the formation of associative fear memories, while GluR1 haploinsufficiency is sufficient to impair one-trial fear learning. These findings support growing evidence of a major role for GluR1-containing AMPA receptors in amygdalamediated forms of learning and memory.

  12. LTB-R1: an alternative to swine mycoplasmal pneumoniae control LTB-R1: uma alternativa para o controle da pneumonia micoplásmica suína

    Directory of Open Access Journals (Sweden)

    Fabrício Rochedo Conceição

    2003-11-01

    Full Text Available Mycoplasmal pneumoniae is the main respiratory disease in swine. The most efficient way to control it is through the use of vaccines (bacterins, whose production cost is high. The objective of this work was to develop a new alternative for controlling Swine Mycoplasmal Pneumoniae, based on a recombinant subunit vaccine containing the R1 region of P97 adhesin of Mycoplasma hyopneumoniae fused to the B subunit of the heat-labile enterotoxin of Escherichia coli (rLTB-R1. In this work we report the amplification of the genes, genetic fusion between LTB and R1 coding sequences, cloning, construction of the expression vector, as well as expression and purification of rLTB-R1 in E. coli.A Pneumonia Micoplásmica é a doença respiratória mais importante dos suínos. A forma mais eficaz de controlá-la é mediante a utilização de vacinas (bacterinas, cujo custo de produção é elevado. Uma nova alternativa para o controle desta doença, baseada em uma vacina de subunidade recombinante contendo a região R1 da adesina P97 de Mycoplasma hyopneumoniae fusionada a subunidade B da enterotoxina termolábel de Escherichia coli (rLTB-R1, foi o alvo deste trabalho. Nele abordou-se a amplificação dos genes, a fusão genética entre as seqüências codificadoras para LTB e R1, a clonagem, a construção do vetor de expressão, assim como a expressão em E. coli e purificação da rLTBR1.

  13. Mouse neutrophils express functional umami taste receptor T1R1/T1R3.

    Science.gov (United States)

    Lee, NaHye; Jung, Young Su; Lee, Ha Young; Kang, NaNa; Park, Yoo Jung; Hwang, Jae Sam; Bahk, Young Yil; Koo, JaeHyung; Bae, Yoe-Sik

    2014-11-01

    Neutrophils play an important role in the initiation of innate immunity against infection and injury. Although many different types of G-protein coupled receptors are functionally expressed in neutrophils, no reports have demonstrated functional expression of umami taste receptor in these cells. We observed that mouse neutrophils express the umami taste receptor T1R1/T1R3 through RNA sequencing and quantitative RT-PCR analysis. Stimulation of mouse neutrophils with L-alanine or L-serine, which are ligands for the umami taste receptor, elicited not only ERK or p38 MAPK phosphorylation but also chemotactic migration. Moreover, addition of L-alanine or L-serine markedly reduced the production of several cytokines including TNF-α induced by lipopolysaccharide (LPS) through inhibition of NF-κB activity or STAT3 phosphorylation in neutrophils. Our findings demonstrate that neutrophils express the umami taste receptor, through which tastants stimulate neutrophils, resulting in chemotactic migration, and attenuation of LPS-induced inflammatory response.

  14. Initial speed of knots in the plasma tail of C/2013 R1(Lovejoy)

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, Masafumi; Furusho, Reiko; Terai, Tsuyoshi; Watanabe, Jun-Ichi [National Astronomical Observatory of Japan, 2-21-1, Osawa, Mitaka, Tokyo, 181-8588 (Japan); Koda, Jin [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794-3800 (United States); Fujiwara, Hideaki, E-mail: YAGI.Masafumi@nao.ac.jp [Subaru Telescope, 650 North A’ohoku Place, Hilo, HI 96720 (United States)

    2015-03-01

    We report short-time variations in the plasma tail of C/2013 R1(Lovejoy). A series of short (2–3 minutes) exposure images with the 8.2 m Subaru telescope shows faint details of filaments and their motions over a 24 minute observing duration. We identified rapid movements of two knots in the plasma tail near the nucleus (∼3×10{sup 5} km). Their speeds are 20 and 25 km s{sup −1} along the tail and 3.8 and 2.2 km s{sup −1} across it, respectively. These measurements set a constraint on an acceleration model of plasma tail and knots as they set the initial speed just after their formation. We also found a rapid narrowing of the tail. After correcting the motion along the tail, the narrowing speed is estimated to be ∼8 km s{sup −1}. These rapid motions suggest the need for high time-resolution studies of comet plasma tails with a large telescope.

  15. Nuclear Research Reactor IEA-R1 - A Study of the Preparing for Decommissioning

    Energy Technology Data Exchange (ETDEWEB)

    Lopes, Valdir Maciel; Filho, Tufic Madi; Ricci, Walter; Martins, Mauro Onofre; Pereira, Maria da Conceicao [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN - Sao Paulo, Av. Professor Lineu Prestes n 2242, USP, Sao Paulo (Brazil)

    2015-07-01

    The Institute of Energy and Nuclear Research (IPEN), Sao Paulo, according to the assignments given by the National Commission of Nuclear Energy (CNEN), enabled the development of this study, especially operational reports about refurbishing carried out on 2013, involving the production of radioisotopes and research in the areas of Radiochemistry and Nuclear Physics. These reports are made in accordance with established standard procedures to meet the requirements of CNEN (National Nuclear Energy Commission, the regulator the nuclear area activities in Brazil) and IAEA (International Atomic Energy Agency). This study presents an assessment of the procedures and methods of treatments for decontamination of the refrigeration primary circuit and changes parts, equipment and tubes of the of the IEA-R1 nuclear research reactor, pool type, power between 3,5 and 4,5 MW. In order to have a sequence in the work, the well-known contaminant radioisotopes were evaluated firstly, using Geiger- Muller equipment. In the second phase, the decontamination was done manually together with the ultrasound cleaning and washing equipment. From the several water solutions of citric acid assessment, the concentration with better confidence was obtained; in order to achieve the best results for decontamination. This study intends to define the best process for decontamination with low taxes of waste and without expensive costs. (authors)

  16. Design, synthesis, and pharmacology of a highly subtype-selective GluR1/2 agonist, (RS)-2-amino-3-(4-chloro-3-hydroxy-5-isoxazolyl)propionic acid (Cl-HIBO)

    DEFF Research Database (Denmark)

    Bjerrum, Esben J; Kristensen, Anders S; Pickering, Darryl S

    2003-01-01

    On the basis of structural studies, chloro-homoibotenic acid (Cl-HIBO) was designed and synthesized. Cl-HIBO was characterized in binding and electrophysiology experiments on native and cloned subtypes of GluRs. Electrophysiological selectivities ranged from 275 to 1600 for GluR1/2 over GluR3...

  17. Two distinct determinants of ligand specificity in T1R1/T1R3 (the umami taste receptor).

    Science.gov (United States)

    Toda, Yasuka; Nakagita, Tomoya; Hayakawa, Takashi; Okada, Shinji; Narukawa, Masataka; Imai, Hiroo; Ishimaru, Yoshiro; Misaka, Takumi

    2013-12-27

    Umami taste perception in mammals is mediated by a heteromeric complex of two G-protein-coupled receptors, T1R1 and T1R3. T1R1/T1R3 exhibits species-dependent differences in ligand specificity; human T1R1/T1R3 specifically responds to L-Glu, whereas mouse T1R1/T1R3 responds more strongly to other L-amino acids than to L-Glu. The mechanism underlying this species difference remains unknown. In this study we analyzed chimeric human-mouse receptors and point mutants of T1R1/T1R3 and identified 12 key residues that modulate amino acid recognition in the human- and mouse-type responses in the extracellular Venus flytrap domain of T1R1. Molecular modeling revealed that the residues critical for human-type acidic amino acid recognition were located at the orthosteric ligand binding site. In contrast, all of the key residues for the mouse-type broad response were located at regions outside of both the orthosteric ligand binding site and the allosteric binding site for inosine-5'-monophosphate (IMP), a known natural umami taste enhancer. Site-directed mutagenesis demonstrated that the newly identified key residues for the mouse-type responses modulated receptor activity in a manner distinct from that of the allosteric modulation via IMP. Analyses of multiple point mutants suggested that the combination of two distinct determinants, amino acid selectivity at the orthosteric site and receptor activity modulation at the non-orthosteric sites, may mediate the ligand specificity of T1R1/T1R3. This hypothesis was supported by the results of studies using nonhuman primate T1R1 receptors. A complex molecular mechanism involving changes in the properties of both the orthosteric and non-orthosteric sites of T1R1 underlies the determination of ligand specificity in mammalian T1R1/T1R3.

  18. Clinicopathologic findings in (anti-FcepsilonR1alpha) autoimmune-related chronic urticaria.

    Science.gov (United States)

    Rojanapremsuk, Theera; Kasprowicz, Sarah; Schafer, Ewa; Story, Rachel; Clarke, Michael S; Walls, Timothy; Snyder, Vivian; Gleason, Briana C; Thomas, Antoinette B; Cibull, Thomas

    2015-05-01

    One cause of chronic urticaria is autoreactivity which is diagnosed by detecting autoantibodies against the IgE receptor alpha subunit (anti-Fc R1alpha). To compare the histopathologic features of chronic urticaria patients testing positive for anti-IgE receptor antibody (Ab) to those testing negative. Totally, 438 patients with a clinical presentation of chronic urticaria (2011-2013) had anti-IgE receptor Ab tested and 37 of those patients had skin biopsy. We evaluated microscopic features including: spongiosis, dermal edema, presence of mast cells, density of lymphocytic infiltration, predomination of eosinophils/neutrophils; intravascular neutrophils and presence of vasculitis. The aforementioned features were compared between negative and positive anti-IgE receptor Ab groups. Of 37 patients , 69% were women and 31% were men. 49% had positive anti-IgE receptor Ab and 51% had negative anti-IgE receptor Ab. In the positive anti-IgE receptor Ab group, 83% showed intravascular neutrophils. Eosinophil predominance was identified in 72% and neutrophil predominance was identified in 28%. In the negative anti-IgE receptor Ab group, 89% showed intravascular neutrophils. Eosinophil predominance was identified in 53% and neutrophil predominance was identified in 47%. There was no evidence of vasculitis in either group. There were no significant histopathologic differences between the anti-IgE receptor Ab positive and negative cases. Therefore, serum testing for anti-IgE receptor Ab is required to identify this subgroup of chronic urticaria patients. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  19. Improvement of Biodesulfurization Rate of Alginate Immobilized Rhodococcus erythropolis R1.

    Science.gov (United States)

    Derikvand, Peyman; Etemadifar, Zahra

    2014-03-01

    Sulfur oxides released from the burning of oil causes severe environmental pollution. The sulfur can be removed via the 4S pathway in biodesulfurization (BDS). Immobilization approaches have been developed to prevent cell contamination of oil during the BDS process. The encapsulation of Rhodococcus erythropolis R1 in calcium alginate beads was studied in order to enhance conversion of dibenzothiophene (DBT) to 2-hydroxy biphenyl (2-HBP) as the final product. Also the effect of different factors on the BDS process was investigated. Calcium alginate capsules were prepared using peristaltic pumps with different needle sizes to control the beads sizes. Scanning electron microscopy and flow cytometry methods were used to study the distribution and viability of encapsulated cells, respectively. Two non-ionic surfactants and also nano Ƴ-Al2O3were used with the ratio of 0.5% (v/v) and 1:5 (v/v) respectively to investigate their BDS efficiency. In addition, the effect of different bead sizes and different concentrations of sodium alginate in BDS activity was studied. The 2% (w/v) sodium alginate beads with 1.5mm size were found to be the optimum for beads stability and efficient 2-HBP production. The viability of encapsulated cells decreased by 12% after 20 h of desulfurization, compared to free cells. Adding the non-ionic surfactants markedly enhanced the rate of BDS, because of increasing mass transfer of DBT to the gel matrix. In addition, Span 80 was more effective than Tween 80. The nanoƳ-Al2O3 particles could increase BDS rate by up to two-folds greater than that of the control beads. The nano Ƴ-Al2O3 can improve the immobilized biocatalyst for excellent efficiency of DBT desulfurization. Also the BDS activity can be enhanced by setting the other explained factors at optimum levels.

  20. Plasmid r1 conjugative DNA processing is regulated at the coupling protein interface.

    Science.gov (United States)

    Mihajlovic, Sanja; Lang, Silvia; Sut, Marta V; Strohmaier, Heimo; Gruber, Christian J; Koraimann, Günther; Cabezón, Elena; Moncalián, Gabriel; de la Cruz, Fernando; Zechner, Ellen L

    2009-11-01

    Selective substrate uptake controls initiation of macromolecular secretion by type IV secretion systems in gram-negative bacteria. Type IV coupling proteins (T4CPs) are essential, but the molecular mechanisms governing substrate entry to the translocation pathway remain obscure. We report a biochemical approach to reconstitute a regulatory interface between the plasmid R1 T4CP and the nucleoprotein relaxosome dedicated to the initiation stage of plasmid DNA processing and substrate presentation. The predicted cytosolic domain of T4CP TraD was purified in a predominantly monomeric form, and potential regulatory effects of this protein on catalytic activities exhibited by the relaxosome during transfer initiation were analyzed in vitro. TraDDeltaN130 stimulated the TraI DNA transesterase activity apparently via interactions on both the protein and the DNA levels. TraM, a protein interaction partner of TraD, also increased DNA transesterase activity in vitro. The mechanism may involve altered DNA conformation as TraM induced underwinding of oriT plasmid DNA in vivo (DeltaL(k) = -4). Permanganate mapping of the positions of duplex melting due to relaxosome assembly with TraDDeltaN130 on supercoiled DNA in vitro confirmed localized unwinding at nic but ruled out formation of an open complex compatible with initiation of the TraI helicase activity. These data link relaxosome regulation to the T4CP and support the model that a committed step in the initiation of DNA export requires activation of TraI helicase loading or catalysis.

  1. Neutronic tests and reactivity balance in the IPR-R1 TRIGA reactor

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Rose Mary Gomes do Prado; Souza, Luiz Claudio Andrade, E-mail: souzarm@cdtn.br, E-mail: lcas@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-07-01

    This paper presents the 2014 neutronic tests performed on CDTN's TRIGA IPR-R1 research reactor. Such tests are performed annually, as prescribed by the Safety Analysis Report. The three control rods, Regulating, Shim and Safety, were calibrated and their worth determined to be 0.52 $, 3.08 $ and 2.78 $, respectively. The Shim rod takes 0.44 s to shutdown the reactor and the Safety rod 0.48 s. The maximum reactivity insertion rates are 48 pcm/s by the Shim rod and 46 pcm/s by the Safety rod. Total reactivity excess is 1.88 $. The temperature reactivity coefficient determined is -0.94 cent/deg C. A reactivity insertion of 0.71 $ is necessary in order to achieve the licensed maximum reactor power of 100 kW. Reactivity losses due to xenon poisoning, after operating for 8 h at maximum power, is 0.20 $, and the insertion of a void tube in the Central Thimble corresponds to 0.22 $. A significant amount of reactivity is required to overcome the temperature effect and allow the reactor to operate at full power for extended periods of time. Given all these reactivity losses, a new fuel element should soon be added to the core in order to increase the reactivity excess. Adding this new fuel element to the C ring and moving the element withdrawn from that position to the F ring, replacing a graphite dummy element, would increase 45.5 cents in the reactivity excess worth. Calculations and experimental results will be used to optimize a new core configuration for the reactor. (author)

  2. CO (3 – 2) HIGH-RESOLUTION SURVEY OF THE GALACTIC PLANE: R1

    Energy Technology Data Exchange (ETDEWEB)

    Dempsey, J. T.; Thomas, H. S.; Currie, M. J., E-mail: j.dempsey@jach.hawaii.edu, E-mail: h.thomas@jach.hawaii.edu, E-mail: m.currie@jach.hawaii.edu [Joint Astronomy Centre, 660 N. Aohoku Place, Hilo, HI 96720 (United States)

    2013-11-01

    We present the first release (R1) of data from the CO High-Resolution Survey (COHRS), which maps a strip of the inner Galactic plane in {sup 12}CO (J = 3 → 2). The data are taken using the Heterodyne Array Receiver Programme on the James Clerk Maxwell Telescope (JCMT) in Hawaii, which has a 14 arcsec angular resolution at this frequency. When complete, this survey will cover |b| ≤ 0.°5 between 10° < l < 65°. This first release covers |b| ≤ 0.°5 between 10.°25 < l < 17.°5 and 50.°25 < l < 55.°25, and |b| ≤ 0.°25 between 17.°5 < l < 50.°25. The data are smoothed to a velocity resolution of 1 km s{sup –1}, a spatial resolution of 16 arcsec and achieve a mean rms of ∼1 K. COHRS data are available to the community online at http://dx.doi.org/10.11570/13.0002. In this paper we describe the data acquisition and reduction techniques used and present integrated intensity images and longitude-velocity maps. We also discuss the noise characteristics of the data. The high resolution is a powerful tool for morphological studies of bubbles and filaments while the velocity information shows the spiral arms and outflows. These data are intended to complement both existing and upcoming surveys, e.g., the Bolocam Galactic Plane Survey (BGPS), ATLASGAL, the Herschel Galactic Plane Survey (Hi-GAL) and the JCMT Galactic Plane Survey with SCUBA-2 (JPS)

  3. Structural basis for selective recognition of endogenous and microbial polysaccharides by macrophage receptor SIGN-R1.

    Science.gov (United States)

    Silva-Martín, Noella; Bartual, Sergio G; Ramírez-Aportela, Erney; Chacón, Pablo; Park, Chae Gyu; Hermoso, Juan A

    2014-11-04

    SIGN-R1 is a principal receptor for microbial polysaccharides uptake and is responsible for C3 fixation via an unusual complement activation pathway on splenic marginal zone macrophages. In these macrophages, SIGN-R1 is also involved in anti-inflammatory activity of intravenous immunoglobulin by direct interaction with sialylated Fcs. The high-resolution crystal structures of SIGN-R1 carbohydrate recognition domain and its complexes with dextran sulfate or sialic acid, and of the sialylated Fc antibody provide insights into SIGN-R1’s selective recognition of a-2,6-sialylated glycoproteins. Unexpectedly, an additional binding site has been found in the SIGNR1 carbohydrate recognition domain, structurally separate from the calcium-dependent carbohydrate-binding site. This secondary binding site could bind repetitive molecular patterns, as observed in microbial polysaccharides, in a calcium-independent manner. These two binding sites may allow SIGNR1 to simultaneously bind both immune glycoproteins and microbial polysaccharide components, accommodating SIGN-R1’s ability to relate the recognition of microbes to the activation of the classical complement pathway.

  4. UV-dependent production of 25-hydroxyvitamin D2 in the recombinant yeast cells expressing human CYP2R1.

    Science.gov (United States)

    Yasuda, Kaori; Endo, Mariko; Ikushiro, Shinichi; Kamakura, Masaki; Ohta, Miho; Sakaki, Toshiyuki

    2013-05-03

    CYP2R1 is known to be a physiologically important vitamin D 25-hydroxylase. We have successfully expressed human CYP2R1 in Saccharomyces cerevisiae to reveal its enzymatic properties. In this study, we examined production of 25-hydroxylated vitamin D using whole recombinant yeast cells that expressed CYP2R1. When vitamin D3 or vitamin D2 was added to the cell suspension of CYP2R1-expressing yeast cells in a buffer containing glucose and β-cyclodextrin, the vitamins were converted into their 25-hydroxylated products. Next, we irradiated the cell suspension with UVB and incubated at 37 °C. Surprisingly, the 25-hydroxy vitamin D2 was produced without additional vitamin D2. Endogenous ergosterol was likely converted into vitamin D2 by UV irradiation and thermal isomerization, and then the resulting vitamin D2 was converted to 25-hydroxyvitamin D2 by CYP2R1. This novel method for producing 25-hydroxyvitamin D2 without a substrate could be useful for practical purposes. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Common requirement for the relaxosome of plasmid R1 in multiple activities of the conjugative type IV secretion system.

    Science.gov (United States)

    Lang, Silvia; Gruber, Christian J; Raffl, Sandra; Reisner, Andreas; Zechner, Ellen L

    2014-06-01

    Macromolecular transport by bacterial type IV secretion systems involves regulated uptake of (nucleo)protein complexes by the cell envelope-spanning transport channel. A coupling protein receptor is believed to recognize the specific proteins destined for transfer, but the steps initiating their translocation remain unknown. Here, we investigate the contribution of a complex of transfer initiation proteins, the relaxosome, of plasmid R1 to translocation of competing transferable substrates from mobilizable plasmids ColE1 and CloDF13 or the bacteriophage R17. We found that not only does the R1 translocation machinery engage the R1 relaxosome during conjugative self-transfer and during infection by R17 phage but it is also activated by its cognate relaxosome to mediate the export of an alternative plasmid. Transporter activity was optimized by the R1 relaxosome even when this complex itself could not be transferred, i.e., when the N-terminal activation domain (amino acids 1 to 992 [N1-992]) of TraI was present without the C-terminal conjugative helicase domain. We propose that the functional dependence of the transfer machinery on the R1 relaxosome for initiating translocation ensures that dissemination of heterologous plasmids does not occur at the expense of self-transfer.

  6. Synaptic depression via mGluR1 positive allosteric modulation suppresses cue-induced cocaine craving

    Science.gov (United States)

    Loweth, Jessica A.; Scheyer, Andrew F.; Milovanovic, Mike; LaCrosse, Amber L.; Flores-Barrera, Eden; Werner, Craig T.; Li, Xuan; Ford, Kerstin A.; Le, Tuan; Olive, M. Foster; Szumlinski, Karen K.; Tseng, Kuei Y.; Wolf, Marina E.

    2014-01-01

    Cue-induced cocaine craving is a major cause of relapse in abstinent addicts. In rats, cue-induced craving progressively intensifies (incubates) during withdrawal from extended-access cocaine self-administration. After ~1 month of withdrawal, incubated craving is mediated by Ca2+-permeable AMPARs (CP-AMPARs) that accumulate in the nucleus accumbens (NAc). We found that decreased mGluR1 surface expression in the NAc precedes and enables CP-AMPAR accumulation. Thus, restoring mGluR1 tone by administering repeated injections of an mGluR1 positive allosteric modulator (PAM) prevented CP-AMPAR accumulation and incubation, whereas blocking mGluR1 transmission at even earlier withdrawal times accelerated CP-AMPAR accumulation. In studies conducted after prolonged withdrawal, when CP-AMPAR levels and cue-induced craving are high, we found that systemic administration of an mGluR1 PAM attenuated the expression of incubated craving by reducing CP-AMPAR transmission in the NAc to control levels. These results demonstrate a strategy whereby recovering addicts could use a systemically active compound to protect against cue-induced relapse. PMID:24270186

  7. MicroRNA miR-1 is up-regulated in remote myocardium in patients with myocardial infarction.

    Science.gov (United States)

    Bostjancic, E; Zidar, N; Stajner, D; Glavac, D

    2010-01-01

    MicroRNAs are small regulatory RNA molecules that mediate regulation of gene expression, thus affecting a variety of physiological, developmental and pathological conditions. They are believed to be new promising therapeutic targets. In recent studies two muscle-specific microRNAs were discovered to contribute to heart diseases and development: miR-1 and miR-133, but there is little data on their expression patterns in human myocardial infarction. We performed simultaneous expression analysis of miR-1, miR-133a, miR-133b in samples of infarcted tissue and remote myocardium from twenty- four patients with acute myocardial infarction. MicroRNA expression was analysed using quantitative real-time PCR and compared to the expression patterns in myocardium of eight healthy adults who died in accidents. We found ~3.8-fold miR-1 up-regulation in remote myocardium when compared to infarcted tissue or healthy adult hearts. As miR-1 has been shown in animal models and clinical studies to contribute to arrhythmogenesis by regulating pacemaker channel genes, our finding of miR-1 up-regulation in patients with myocardial infarction indicates that it might be responsible for the higher risk for arrhythmias in these patients. In addition, miR-133a/b down-regulation in infarcted tissue and remote myocardium was observed, indicating miR-133a/b involvement in the heart response to myocardial infarction. We conclude that miR-1 and miR-133 seem to be important regulators of heart adaptation after ischaemic stress.

  8. Fluctuations in relative humidity provided to extremely low-birthweight infants (R1).

    Science.gov (United States)

    Kaczmarek, Jennifer; Tarawneh, Amjad; Martins, Bianca; Sant' Anna, Guilherme Mendes

    2012-04-01

    In extremely low-birthweight infants, the addition of relative humidity (RH) improves thermal stability, fluid and electrolyte balance. However, during routine care this microenvironment is frequently disturbed. The objective of this study was to determine the frequency, magnitude and direction of fluctuations in RH provided to extremely low-birthweight infants. All infants in our study had ambient temperature and RH continuously recorded for 48 h using a datalogger device (RH32S-C2). A clinically acceptable range for RH was defined as the set point ± 10%. A secondary analysis was performed to compare outcomes between infants that spent > 50% of the time out-of-range (OOR) or inside the range (IR). A P-value < 0.05 was significant. A total of 20 infants were included. Important fluctuations were detected by the device with infants spending 40% and 14% of the time above and below the range, respectively. However, the RH set point did not differ from the mean levels measured over 48 h by the RH32S-C2 or the incubator. Infants in the OOR group spent significantly more time at values higher than the planned range when compared to IR infants. Although significant fluctuations in RH above the desired range were detected in more than half of the infants, the average values were similar to the set points. Nevertheless, knowledge of these dynamic changes may help to optimize individualized care. © 2011 The Authors. Pediatrics International © 2011 Japan Pediatric Society.

  9. A Saccharomyces cerevisiae assay system to investigate ligand/AdipoR1 interactions that lead to cellular signaling.

    Directory of Open Access Journals (Sweden)

    Mustapha Aouida

    Full Text Available Adiponectin is a mammalian hormone that exerts anti-diabetic, anti-cancer and cardioprotective effects through interaction with its major ubiquitously expressed plasma membrane localized receptors, AdipoR1 and AdipoR2. Here, we report a Saccharomyces cerevisiae based method for investigating agonist-AdipoR interactions that is amenable for high-throughput scale-up and can be used to study both AdipoRs separately. Agonist-AdipoR1 interactions are detected using a split firefly luciferase assay based on reconstitution of firefly luciferase (Luc activity due to juxtaposition of its N- and C-terminal fragments, NLuc and CLuc, by ligand induced interaction of the chimeric proteins CLuc-AdipoR1 and APPL1-NLuc (adaptor protein containing pleckstrin homology domain, phosphotyrosine binding domain and leucine zipper motif 1-NLuc in a S. cerevisiae strain lacking the yeast homolog of AdipoRs (Izh2p. The assay monitors the earliest known step in the adiponectin-AdipoR anti-diabetic signaling cascade. We demonstrate that reconstituted Luc activity can be detected in colonies or cells using a CCD camera and quantified in cell suspensions using a microplate reader. AdipoR1-APPL1 interaction occurs in absence of ligand but can be stimulated specifically by agonists such as adiponectin and the tobacco protein osmotin that was shown to have AdipoR-dependent adiponectin-like biological activity in mammalian cells. To further validate this assay, we have modeled the three dimensional structures of receptor-ligand complexes of membrane-embedded AdipoR1 with cyclic peptides derived from osmotin or osmotin-like plant proteins. We demonstrate that the calculated AdipoR1-peptide binding energies correlate with the peptides' ability to behave as AdipoR1 agonists in the split luciferase assay. Further, we demonstrate agonist-AdipoR dependent activation of protein kinase A (PKA signaling and AMP activated protein kinase (AMPK phosphorylation in S. cerevisiae, which are

  10. Developing new PET tracers to image the growth hormone secretagogue receptor 1a (GHS-R1a).

    Science.gov (United States)

    Kawamura, Kazunori; Fujinaga, Masayuki; Shimoda, Yoko; Yamasaki, Tomoteru; Zhang, Yiding; Hatori, Akiko; Xie, Lin; Wakizaka, Hidekatsu; Kumata, Katsushi; Ohkubo, Takayuki; Kurihara, Yusuke; Ogawa, Masanao; Nengaki, Nobuki; Zhang, Ming-Rong

    2017-09-01

    `The growth hormone secretagogue receptor 1a (GHS-R1a) is the orphan G-protein-coupled receptor, and its endogenous ligand is ghrelin. GHS-R1a contributes to regulation of glucose homeostasis, memory and learning, food addiction, and neuroprotection. Several PET tracers for GHS-R1a have been developed, but none have been reported to be clinically applicable to GHS-R1a imaging. In this study, we developed three new PET tracers for GHS-R1a: 18F-labeled 6-(4-chlorophenyl)-3-((1-(2-fluoroethyl)piperidin-3-yl)methyl)-2-(o-tolyl)quinazolin-4(3H)-one (1), 11C-labeled 6-(4-chlorophenyl)-3-((1-(2-methoxyethyl)piperidin-3-yl)methyl)-2-(o-tolyl)quinazolin-4(3H)-one (2), and 11C-labeled (S)-(4-(1H-indole-6-carbonyl)-3-methylpiperazin-1-yl)(4'-methoxy-[1,1'-biphenyl]-4-yl)methanone (3). [18F]1 was synthesized by the 18F-fluoroethylation; [11C]2 or [11C]3 was synthesized by the 11C-methylation. Biodistribution studies and PET studies were conducted in mice. We successfully radiosynthesized [18F]1, [11C]2, and [11C]3 with appropriate radioactivity for the animal study. In the ex vivo biodistribution study, 60min following injection, the radioactivity level of [18F]1 was relatively high in the small intestine, that of [11C]2 was high in the liver, and that of [11C]3 was high in the pancreas. The radioactivity levels of the three PET tracers were relatively low in the brain. Under pretreatment with YIL781 (a selective and high affinity antagonist for GHS-R1a), the pancreas radioactivity level at 30min following [11C]3 injection was significantly reduced to 55% of control, but the radioactivity in the brain was not changed. In the PET study under control conditions, high radioactivity levels in the liver and pancreas were observed following [11C]3 injection. With YIL781 pretreatment, the accumulated radioactivity in the pancreas 15-60min after [11C]3 injection was significantly decreased to 78% of control. [11C]3 exhibited relatively high uptake and in vivo specific binding to GHS-R

  11. Normas do Teste de Inteligência Não Verbal R-1 para adultos não alfabetizados

    OpenAIRE

    Maria Olinda Gottsfritz; Irai Cristina Boccato Alves

    2009-01-01

    The R-1: Non-Verbal Intelligence Test is a Brazilian test to measure general intelligence. It was created to assess future drivers. However, the last published test manual does not have standards for illiterate adults. This study was designed to establish norms in the R-1 Test among illiterate adults and to present an analysis of frequencies of success for each item. The sample was composed by 151 adults, aged from 16 to 77 years of both sexes, enrolled in literacy courses in São Paulo city. ...

  12. Urticaria pigmentosa associated with acute stress and lesional skin mast-cell expression of CRF-R1.

    Science.gov (United States)

    Theoharides, T C; Kempuraj, D; Marchand, J; Tzianoumis, L; Vasiadi, M; Katsarou-Katsari, A; Makris, M; Kalogeromitros, D

    2009-07-01

    A 38-year-old woman presented with a pronounced increase in symptoms and proliferation of urticaria pigmentosa (UP) after acute psychological stress, which was quantified using the Spielberger's State-Trait Anxiety Inventory. Immunohistochemical examination of a skin biopsy from a new UP lesion showed a large number of activated mast cells expressing corticotrophin-releasing factor receptor-1 (CRF-R1) and there was high serum CRF. This is the first documented report to our knowledge of UP worsening associated with acute stress, possibly through activation of skin mast-cell CRF-R1.

  13. A Saccharomyces cerevisiae Assay System to Investigate Ligand/AdipoR1 Interactions That Lead to Cellular Signaling

    KAUST Repository

    Aouida, Mustapha

    2013-06-07

    Adiponectin is a mammalian hormone that exerts anti-diabetic, anti-cancer and cardioprotective effects through interaction with its major ubiquitously expressed plasma membrane localized receptors, AdipoR1 and AdipoR2. Here, we report a Saccharomyces cerevisiae based method for investigating agonist-AdipoR interactions that is amenable for high-throughput scale-up and can be used to study both AdipoRs separately. Agonist-AdipoR1 interactions are detected using a split firefly luciferase assay based on reconstitution of firefly luciferase (Luc) activity due to juxtaposition of its N- and C-terminal fragments, NLuc and CLuc, by ligand induced interaction of the chimeric proteins CLuc-AdipoR1 and APPL1-NLuc (adaptor protein containing pleckstrin homology domain, phosphotyrosine binding domain and leucine zipper motif 1-NLuc) in a S. cerevisiae strain lacking the yeast homolog of AdipoRs (Izh2p). The assay monitors the earliest known step in the adiponectin-AdipoR anti-diabetic signaling cascade. We demonstrate that reconstituted Luc activity can be detected in colonies or cells using a CCD camera and quantified in cell suspensions using a microplate reader. AdipoR1-APPL1 interaction occurs in absence of ligand but can be stimulated specifically by agonists such as adiponectin and the tobacco protein osmotin that was shown to have AdipoR-dependent adiponectin-like biological activity in mammalian cells. To further validate this assay, we have modeled the three dimensional structures of receptor-ligand complexes of membrane-embedded AdipoR1 with cyclic peptides derived from osmotin or osmotin-like plant proteins. We demonstrate that the calculated AdipoR1-peptide binding energies correlate with the peptides\\' ability to behave as AdipoR1 agonists in the split luciferase assay. Further, we demonstrate agonist-AdipoR dependent activation of protein kinase A (PKA) signaling and AMP activated protein kinase (AMPK) phosphorylation in S. cerevisiae, which are homologous to

  14. Enhanced natural killer cell activation by exopolysaccharides derived from yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1.

    Science.gov (United States)

    Makino, Seiya; Sato, Asako; Goto, Ayako; Nakamura, Marie; Ogawa, Miho; Chiba, Yoshika; Hemmi, Jun; Kano, Hiroshi; Takeda, Kazuyoshi; Okumura, Ko; Asami, Yukio

    2016-02-01

    Yogurt is generally recognized as a beneficial food for our health, but research into its physiological effects has focused mainly on intestinal dysfunctions such as constipation and diarrhea. We previously found yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1 (hereafter OLL1073R-1) could reduce risks of catching the common cold and flu in human trials. It was assumed that immunostimulatory exopolysaccharide (EPS) produced from OLL1073R-1 play an important role in this context. However, few studies have examined the immunostimulatory effects of traditional Bulgarian yogurts fermented with different strains of lactobacilli and their metabolites. Therefore, we screened 139 L. delbrueckii ssp. bulgaricus strains and identified OLL1073R-1 as the most robust producer of EPS. This strain was also the only strain that induced the production of IFN-γ in vitro. Oral administration of the EPS or yogurt fermented with OLL1073R-1 and Streptococcus thermophilus OLS3059 (OLL1073R-1 yogurt) augmented natural killer (NK) cell activity and induced IFN-γ production in spleen cells in mice, whereas 2 other yogurts fermented with other strains had no effect on NK cell activity. Cellular preparations of the OLL1073R-1 strain also slightly augmented NK cell activity, but were less effective than EPS itself. The EPS-dependent stimulation of NK cell activity was abrogated in IFN-γ knockout mice and in myeloid differentiation factor 88 knockout mice. Furthermore, IFN-γ production from spleen cells stimulated with EPS was completely blocked with both anti-IL-12 and anti-IL-18 antibodies in vitro. These findings suggest that NK cell activation by OLL1073R-1 yogurt is EPS-dependent, occurs via IL-12- and IL-18-mediated IFN-γ production, and requires myeloid differentiation factor 88. We showed that traditional Bulgarian yogurt could exert immunostimulatory effects by selecting starter strains and part of the mechanisms depend on IFN-γ inducible EPS produced

  15. Human genetic polymorphisms in T1R1 and T1R3 taste receptor subunits affect their function.

    OpenAIRE

    Raliou, Mariam; Grauso, Marta; Hoffmann, Brice; Schlegel-Le-Poupon, Claire; Nespoulous, Claude; Débat, Hélène; Belloir, Christine; Wiencis, Anna; Sigoillot, Maud; Bano, Singh Preet; Trotier, Didier; Pernollet, Jean-Claude; MONTMAYEUR, Jean-Pierre; Faurion, Annick; Briand, Loïc

    2011-01-01

    International audience; Umami is the typical taste induced by monosodium glutamate (MSG), which is thought to be detected by the heterodimeric G protein-coupled receptor, T1R1 and T1R3. Previously, we showed that MSG detection thresholds differ substantially between individuals and we further showed that nontaster and hypotaster subjects are associated with nonsynonymous single polymorphisms occurring in the T1R1 and T1R3 genes. Here, we show using functional expression that both amino acid s...

  16. Human Genetic Polymorphisms in T1R1 and T1R3 Taste Receptor Subunits Affect Their Function

    OpenAIRE

    Raliou, Mariam; Grauso, Marta; Hoffmann, Brice; Schlegel-Le-Poupon, Claire; Nespoulous, Claude; Debat, Helene; Belloir, Christine; Wiencis, Ana; Sigoillot, Maud; Bano, Singh Preet; Trotier, Didier; Pernollet, J Claude; MONTMAYEUR, Jean-Pierre; Faurion, Annick

    2011-01-01

    International audience; Umami is the typical taste induced by monosodium glutamate (MSG), which is thought to be detected by the heterodimeric G protein-coupled receptor, T1R1 and T1R3. Previously, we showed that MSG detection thresholds differ substantially between individuals and we further showed that nontaster and hypotaster subjects are associated with nonsynonymous single polymorphisms occurring in the T1R1 and T1R3 genes. Here, we show using functional expression that both amino acid s...

  17. New digital control system for the operation of the Colombian research reactor IAN-R1; Nuevo sistema de control digital para la operacion del reactor de investigacion Colombiano IAN-R1

    Energy Technology Data Exchange (ETDEWEB)

    Celis del A, L.; Rivero, T.; Bucio, F.; Ramirez, R.; Segovia, A.; Palacios, J., E-mail: lina.celis@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2015-09-15

    En 2011, Mexico won the Colombian international tender for the renewal of instrumentation and control of the IAN-R1 Reactor, to Argentina and the United States. This paper presents the design criteria and the development made for the new digital control system installed in the Colombian nuclear reactor IAN-R1, which is based on a redundant and diverse architecture, which provides increased availability, reliability and safety in the reactor operation. This control system and associated instrumentation met all national export requirements, with the safety requirements established by the IAEA as well as the requirements demanded by the Colombian Regulatory Body in nuclear matter. On August 20, 2012, the Colombian IAN-R1 reactor reached its first criticality controlled with the new system developed at Instituto Nacional de Investigaciones Nucleares (ININ). On September 14, 2012, the new control system of the Colombian IAN-R1 reactor was officially handed over to the Colombian authorities, this being the first time that Mexico exported nuclear technology through the ININ. Currently the reactor is operating successfully with the new control system, and has an operating license for 5 years. (Author)

  18. Parameter Estimation

    DEFF Research Database (Denmark)

    Sales-Cruz, Mauricio; Heitzig, Martina; Cameron, Ian

    2011-01-01

    In this chapter the importance of parameter estimation in model development is illustrated through various applications related to reaction systems. In particular, rate constants in a reaction system are obtained through parameter estimation methods. These approaches often require the application...... of optimisation techniques coupled with dynamic solution of the underlying model. Linear and nonlinear approaches to parameter estimation are investigated. There is also the application of maximum likelihood principles in the estimation of parameters, as well as the use of orthogonal collocation to generate a set...... of algebraic equations as the basis for parameter estimation.These approaches are illustrated using estimations of kinetic constants from reaction system models....

  19. The architecture of the BubR1 tetratricopeptide tandem repeat defines a protein motif underlying mitotic checkpoint-kinetochore communication

    DEFF Research Database (Denmark)

    Bolanos-Garcia, Victor M; Nilsson, Jakob; Blundell, Tom L

    2012-01-01

    as substitution of BubR1 residues engaged in KNL1 binding impaired the SAC and BubR1 recruitment into checkpoint complexes in stable cell lines. Here we discuss the implications of the disorder-to-order transition of KNL1 upon BubR1 binding for SAC signaling and propose a mechanistic model of how BUBs binding may...

  20. Application of Powder Diffraction Methods to the Analysis of Short- and Long-Range Atomic Order in Nanocrystalline Diamond and SiC: The Concept of the Apparent Lattice Parameter (alp)

    Science.gov (United States)

    Palosz, B.; Grzanka, E.; Gierlotka, S.; Stelmakh, S.; Pielaszek, R.; Bismayer, U.; Weber, H.-P.; Palosz, W.

    2003-01-01

    Two methods of the analysis of powder diffraction patterns of diamond and SiC nanocrystals are presented: (a) examination of changes of the lattice parameters with diffraction vector Q ('apparent lattice parameter', alp) which refers to Bragg scattering, and (b), examination of changes of inter-atomic distances based on the analysis of the atomic Pair Distribution Function, PDF. Application of these methods was studied based on the theoretical diffraction patterns computed for models of nanocrystals having (i) a perfect crystal lattice, and (ii), a core-shell structure, i.e. constituting a two-phase system. The models are defined by the lattice parameter of the grain core, thickness of the surface shell, and the magnitude and distribution of the strain field in the shell. X-ray and neutron experimental diffraction data of nanocrystalline SiC and diamond powders of the grain diameter from 4 nm up to micrometers were used. The effects of the internal pressure and strain at the grain surface on the structure are discussed based on the experimentally determined dependence of the alp values on the Q-vector, and changes of the interatomic distances with the grain size determined experimentally by the atomic Pair Distribution Function (PDF) analysis. The experimental results lend a strong support to the concept of a two-phase, core and the surface shell structure of nanocrystalline diamond and SiC.

  1. Synthesis and physical-chemical properties of 6-(5-(1Н-tetrazole-1-ylmethyl-4-R-1,2,4-triazole-3-ylthiopyridin-3-amines and 6-((5-(1Н-tetrazole-1-ylmethil-4-R-1,2,4-triazole-3-ylthiopyridin-3-yl-(alk,ar,heterylmethanimines

    Directory of Open Access Journals (Sweden)

    Yu. S. Hulina

    2017-02-01

    compounds, which have not been described previously, were obtained during the synthetic studies. The computer prediction was performed using PASS online service, it was found that the synthesized 6-(5-(1Н-tetrazole-1-ylmethyl-4-R-1,2,4-triazole-3-ylthiopyridin-3-amines and 6-((5-(1Н-tetrazole-1-ylmethil-4-R-1,2,4-triazole-3-ylthiopyridin-3-yl-(alk,ar,heterylmethanimines are low-toxic compounds and exhibit a wide range of biological actions, which corresponds to literature data. Conclusions. The results of our work have confirmed the structure of the synthesized compounds, which indicates the possibility of their further use in biological studies.

  2. Wave-of-advance models of the diffusion of the Y chromosome haplogroup R1b1b2 in Europe.

    Directory of Open Access Journals (Sweden)

    Per Sjödin

    Full Text Available Whether or not the spread of agriculture in Europe was accompanied by movements of people is a long-standing question in archeology and anthropology, which has been frequently addressed with the help of population genetic data. Estimates on dates of expansion and geographic origins obtained from genetic data are however sensitive to the calibration of mutation rates and to the mathematical models used to perform inference. For instance, recent data on the Y chromosome haplogroup R1b1b2 (M269 have either suggested a Neolithic origin for European paternal lineages or a more ancient Paleolithic origin depending on the calibration of Y-STR mutation rates. Here we examine the date of expansion and the geographic origin of hgR1b1b2 considering two current estimates of mutation rates in a total of fourteen realistic wave-of-advance models. We report that a range expansion dating to the Paleolithic is unlikely to explain the observed geographical distribution of microsatellite diversity, and that whether the data is informative with respect to the spread of agriculture in Europe depends on the mutation rate assumption in a critical way.

  3. Efficient bioremediation of radioactive iodine using biogenic gold nanomaterial-containing radiation-resistant bacterium, Deinococcus radiodurans R1.

    Science.gov (United States)

    Choi, Mi Hee; Jeong, Sun-Wook; Shim, Ha Eun; Yun, Seong-Jae; Mushtaq, Sajid; Choi, Dae Seong; Jang, Beom-Su; Yang, Jung Eun; Choi, Yong Jun; Jeon, Jongho

    2017-04-04

    We herein report a new bioremediation method using a radiation-resistant bacterium. Biogenic gold nanomaterial-containing Deinococcus radiodurans R1 showed excellent capability for the removal of radioactive iodine (>99%) in several aqueous solutions. These observations demonstrated that our remediation system would be efficiently applied to the treatment of radioactive wastes.

  4. Inducible gene expression mediated by a repressor-operator system isolated from Lactococcus lactis bacteriophage r1t

    NARCIS (Netherlands)

    Nauta, Arjen; Sinderen, Douwe van; Karsens, Harma; Smit, Egbert; Venema, Gerard; Kok, Jan

    A regulatory region of the temperate Lactococcus lactis bacteriophage r1t chromosome has been cloned and characterized, It encompasses the two divergently oriented genes rro, encoding the phage repressor, and tee. Both genes, of which the transcription start sites have been mapped, are preceded by

  5. Effect of Wenxin Granules on Gap Junction and MiR-1 in Rats with Myocardial Infarction

    Directory of Open Access Journals (Sweden)

    Aiming Wu

    2017-01-01

    Full Text Available Myocardial infarction (MI patients are at high risk of potential lethal arrhythmia. Gap junction and microRNA-1 (miR-1 are both arrhythmia generating conditions. The present study investigated whether Wenxin Granules (Wenxin-Keli, WXKL could prevent potential lethal arrhythmia by improving gap junctions and miR-1 following MI. Male Sprague-Dawley rats were divided randomly into control, model, metoprolol, low dose WXKL, and high dose WXKL groups. The MI rat model was created by coronary artery ligation. Treatments were administrated intragastrically to the rats for 4 weeks. Conventional transmission electron microscopy was performed to observe the ultrastructure of gap junctions. Quantitative real-time PCR and western blotting were used to detect the expression of miR-1, protein kinase C (PKC, and related proteins. Additionally, a programmatic electrophysiological stimulation test was performed to detect the ventricular fibrillation threshold (VFT. WXKL protected the ultrastructure of the gap junctions and their constituent Cx43 by regulating miR-1 and PKC mediated signal transduction and increased the VFT significantly in the rat MI model. The results suggested that WXKL is an effective alternative medicine to prevent potentially lethal arrhythmia following MI.

  6. Normas do Teste de Inteligência Não Verbal R-1 para adultos não alfabetizados

    Directory of Open Access Journals (Sweden)

    Maria Olinda Gottsfritz

    2009-10-01

    Full Text Available The R-1: Non-Verbal Intelligence Test is a Brazilian test to measure general intelligence. It was created to assess future drivers. However, the last published test manual does not have standards for illiterate adults. This study was designed to establish norms in the R-1 Test among illiterate adults and to present an analysis of frequencies of success for each item. The sample was composed by 151 adults, aged from 16 to 77 years of both sexes, enrolled in literacy courses in São Paulo city. The R-1 Test was collectively administered, with no time limits. Results indicated that illiterate adult’s means were lower than more educated people, confirming that education influences intelligence test scores, as it was suggested by literature. A comparison of the relative frequencies of passing individual items between the illiterate group and the more educated sample, revealed that items presented the same relative difficulty to both, although success percentages were lower for the illiterate group.   Keywords: R-1 Test; illiteracy; intellectual development; intelligence tests.

  7. On the Composition and Neutrix Composition of the Delta Function and the Function cosh^{-1}(|x|^{1/r}+1

    Directory of Open Access Journals (Sweden)

    Brian Fisher

    2017-03-01

    Full Text Available Let $F$ be a distribution in $\\mathcal{D'}$ and let $f$ be a locally summable function. The composition $F(f(x$ of $F$ and $f$ is said to exist and be equal to the distribution $h(x$ if the limit of the sequence $\\{ F_{n}(f(x\\}$ is equal to $h(x$, where $F_n(x =F(x*\\delta _n(x$ for $n=1,2, \\ldots$ and $\\{\\delta_n(x\\}$ is a certain regular sequence converging to the Dirac delta function. It is proved that the neutrix composition $ \\delta^{(s}[\\cosh^{-1} (x_+^{1/r}+1] $ exists and \\beqa \\delta^{(s}[\\cosh^{-1} (x_+^{1/r}+1] = - \\sum _{k=0} ^{M-1} \\sum_{i=0}^{kr+r} {k \\choose i}{(-1^{i+k}rc_{r,s,k} \\over (kr+rk!}\\delta ^{(k}(x, for $s =M-1,M, M+1,\\ldots$ and $r=1,2,\\ldots,$ where $$c_{r,s,k}=\\sum _{j=0}^{i} {i \\choose j}{ (-1^{kr+r-i}(2j-i^{s+1}\\over 2^{s+i+1} },$$ $M$ is the smallest integer for which $s-2r+1 < 2Mr$ and $r\\le s/(2M+2.$ Further results are also proved.

  8. Evaluation of R1-6 gateway treatment alternatives for pedestrian crossings : follow-up report : final report.

    Science.gov (United States)

    2017-06-01

    Monthly follow-up data confirmed that permanent in roadway installations of the R1-6 gateway treatment led to an : increase in the percentage of drivers yielding to pedestrians at midblock and multilane urban and suburban locations : from 15% to 70% ...

  9. Gas Antisolvent Approach for the Precipitation of α -Methoxyphenylacetic Acid – ( R -1-Cyclohexylethylamine Diateromeric Salt

    Directory of Open Access Journals (Sweden)

    A. Zodge

    2017-10-01

    Full Text Available One of the major drawbacks of diastereomeric salt precipitation based enantioseparation is the time and solvent requirement of crystallization. In the gas antisolvent (GAS approach, supercritical carbon dioxide is applied as an antisolvent, and the precipitation takes place in a couple of minutes. By setting the process parameters diastereomeric excess, yields, and selectivity can be controlled. Applicability of the process is demonstrated on the resolution of racemic 2-methoxyphenylacetic acid with enantiopure (R-(−-1-cyclohexylethylamine. Diastereomeric excess values over 55 % along with 80 % yields were achieved at optimal conditions in a single step.

  10. Transfer protein TraY of plasmid R1 stimulates TraI-catalyzed oriT cleavage in vivo.

    Science.gov (United States)

    Karl, W; Bamberger, M; Zechner, E L

    2001-02-01

    The effect of TraY protein on TraI-catalyzed strand scission at the R1 transfer origin (oriT) in vivo was investigated. As expected, the cleavage reaction was not detected in Escherichia coli cells expressing tral and the integration host factor (IHF) in the absence of other transfer proteins. The TraM dependence of strand scission was found to be inversely correlated with the presence of TraY. Thus, the TraY and TraM proteins could each enhance cleaving activity at oriT in the absence of the other. In contrast, no detectable intracellular cleaving activity was exhibited by TraI in an IHF mutant strain despite the additional presence of both TraM and TraY. An essential role for IHF in this reaction in vivo is, therefore, implied. Mobilization experiments employing recombinant R1 oriT constructions and a heterologous conjugative helper plasmid were used to investigate the independent contributions of TraY and TraM to the R1 relaxosome during bacterial conjugation. In accordance with earlier observations, traY was dispensable for mobilization in the presence of traM, but mobilization did not occur in the absence of both traM and traY. Interestingly, although the cleavage assays demonstrate that TraM and TraY independently promote strand scission in vivo, TraM remained essential for mobilization of the R1 origin even in the presence of TraY. These findings suggest that, whereas TraY and TraM function may overlap to a certain extent in the R1 relaxosome, TraM additionally performs a second function that is essential for successful conjugative transmission of plasmid DNA.

  11. Identification of potential small molecule allosteric modulator sites on IL-1R1 ectodomain using accelerated conformational sampling method.

    Directory of Open Access Journals (Sweden)

    Chao-Yie Yang

    Full Text Available The interleukin-1 receptor (IL-1R is the founding member of the interleukin 1 receptor family which activates innate immune response by its binding to cytokines. Reports showed dysregulation of cytokine production leads to aberrant immune cells activation which contributes to auto-inflammatory disorders and diseases. Current therapeutic strategies focus on utilizing antibodies or chimeric cytokine biologics. The large protein-protein interaction interface between cytokine receptor and cytokine poses a challenge in identifying binding sites for small molecule inhibitor development. Based on the significant conformational change of IL-1R type 1 (IL-1R1 ectodomain upon binding to different ligands observed in crystal structures, we hypothesized that transient small molecule binding sites may exist when IL-1R1 undergoes conformational transition and thus suitable for inhibitor development. Here, we employed accelerated molecular dynamics (MD simulation to efficiently sample conformational space of IL-1R1 ectodomain. Representative IL-1R1 ectodomain conformations determined from the hierarchy cluster analysis were analyzed by the SiteMap program which leads to identify small molecule binding sites at the protein-protein interaction interface and allosteric modulator locations. The cosolvent mapping analysis using phenol as the probe molecule further confirms the allosteric modulator site as a binding hotspot. Eight highest ranked fragment molecules identified from in silico screening at the modulator site were evaluated by MD simulations. Four of them restricted the IL-1R1 dynamical motion to inactive conformational space. The strategy from this study, subject to in vitro experimental validation, can be useful to identify small molecule compounds targeting the allosteric modulator sites of IL-1R and prevent IL-1R from binding to cytokine by trapping IL-1R in inactive conformations.

  12. Common variants in CYP2R1 and GC genes predict vitamin D concentrations in healthy Danish children and adults.

    Directory of Open Access Journals (Sweden)

    Janna Nissen

    Full Text Available Environmental factors such as diet, intake of vitamin D supplements and exposure to sunlight are known to influence serum vitamin D concentrations. Genetic epidemiology of vitamin D is in its infancy and a better understanding on how genetic variation influences vitamin D concentration is needed. We aimed to analyse previously reported vitamin D-related polymorphisms in relation to serum 25(OHD concentrations in 201 healthy Danish families with dependent children in late summer in Denmark. Serum 25(OHD concentrations and a total of 25 SNPs in GC, VDR, CYP2R1, CYP24A1, CYP27B1, C10or88 and DHCR7/NADSYN1 genes were analysed in 758 participants. Genotype distributions were in Hardy-Weinberg equilibrium for the adult population for all the studied polymorphisms. Four SNPs in CYP2R1 (rs1562902, rs7116978, rs10741657 and rs10766197 and six SNPs in GC (rs4588, rs842999, rs2282679, rs12512631, rs16846876 and rs17467825 were statistically significantly associated with serum 25(OHD concentrations in children, adults and all combined. Several of the SNPs were in strong linkage disequilibrium, and the associations were driven by CYP2R1-rs10741657 and rs10766197, and by GC-rs4588 and rs842999. Genetic risk score analysis showed that carriers with no risk alleles of CYP2R1-rs10741657 and rs10766197, and/or GC rs4588 and rs842999 had significantly higher serum 25(OHD concentrations compared to carriers of all risk alleles. To conclude, our results provide supporting evidence that common polymorphisms in GC and CYP2R1 are associated with serum 25(OHD concentrations in the Caucasian population and that certain haplotypes may predispose to lower 25(OHD concentrations in late summer in Denmark.

  13. On Range of Skill

    DEFF Research Database (Denmark)

    Hansen, Thomas Dueholm; Miltersen, Peter Bro; Sørensen, Troels Bjerre

    2008-01-01

    is a small number, but only gave heuristic arguments for this. In this paper, we provide the first methods for rigorously estimating the Range of Skill of a given game. We provide some general, asymptotic bounds that imply that the Range of Skill of a perfectly balanced game tree is almost exponential in its......At AAAI'07, Zinkevich, Bowling and Burch introduced the Range of Skill measure of a two-player game and used it as a parameter in the analysis of the running time of an algorithm for finding approximate solutions to such games. They suggested that the Range of Skill of a typical natural game...... size (and doubly exponential in its depth). We also provide techniques that yield concrete bounds for unbalanced game trees and apply these to estimate the Range of Skill of Tic-Tac-Toe and Heads-Up Limit Texas Hold'em Poker. In particular, we show that the Range of Skill of Tic-Tac-Toe is more than...

  14. Thyrotropin-releasing hormone receptor type 1 (TRH-R1), not TRH-R2, primarily mediates taltirelin actions in the CNS of mice.

    Science.gov (United States)

    Thirunarayanan, Nanthakumar; Nir, Eshel A; Raaka, Bruce M; Gershengorn, Marvin C

    2013-05-01

    Thyrotropin-releasing hormone receptor type 2 (TRH-R2), not TRH-R1, has been proposed to mediate the CNS effects of TRH and its more effective analog taltirelin (TAL). Consistent with this idea, TAL exhibited higher binding affinity and signaling potency at mouse TRH-R2 than TRH-R1 in a model cell system. We used TRH-R1 knockout (R1ko), R2ko and R1/R2ko mice to determine which receptor mediates the CNS effects of TAL. There was no TRH-R1 mRNA in R1ko and R1/R2ko mice and no TRH-R2 mRNA in R2ko and R1/R2ko mice. Specific [(3)H]MeTRH binding to whole brain membranes was 5% of wild type (WT) for R1ko mice, 100% for R2ko mice and 0% for R1/R2ko mice, indicating TRH-R1 is the predominant receptor expressed in the brain. In arousal assays, TAL shortened sleep time with pentobarbital sedation in WT and R2ko mice by 44 and 49% and with ketamine/xylazine sedation by 66 and 55%, but had no effect in R1ko and R1/R2ko mice. In a tail flick assay of nociception, TAL increased response latency by 65 and 70% in WT and R2ko mice, but had no effect in R1ko and R1/R2ko mice. In a tail suspension test of depression-like behavior, TAL increased mobility time by 49 and 37% in WT and R2ko mice, but had no effect in R1ko and R1/R2ko mice. Thus, in contrast to the generally accepted view that the CNS effects of TAL are mediated by TRH-R2, these effects are mediated primarily if not exclusively by TRH-R1 in mice.

  15. Orthogonal Range Searching on the RAM, Revisited

    DEFF Research Database (Denmark)

    Chan, Timothy M.; Larsen, Kasper Green; Patrascu, Mihai

    2011-01-01

    We present a number of new results on one of the most extensively studied topics in computational geometry, orthogonal range searching. All our results are in the standard word RAM model: We present two data structures for 2-d orthogonal range emptiness. The first achieves O(n lg lg n) space and O...... the output size. This resolves two open problems (both appeared in Preparata and Shamos' seminal book): given a set of n axis-aligned rectangles in the plane, we can report all k enclosure pairs (i.e., pairs (r1,r2) where rectangle r1 completely encloses rectangle r2) in O(n lg n + k) expected time; given...

  16. Teste de Inteligência R1-Forma B e G36: evidência de validade convergente R1-Forma B Intelligence Test and G36: evidences of convergent validity

    Directory of Open Access Journals (Sweden)

    Acácia A. Angeli dos Santos

    2005-08-01

    Full Text Available Considerando-se a relevância de se obter medidas confiáveis para a avaliação da inteligência, este estudo foi proposto com o objetivo de verificar a validade convergente entre os testes R1-Forma B e o G36. Participaram 78 alunos que freqüentavam o Telecurso do ensino médio, com idades entre 15 e 64 anos (média = 36,84; DP = 10,10, sendo 27 (34,6% do sexo feminino e 51 (65,4% do masculino. Os resultados apontaram para uma alta correlação entre os testes (r = 0,80, o que permite afirmar que medem o mesmo construto. Apesar disso, a hipótese de que o G36 estaria mais correlacionado com o Fator 2 do R-1 não pôde ser confirmada. Esse dado pode indicar que o G36 não seja unidimensional e se relacione mais com a inteligência cristalizada do que com o fator g.Considering the relevance of obtaining trustful measurement for the evaluation of intelligence, this study aimed at verifying the convergent validity between the R1-Forma B and the G36 tests. 78 students of both gender (34,6% female and 65,4% male, aged from 15 to 64 years old (mean = 36,84; SD = 10,10 and attending to the high school Telecurso were studied. The results indicated a high correlation between tests (r = 0.80, what allowed for the statement that they measure similar constructs. Nevertheless, the hypothesis that G36 would be more correlated with Factor 2 of R-1 could not be confirmed. This information suggests that the G36 is not unidimensional and is more related to crystallized intelligence than the g factor.

  17. Identification for the optimal working parameters of Ti-6Al-4V-0.1Ru alloy in a wide deformation condition range by processing maps based on DMM

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Yu-feng; Long, Shuai; Zhou, Yu-ting; Zhao, Jia; Wang, Tian-yu; Zhou, Jie, E-mail: kkyttyls@vip.qq.com [School of Material Science and Engineering, Chongqing University (China)

    2016-11-15

    The hot deformation behaviours of Ti-6Al-4V-0.1Ru alloy were investigated by isothermal hot compression tests in the temperature range of 1023-1423 K and strain rate range of 0.01-10 s{sup -1}. The β transus was determined to be 1198 K by continuous heating method. The values of deformation activation energy Q at the strain of 0.3 were calculated to be 630.01 kJ/mol in dual-phase field and 331.75 kJ/mol in β-phase field. Moreover, the processing maps at the strain of 0.2, 0.4, 0.6 and 0.8 were developed based on dynamic materials model (DMM). To deeply understand the microstructure evolution mechanism during hot deformation processes and to verify the processing maps, the microstructures at different deformation conditions were observed. The stable microstructures (i.e. globularization, dynamic recovery (DRV) and β dynamic recrystallization (β-DRX)) and instable microstructures (i.e. lamellae kinking and flow localization) were obtained. To make it useful in the design of industrial hot working schedules for this material, a microstructural mechanism map was constructed on the basis of processing maps and microstructure observation. Deformation conditions in the vicinity of 1150 K & 0.01 s{sup -1} where globularization occurs and in the vicinity of 1323 K & 0.01 s{sup -1} where β-DRX occurs are recommended. (author)

  18. Distinct domains in Bub1 localize RZZ and BubR1 to kinetochores to regulate the checkpoint

    DEFF Research Database (Denmark)

    Zhang, Gang; Lischetti, Tiziana; Hayward, Daniel G

    2015-01-01

    The spindle assembly checkpoint (SAC) ensures proper chromosome segregation by delaying anaphase onset in response to unattached kinetochores. Checkpoint signalling requires the kinetochore localization of the Mad1-Mad2 complex that in more complex eukaryotes depends on the Rod-Zwilch-ZW10 (RZZ......) complex. The kinetochore protein Zwint has been proposed to be the kinetochore receptor for RZZ, but here we show that Bub1 and not Zwint is required for RZZ recruitment. We find that the middle region of Bub1 encompassing a domain essential for SAC signalling contributes to RZZ localization. In addition......, we show that a distinct region in Bub1 mediates kinetochore localization of BubR1 through direct binding, but surprisingly removal of this region increases checkpoint strength. Our work thus uncovers how Bub1 coordinates checkpoint signalling by distinct domains for RZZ and BubR1 recruitment...

  19. Anaplastic Thyroid Carcinoma: Current Treatments and Potential New Therapeutic Options with Emphasis on TfR1/CD71

    Directory of Open Access Journals (Sweden)

    Rosalba Parenti

    2014-01-01

    Full Text Available Anaplastic thyroid carcinoma (ATC is one of the most aggressive human cancers. Actually, ATC is refractory to conventional therapies, including surgery, chemotherapy, radiotherapy, and radioiodine (131I therapy. Accordingly, genetic and molecular characterizations of ATC have been frequently and periodically reviewed in order to identify potential biological markers exploitable for target therapy. This review briefly focuses on main molecular events that characterize ATC and provides an update about preclinical studies. In addition, the overexpression of transferrin receptor 1 (TfR1/CD71 by neoplastic cells of ATC is emphasized in that it could represent a potential therapeutic target. In this regard, new therapeutic approaches based on the use of monoclonal or recombinant antibodies, or transferrin-gallium-TfR1/CD71 molecular complexes, or lastly small interfering RNAs (siRNAs are proposed.

  20. Inventory parameters

    CERN Document Server

    Sharma, Sanjay

    2017-01-01

    This book provides a detailed overview of various parameters/factors involved in inventory analysis. It especially focuses on the assessment and modeling of basic inventory parameters, namely demand, procurement cost, cycle time, ordering cost, inventory carrying cost, inventory stock, stock out level, and stock out cost. In the context of economic lot size, it provides equations related to the optimum values. It also discusses why the optimum lot size and optimum total relevant cost are considered to be key decision variables, and uses numerous examples to explain each of these inventory parameters separately. Lastly, it provides detailed information on parameter estimation for different sectors/products. Written in a simple and lucid style, it offers a valuable resource for a broad readership, especially Master of Business Administration (MBA) students.

  1. IEA-R1 Nuclear Research Reactor: 58 Years of Operating Experience and Utilization for Research, Teaching and Radioisotopes Production

    Energy Technology Data Exchange (ETDEWEB)

    Cardenas, Jose Patricio Nahuel; Filho, Tufic Madi; Saxena, Rajendra; Filho, Walter Ricci [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Instituto de Pesquisas Energeticas e Nucleares - IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242 Cid Universitaria CEP: 05508-000- Sao Paulo-SP (Brazil)

    2015-07-01

    IEA-R1 research reactor at the Instituto de Pesquisas Energeticas e Nucleares (Nuclear and Energy Research Institute) IPEN, Sao Paulo, Brazil is the largest power research reactor in Brazil, with a maximum power rating of 5 MWth. It is being used for basic and applied research in the nuclear and neutron related sciences, for the production of radioisotopes for medical and industrial applications, and for providing services of neutron activation analysis, real time neutron radiography, and neutron transmutation doping of silicon. IEA-R1 is a swimming pool reactor, with light water as the coolant and moderator, and graphite and beryllium as reflectors. The reactor was commissioned on September 16, 1957 and achieved its first criticality. It is currently operating at 4.5 MWth with a 60-hour cycle per week. In the early sixties, IPEN produced {sup 131}I, {sup 32}P, {sup 198}Au, {sup 24}Na, {sup 35}S, {sup 51}Cr and labeled compounds for medical use. During the past several years, a concerted effort has been made in order to upgrade the reactor power to 5 MWth through refurbishment and modernization programs. One of the reasons for this decision was to produce {sup 99}Mo at IPEN. The reactor cycle will be gradually increased to 120 hours per week continuous operation. It is anticipated that these programs will assure the safe and sustainable operation of the IEA-R1 reactor for several more years, to produce important primary radioisotopes {sup 99}Mo, {sup 125}I, {sup 131}I, {sup 153}Sm and {sup 192}Ir. Currently, all aspects of dealing with fuel element fabrication, fuel transportation, isotope processing, and spent fuel storage are handled by IPEN at the site. The reactor modernization program is slated for completion by 2015. This paper describes 58 years of operating experience and utilization of the IEA-R1 research reactor for research, teaching and radioisotopes production. (authors)

  2. Direct binding between BubR1 and B56-PP2A phosphatase complexes regulate mitotic progression

    DEFF Research Database (Denmark)

    Kruse, Thomas; Zhang, Gang; Larsen, Marie Sofie Yoo

    2013-01-01

    but the mechanism behind this is not clear. Here we show that BubR1 directly binds to the B56 family of PP2A regulatory subunits through a conserved motif that is phosphorylated by Cdk1 and Plk1. Two highly conserved hydrophobic residues surrounding the S670 Cdk1 phosphorylation site are required for B56 binding...... Aurora B kinase activity at improperly attached kinetochores by recruiting B56-PP2A phosphatase complexes....

  3. Feasibility studies of producing {sup 99} Mo by capture in the IEA-R1 research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Concilio, Roberta; Mendonca, Arlindo Gilson; Maiorino, Jose Rubens [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mail: maiorino@net.ipen.br; amendon@net.ipen.br

    1998-07-01

    Everyday the production of {sup 99} Mo for {sup 99m} Tc generators, becomes more necessary, whose properties are ideal for medical diagnosis. This works presents a description and an analysis of the production of {sup 99} Mo by radioactive capture at {sup 98} Mo using the research reactor IEA-R1 in 5 MW and operating 5 days a week, referring to the use of targets, separation methods, total and specific activity attained and its limitations. (author)

  4. PLSCR1/IP3R1/Ca2+ axis contributes to differentiation of primary AML cells induced by wogonoside.

    Science.gov (United States)

    Li, Hui; Xu, Jingyan; Zhou, Yuxin; Liu, Xiao; Shen, L E; Zhu, Y U; Li, Zhiyu; Wang, Xiaotang; Guo, Qinglong; Hui, Hui

    2017-05-11

    Multiple lines of evidence have demonstrated that increased expression of phospholipid scramblase 1 (PLSCR1) is involved in the differentiation of acute myeloid leukemia (AML) cells by several differentiation-inducing agents including ATRA and phorbol 12-myristate 13-acetate. However, none of these agents can achieve nonhomogenous subcellular distribution of PLSCR1. We have demonstrated that wogonoside possesses differentiation and anti-leukemic effects in AML cell lines by promoting PLSCR1 trafficking into nucleus. Here we report that wogonoside promotes the expression of PLSCR1 and enhances its nuclear translocation and binding to the 1, 4, 5-trisphosphate receptor 1 (IP3R1) promoter in AML patient-derived primary cells. Wogonoside activates IP3R1, in turn, promotes release of Ca2+ from endoplasmic reticulum, and eventually leads to cell differentiation. Our in vivo study further confirms that wogonoside can promote PLSCR1 and IP3R1 expression in primary AML cells and reduce the AML cell counts in engrafted nonobese diabetic/severe combined immunodeficient mice. Taken together, our findings provide new insight into the mechanism of wogonoside-induced differentiation and anti-leukemic effect on primary AML cells, suggesting the therapeutic potential of wogonoside for AML, especially for non-APL AML.

  5. The internal Cdc20 binding site in BubR1 facilitates both spindle assembly checkpoint signalling and silencing

    DEFF Research Database (Denmark)

    Lischetti, Tiziana; Zhang, Gang; Sedgwick, Garry G

    2014-01-01

    Improperly attached kinetochores activate the spindle assembly checkpoint (SAC) and by an unknown mechanism catalyse the binding of two checkpoint proteins, Mad2 and BubR1, to Cdc20 forming the mitotic checkpoint complex (MCC). Here, to address the functional role of Cdc20 kinetochore localization...... in the SAC, we delineate the molecular details of its interaction with kinetochores. We find that BubR1 recruits the bulk of Cdc20 to kinetochores through its internal Cdc20 binding domain (IC20BD). We show that preventing Cdc20 kinetochore localization by removal of the IC20BD has a limited effect...... on the SAC because the IC20BD is also required for efficient SAC silencing. Indeed, the IC20BD can disrupt the MCC providing a mechanism for its role in SAC silencing. We thus uncover an unexpected dual function of the second Cdc20 binding site in BubR1 in promoting both efficient SAC signalling and SAC...

  6. Impaired IFNγ-Signaling and Mycobacterial Clearance in IFNγR1-Deficient Human iPSC-Derived Macrophages

    Directory of Open Access Journals (Sweden)

    Anna-Lena Neehus

    2018-01-01

    Full Text Available Mendelian susceptibility to mycobacterial disease (MSMD is caused by inborn errors of interferon gamma (IFNγ immunity and is characterized by severe infections by weakly virulent mycobacteria. Although IFNγ is the macrophage-activating factor, macrophages from these patients have never been studied. We demonstrate the generation of heterozygous and compound heterozygous (iMSMD-cohet induced pluripotent stem cells (iPSCs from a single chimeric patient, who suffered from complete autosomal recessive IFNγR1 deficiency and received bone-marrow transplantation. Loss of IFNγR1 expression had no influence on the macrophage differentiation potential of patient-specific iPSCs. In contrast, lack of IFNγR1 in iMSMD-cohet macrophages abolished IFNγ-dependent phosphorylation of STAT1 and induction of IFNγ-downstream targets such as IRF-1, SOCS-3, and IDO. As a consequence, iMSMD-cohet macrophages show impaired upregulation of HLA-DR and reduced intracellular killing of Bacillus Calmette-Guérin. We provide a disease-modeling platform that might be suited to investigate novel treatment options for MSMD and to gain insights into IFNγ signaling in macrophages.

  7. Antibody-Based Protective Immunity against Helminth Infections: Antibody Phage Display Derived Antibodies against BmR1 Antigen

    Directory of Open Access Journals (Sweden)

    Anizah Rahumatullah

    2017-11-01

    Full Text Available Helminth parasite infections are significantly impacting global health, with more than two billion infections worldwide with a high morbidity rate. The complex life cycle of the nematodes has made host immune response studies against these parasites extremely difficult. In this study, we utilized two phage antibody libraries; the immune and naïve library were used to identify single chain fragment variable (scFv clones against a specific filarial antigen (BmR1. The V-gene analysis of isolated scFv clones will help shed light on preferential VDJ gene segment usage against the filarial BmR1 antigen in healthy and infected states. The immune library showed the usage of both lambda and kappa light chains. However, the naïve library showed preferential use of the lambda family with different amino acid distributions. The binding characteristics of the scFv clones identified from this work were analyzed by immunoassay and immunoaffinity pull down of BmR1. The work highlights the antibody gene usage pattern of a naïve and immune antibody library against the same antigen as well as the robust nature of the enriched antibodies for downstream applications.

  8. Implementation of the optimization for the methodology of the neutronic calculation and thermo-hydraulic in IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Stefani, Giovanni Laranjo de; Conti, Thadeu das Neves; Fedorenko, Giuliana G.; Castro, Vinicius A.; Maio, Mireia F., E-mail: gstefani@ipen.b, E-mail: tnconti@ipen.b, E-mail: g.fedorenko@ipen.b, E-mail: vcastro@ipen.b, E-mail: mfmaio@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Santos, Thiago Augusto dos, E-mail: tsantos@ipen.b [Universidade de Sao Paulo (IFUSP), Sao Paulo, SP (Brazil). Inst. de Fisica

    2011-07-01

    This work objective was to create a manager program that would automate the programs and computer codes in use for neutronic calculation and thermo-hydraulic in IEA-R1 reactor thus making the process for calculation of safety parameters and for configuration change up to 98% faster than that used in the reactor today. This process was tested in combination with the reactor operators and is being implemented by the quality department. The main codes and programs involved in the calculations of configuration change are Leopard, Hammier-Technion, Twodb, Citation and Cobra. Calculations of delayed neutron and criticality coefficients given in the process of safety parameters calculation are given by the Hammer-Technion and Citation in a process that involves about eleven repetitions so that it meets all the necessary conditions (such different temperatures of the moderator and fuel). The results are entirely consistent with the expected and absolutely the same as those given by manual process. Thus the work shows its reliability as well the advantage of saving time, once a process that could take up to four hours was turned in one that takes around five minutes when done in a home computer. Much of this advantage is due to the fact that were created subprograms to treat the output of each program used and transform them into the input of the other programs, removing from it the intermediate essential data for this to occur, thus avoiding also a possible human error by handling the various data supplied. (author)

  9. Vitamin D Insufficiency in Arabs and South Asians Positively Associates with Polymorphisms in GC and CYP2R1 Genes

    Science.gov (United States)

    Elkum, Naser; Alkayal, Fadi; Noronha, Fiona; Ali, Maisa M.; Melhem, Motasem; Al-Arouj, Monira; Bennakhi, Abdullah; Behbehani, Kazem; Alsmadi, Osama; Abubaker, Jehad

    2014-01-01

    Background A number of genetic studies have reported an association between vitamin D related genes such as group-specific component gene (GC), Cytochrome P450, family 2, subfamily R, polypeptide 1 (CYP2R1) and 7-dehydrocholesterol reductase/nicotinamide-adenine dinucleotide synthetase 1 (DHCR7/NADSYN1) and serum levels of the active form of Vitamin D, 25 (OH) D among African Americans, Caucasians, and Chinese. Little is known about how genetic variations associate with, or contribute to, 25(OH)D levels in Arabs populations. Methods Allele frequencies of 18 SNPs derived from CYP2R1, GC, and DHCR7/NADSYN1 genes in 1549 individuals (Arabs, South Asians, and Southeast Asians living in Kuwait) were determined using real time genotyping assays. Serum levels of 25(OH)D were measured using chemiluminescence immunoassay. Results GC gene polymorphisms (rs17467825, rs3755967, rs2282679, rs7041 and rs2298850) were found to be associated with 25(OH)D serum levels in Arabs and South Asians. Two of the CYP2R1 SNPs (rs10500804 and rs12794714) and one of GC SNPs (rs1155563) were found to be significantly associated with 25(OH)D serum levels only in people of Arab origin. Across all three ethnicities none of the SNPs of DHCR7/NADSYN1 were associated with serum 25(OH)D levels and none of the 18 SNPs were significantly associated with serum 25(OH)D levels in people from South East Asia. Conclusion Our data show for the first time significant association between the GC (rs2282679 and rs7041), CYP2R1 (rs10741657) SNPs and 25(OH)D levels. This supports their roles in vitamin D Insufficiency in Arab and South Asian populations respectively. Interestingly, two of the CYP2R1 SNPs (rs10500804 and rs12794714) and one GC SNP (rs1155563) were found to correlate with vitamin D in Arab population exclusively signifying their importance in this population. PMID:25405862

  10. Excitation functions of parameters extracted from three-source (net-)proton rapidity distributions in Au-Au and Pb-Pb collisions over an energy range from AGS to RHIC

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Li-Na; Liu, Fu-Hu [Shanxi University, Institute of Theoretical Physics, Taiyuan, Shanxi (China); Sun, Yan; Sun, Zhu [Shanxi Datong University, Department of Physics, Datong, Shanxi (China); Lacey, Roy A. [Stony Brook University, Departments of Chemistry and Physics, Stony Brook, NY (United States)

    2017-03-15

    Experimental results of the rapidity spectra of protons and net-protons (protons minus antiprotons) emitted in gold-gold (Au-Au) and lead-lead (Pb-Pb) collisions, measured by a few collaborations at the alternating gradient synchrotron (AGS), super proton synchrotron (SPS), and relativistic heavy ion collider (RHIC), are described by a three-source distribution. The values of the distribution width σ{sub C} and fraction k{sub C} of the central rapidity region, and the distribution width σ{sub F} and rapidity shift Δy of the forward/backward rapidity regions, are then obtained. The excitation function of σ{sub C} increases generally with increase of the center-of-mass energy per nucleon pair √(s{sub NN}). The excitation function of σ{sub F} shows a saturation at √(s{sub NN}) = 8.8 GeV. The excitation function of k{sub C} shows a minimum at √(s{sub NN}) = 8.8 GeV and a saturation at √(s{sub NN}) ∼ 17 GeV. The excitation function of Δy increases linearly with ln(√(s{sub NN})) in the considered energy range. (orig.)

  11. Redefining solubility parameters: the partial solvation parameters.

    Science.gov (United States)

    Panayiotou, Costas

    2012-03-21

    The present work reconsiders a classical and universally accepted concept of physical chemistry, the solubility parameter. Based on the insight derived from modern quantum chemical calculations, a new definition of solubility parameter is proposed, which overcomes some of the inherent restrictions of the original definition and expands its range of applications. The original single solubility parameter is replaced by four partial solvation parameters reflecting the dispersion, the polar, the acidic and the basic character of the chemical compounds as expressed either in their pure state or in mixtures. Simple rules are adopted for the definition and calculation of these four parameters and their values are tabulated for a variety of common substances. In contrast, however, to the well known Hansen solubility parameters, their design and evaluation does not rely exclusively on the basic rule of "similarity matching" for solubility but it makes also use of the other basic rule of compatibility, namely, the rule of "complementarity matching". This complementarity matching becomes particularly operational with the sound definition of the acidic and basic components of the solvation parameter based on the third σ-moments of the screening charge distributions of the quantum mechanics-based COSMO-RS theory. The new definitions are made in a simple and straightforward manner, thus, preserving the strength and appeal of solubility parameter stemming from its simplicity. The new predictive method has been applied to a variety of solubility data for systems of pharmaceuticals and polymers. The results from quantum mechanics calculations are critically compared with the results from Abraham's acid/base descriptors.

  12. Electrical transport and magnetoresistance of double layered CMR manganites R1.2Sr1.8Mn2O7(R = La, Pr, Sm

    Directory of Open Access Journals (Sweden)

    Reddy Y.S.

    2017-07-01

    Full Text Available Polycrystalline bulk samples of double layered (DL colossal magnetoresistive (CMR manganites R1.2Sr1.8Mn2O7 (R = La, Pr, Sm were prepared by sol-gel method to study the effect of size of lanthanide ion on their magnetotransport properties. The electrical resistivity of the samples was investigated in the temperature range of 70 K to 300 K at different magnetic fields. The samples LSMO and PSMO show insulator-to-metal transition (IMT behavior, while SSMO sample exhibits insulating behavior in the entire temperature range with a very large value of resistivity. The insulator-to-metal transition temperature (TIM decreases from 123 K (LSMO to 90 K (PSMO and disappears in SSMO sample. To explain the electrical transport above TIM, the temperature dependent resistivity data (T > TIM of all the samples were fitted to the equations of different conduction models. The results indicate that the conduction at T > TIM is due to Mott variable range hopping (VRH mechanism in the LSMO and PSMO samples, while Efros-Shkloskii (ES type of VRH model dominates the conduction process in the SSMO sample. All the three samples show increasing magnetoresistance (MR even below TIM and the maximum MR is shown by LSMO (39 % at 75 K, 3 T.

  13. BubR1 Acts as a Promoter in Cellular Motility of Human Oral Squamous Cancer Cells through Regulating MMP-2 and MMP-9

    Directory of Open Access Journals (Sweden)

    Chou-Kit Chou

    2015-07-01

    Full Text Available BubR1 is a critical component of spindle assembly checkpoint, ensuring proper chromatin segregation during mitosis. Recent studies showed that BubR1 was overexpressed in many cancer cells, including oral squamous cell carcinomas (OSCC. However, the effect of BubR1 on metastasis of OSCC remains unclear. This study aimed to unravel the role of BubR1 in the progression of OSCC and confirm the expression of BubR1 in a panel of malignant OSCC cell lines with different invasive abilities. The results of quantitative real-time PCR showed that the mRNA level of BubR1 was markedly increased in four OSCC cell lines, Ca9-22, HSC3, SCC9 and Cal-27 cells, compared to two normal cells, normal human oral keratinocytes (HOK and human gingival fibroblasts (HGF. Moreover, the expression of BubR1 in these four OSCC cell lines was positively correlated with their motility. Immunofluorescence revealed that BubR1 was mostly localized in the cytosol of human gingival carcinoma Ca9-22 cells. BubR1 knockdown significantly decreased cellular invasion but slightly affect cellular proliferation on both Ca9-22 and Cal-27 cells. Consistently, the activities of metastasis-associated metalloproteinases MMP-2 and MMP-9 were attenuated in BubR1 knockdown Ca9-22 cells, suggesting the role of BubR1 in promotion of OSCC migration. Our present study defines an alternative pathway in promoting metastasis of OSCC cells, and the expression of BubR1 could be a prognostic index in OSCC patients.

  14. Optimization of Saturn paraboloid magnetospheric field model parameters using Cassini equatorial magnetic field data

    Directory of Open Access Journals (Sweden)

    E. S. Belenkaya

    2016-07-01

    Full Text Available The paraboloid model of Saturn's magnetosphere describes the magnetic field as being due to the sum of contributions from the internal field of the planet, the ring current, and the tail current, all contained by surface currents inside a magnetopause boundary which is taken to be a paraboloid of revolution about the planet-Sun line. The parameters of the model have previously been determined by comparison with data from a few passes through Saturn's magnetosphere in compressed and expanded states, depending on the prevailing dynamic pressure of the solar wind. Here we significantly expand such comparisons through examination of Cassini magnetic field data from 18 near-equatorial passes that span wide ranges of local time, focusing on modelling the co-latitudinal field component that defines the magnetic flux passing through the equatorial plane. For 12 of these passes, spanning pre-dawn, via noon, to post-midnight, the spacecraft crossed the magnetopause during the pass, thus allowing an estimate of the concurrent subsolar radial distance of the magnetopause R1 to be made, considered to be the primary parameter defining the scale size of the system. The best-fit model parameters from these passes are then employed to determine how the parameters vary with R1, using least-squares linear fits, thus providing predictive model parameters for any value of R1 within the range. We show that the fits obtained using the linear approximation parameters are of the same order as those for the individually selected parameters. We also show that the magnetic flux mapping to the tail lobes in these models is generally in good accord with observations of the location of the open-closed field line boundary in Saturn's ionosphere, and the related position of the auroral oval. We then investigate the field data on six passes through the nightside magnetosphere, for which the spacecraft did not cross the magnetopause, such that in this case we compare the

  15. Diagnostic value of copper parameters to predict growth of suckling calves grazing native range in Argentina Valor diagnóstico dos parâmetros de cobre para prever o crescimento de bezerros lactantes em pastagem nativas na Argentina

    Directory of Open Access Journals (Sweden)

    Luis E Fazzio

    2010-10-01

    Full Text Available A study was conducted to evaluate the predictive diagnostic value of different copper (Cu parameters as indicators of average daily gain (ADG in growing calves. The effects in calves of cow Cu supplementation in the last one-third gestation period were also evaluated. Five supplementation trials, with a total of 300 calves, were carried out. Two groups of 30 calves were randomly assigned to each trial, one group was parenterally supplemented (SG and the other was not supplemented (NSG. Trials began when calves were three-month-old and ended at weaning time. At each sampling calves were weighed and blood was taken to determine Cu concentrations in plasma, Whole Blood (WB, Red Cells (RC and Packed Cell Volume (PCV. Liver samples from six animals of each group were taken both at the beginning and at the end of the trial. In two trials the mothers of the SG received Cu supplementation at the last one- third gestation period. Four of the five trials exhibited low ADG in the NSGs. In these groups, plasma Cu concentration decreased rapidly before low ADG was detected, which occurred with values remaining below 25µg/dl. The decrease of RC Cu concentration was considerably slow. WB showed an intermediate position. PCV in the SGs was higher than in the NSGs in all trials. Cow supplementation was insufficient to generate a liver storage able to last after calves reached the 3 months of age. These data could be useful to predict the risk of low ADG in grazing calves.Foi realizado um estudo para predisser o valor diagnóstico de diferentes parâmetros de cobre (Cu como indicadores de ganho médio diário (ADG na criação de bezerros. Também foram avaliados os efeitos da suplementação com Cu nas vacas no último terço da gestação. Cinco ensaios de suplementação, com um total de 300 bezerros, foram realizados. Dois grupos de 30 bezerros foram atribuídos aleatoriamente em cada proba, um grupo foi parenteralmente suple mentado (SG e o outro não foi

  16. Effects of Conformational Peptide Probe DP4 on Bidirectional Signaling between DHPR and RyR1 Calcium Channels in Voltage-Clamped Skeletal Muscle Fibers

    OpenAIRE

    Olojo, Rotimi O.; Hernández-Ochoa, Erick O.; Ikemoto, Noriaki; Schneider, Martin F.

    2011-01-01

    In skeletal muscle, excitation-contraction coupling involves the activation of dihydropyridine receptors (DHPR) and type-1 ryanodine receptors (RyR1) to produce depolarization-dependent sarcoplasmic reticulum Ca2+ release via orthograde signaling. Another form of DHPR-RyR1 communication is retrograde signaling, in which RyRs modulate the gating of DHPR. DP4 (domain peptide 4), is a peptide corresponding to residues Leu2442-Pro2477 of the central domain of the RyR1 that produces RyR1 channel d...

  17. The C5a/C5aR1 axis controls the development of experimental allergic asthma independent of LysM-expressing pulmonary immune cells.

    Directory of Open Access Journals (Sweden)

    Anna V Wiese

    Full Text Available C5a regulates the development of maladaptive immune responses in allergic asthma mainly through the activation of C5a receptor 1 (C5aR1. Yet, the cell types and the mechanisms underlying this regulation are ill-defined. Recently, we described increased C5aR1 expression in lung tissue eosinophils but decreased expression in airway and pulmonary macrophages as well as in pulmonary CD11b+ conventional dendritic cells (cDCs and monocyte-derived DCs (moDCs during the allergic effector phase using a floxed green fluorescent protein (GFP-C5aR1 knock-in mouse. Here, we determined the role of C5aR1 signaling in neutrophils, moDCs and macrophages for the pulmonary recruitment of such cells and the importance of C5aR1-mediated activation of LysM-expressing cells for the development of allergic asthma. We used LysM-C5aR1 KO mice with a specific deletion of C5aR1 in LysMCre-expressing cells and confirmed the specific deletion of C5aR1 in neutrophils, macrophages and moDCs in the airways and/or the lung tissue. We found that alveolar macrophage numbers were significantly increased in LysM-C5aR1 KO mice. Induction of ovalbumin (OVA-driven experimental allergic asthma in GFP-C5aR1fl/fl and LysM-C5aR1 KO mice resulted in strong but similar airway resistance, mucus production and Th2/Th17 cytokine production. In contrast, the number of airway but not of pulmonary neutrophils was lower in LysM-C5aR1 KO as compared with GFP-C5aR1fl/fl mice. The recruitment of macrophages, cDCs, moDCs, T cells and type 2 innate lymphoid cells was not altered in LysM-C5aR1 KO mice. Our findings demonstrate that C5aR1 is critical for steady state control of alveolar macrophage numbers and the transition of neutrophils from the lung into the airways in OVA-driven allergic asthma. However, C5aR1 activation of LysM-expressing cells plays a surprisingly minor role in the recruitment and activation of such cells and the development of the allergic phenotype in OVA-driven experimental

  18. Ligand specificity and affinity of BT-R1, the Bacillus thuringiensis Cry1A toxin receptor from Manduca sexta, expressed in mammalian and insect cell cultures.

    OpenAIRE

    Keeton, T P; Bulla, L A

    1997-01-01

    The Manduca sexta receptor for the Bacillus thuringiensis Cry1Aa, Cry1Ab, and Cry1Ac toxins, BT-R1, has been expressed in heterologous cell culture, and its ligand binding characteristics have been determined. When transfected with the BT-R1 cDNA, insect and mammalian cell cultures produce a binding protein of approximately 195 kDa, in contrast to natural BT-R1 from M. sexia, which has an apparent molecular weight of 210 kDa. Transfection of cultured Spodoptera frugiperda cells with the BT-R1...

  19. Analysis of the R1b-DF27 haplogroup shows that a large fraction of Iberian Y-chromosome lineages originated recently in situ

    OpenAIRE

    Solé Morata, Neus; Villaescusa, Patricia; García-Fernández, Carla; Font-Porterias, Neus; Illescas, María José; Valverde, Laura; Tassi, Francesca; Ghirotto, Silvia; Férec, Claude; Rouault, Karen; Jiménez-Moreno, Susana; Martínez-Jarreta, Begoña; Pinheiro, María Fátima; Zarrabeitia, María T.; Carracedo, Ángel

    2017-01-01

    Haplogroup R1b-M269 comprises most Western European Y chromosomes; of its main branches, R1b-DF27 is by far the least known, and it appears to be highly prevalent only in Iberia. We have genotyped 1072 R1b-DF27 chromosomes for six additional SNPs and 17 Y-STRs in population samples from Spain, Portugal and France in order to further characterize this lineage and, in particular, to ascertain the time and place where it originated, as well as its subsequent dynamics. We found that R1b-DF27 is p...

  20. Ageing implementation and refurbishment development at the IEA-R1 nuclear research reactor: a 15 years experience

    Energy Technology Data Exchange (ETDEWEB)

    Cardenas, Jose Patricio N.; Ricci Filho, Walter; Carvalho, Marcos R. de; Berretta, Jose Roberto; Marra Neto, Adolfo, E-mail: ahiru@ipen.b, E-mail: wricci@ipen.b, E-mail: carvalho@ipen.b, E-mail: jrretta@ipen.b, E-mail: amneto@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    IPEN (Instituto de Pesquisas Energeticas e Nucleares) is a nuclear research center established into the Secretary of Science and Technology from the government of the state of Sao Paulo, and administered both technically and financially by Comissao Nacional de Energia Nuclear (CNEN), a federal government organization under the Ministry of Science and Technology. The institute is located inside the campus of the University of Sao Paulo, Sao Paulo city, Brazil. One of major nuclear facilities at IPEN is the IEA-R1 nuclear research reactor. It is the unique Brazilian research reactor with substantial power level suitable for application with research in physics, chemistry, biology and engineering, as well as radioisotope production for medical and other applications. Designed and built by Babcok-Wilcox, in accordance with technical specifications established by the Brazilian Nuclear Energy Commission, and financed by the US Atoms for Peace Program, it is a swimming pool type reactor, moderated and cooled by light water and uses graphite and beryllium as reflector elements. The first criticality was achieved on September 16, 1957 and the reactor is currently operating at 4.0 MW on a 64h per week cycle. Since 1996, an IEA-R1 reactor ageing study was established at the Research Reactor Center (CRPq) related with general deterioration of components belonging to some operational systems, as cooling towers from secondary cooling system, piping and pumps, sample irradiation devices, radiation monitoring system, fuel elements, rod drive mechanisms, nuclear and process instrumentation and safety operational system. Although basic structures are almost the same as the original design, several improvements and modifications in components, systems and structures had been made along reactor life. This work aims to show the development of the ageing program in the IEA-R1 reactor and the upgrading (modernization) that was carried out, concerning several equipment and system in the

  1. A systematic study of gene mutations in urothelial carcinoma; inactivating mutations in TSC2 and PIK3R1.

    Directory of Open Access Journals (Sweden)

    Gottfrid Sjödahl

    Full Text Available BACKGROUND: Urothelial carcinoma (UC is characterized by frequent gene mutations of which activating mutations in FGFR3 are the most frequent. Several downstream targets of FGFR3 are also mutated in UC, e.g., PIK3CA, AKT1, and RAS. Most mutation studies of UCs have been focused on single or a few genes at the time or been performed on small sample series. This has limited the possibility to investigate co-occurrence of mutations. METHODOLOGY/PRINCIPAL FINDINGS: We performed mutation analyses of 16 genes, FGFR3, PIK3CA, PIK3R1 PTEN, AKT1, KRAS, HRAS, NRAS, BRAF, ARAF, RAF1, TSC1, TSC2, APC, CTNNB1, and TP53, in 145 cases of UC. We show that FGFR3 and PIK3CA mutations are positively associated. In addition, we identified PIK3R1 as a target for mutations. We demonstrate a negative association at borderline significance between FGFR3 and RAS mutations, and show that these mutations are not strictly mutually exclusive. We show that mutations in BRAF, ARAF, RAF1 rarely occurs in UC. Our data emphasize the possible importance of APC signaling as 6% of the investigated tumors either showed inactivating APC or activating CTNNB1 mutations. TSC1, as well as TSC2, that constitute the mTOR regulatory tuberous sclerosis complex were found to be mutated at a combined frequency of 15%. CONCLUSIONS/SIGNIFICANCE: Our data demonstrate a significant association between FGFR3 and PIK3CA mutations in UC. Moreover, the identification of mutations in PIK3R1 further emphasizes the importance of the PI3-kinase pathway in UC. The presence of TSC2 mutations, in addition to TSC1 mutations, underlines the involvement of mTOR signaling in UC.

  2. Study of molybdenum-99 production in IEA-R1m reactor using a beryllium irradiator; Estudos sobre a producao de molibdenio no reator IEA-R1m utilizando um irradiador de berilio

    Energy Technology Data Exchange (ETDEWEB)

    Ricci Filho, Walter [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil); Moreira, Joao M.L. [Centro Tecnologico da Marinha (CTMSP), Sao Paulo, SP (Brazil)

    1999-11-01

    The IEA-R1 reactor has undergone a modernization to increase its operating power to 5 MW, in order to allow a more efficient production of the {sup 99} Mo radioisotope. An irradiation element made of Be was acquired for the reactor and studies were initiated for determining its performance when compared to other irradiators available in the reactor, the water and graphite types. The results obtained showed some advantages of the Be irradiation element for producing {sup 99} Mo: the epithermal neutron flux in the irradiation element is approximately 15% greater than in the water and in the graphite irradiation elements; the negative reactivity introduced in the reactor by the Be irradiation element is substantially smaller than the those introduced by the other elements: - 1636 pcm for the Be irradiator, -2568 for the graphite irradiator and -2977 pcm for the water irradiator. It is concluded that the production of the {sup 99M}o radioisotope with the Be irradiation element can be increased by 15% in the IEA-R1m reactor. It also requires less fuel for the reactor operation due to the smaller negative reactivity introduced in the reactor core. (author) 4 refs., 9 figs., 1 tab.

  3. Circuits design of action logics of the protection system of nuclear reactor IAN-R1 of Colombia; Diseno de los circuitos de la logica de actuacion del sistema de proteccion del reactor nuclear IAN-R1 de Colombia

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez M, J. L.; Rivero G, T.; Sainz M, E., E-mail: joseluis.gonzalez@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2014-10-15

    Due to the obsolescence of the instrumentation and control system of the nuclear research reactor IAN-R1, the Institute of Geology and Mining of Colombia, IngeoMinas, launched an international convoking for renewal it which was won by the Instituto Nacional de Investigaciones Nucleares (ININ). Within systems to design, the reactor protection system is described as important for safety, because this carried out, among others two primary functions: 1) ensuring the reactor shutdown safely, and 2) controlling the interlocks to protect against operational errors if defined conditions have not been met. To fulfill these functions, the various subsystems related to the safety report the state in which they are using binary signals and are connected to the inputs of two redundant logic wiring circuits called action logics (Al) that are part of the reactor protection system. These Al also serve as logical interface to indicate at all times the status of subsystems, both the operator and other systems. In the event that any of the subsystems indicates a state of insecurity in the reactor, the Al generate signals off (or scram) of the reactor, maintaining the interlock until the operator sends a reset signal. In this paper the design, implementation, verification and testing of circuits that make up the Al 1 and 2 of IAN-R1 reactor is described, considering the fulfillment of the requirements that the different international standards imposed on this type of design. (Author)

  4. Purification and characterization of a (R)-1-phenyl-1,3-propanediol-producing enzyme from Trichosporon fermentans AJ-5152 and enzymatic (R)-1-phenyl-1,3-propanediol production.

    Science.gov (United States)

    Kira, Ikuo; Onishi, Norimasa

    2009-07-01

    An (R)-1-phenyl-1,3-propanediol-producing enzyme was purified from Trichosporon fermentans AJ-5152. It was NADPH-dependent and converted 3-hydroxy-1-phenylpropane-1-one (HPPO) to (R)-1-phenyl-1,3-propanediol [(R)-PPD] with anti-Prelog's specificity. It showed maximum activity at pH 7.0 and 40 degrees C. Its K(m) and V(max) values toward HPPO were 20.1 mM and 3.4 mumol min(-1) mg protein(-1) respectively. The relative molecular weight of the enzyme was estimated to be 68,000 on gel filtration and 32,000 on SDS-polyacrylamide gel electrophoresis. An (R)-PPD-producing reaction using the (R)-PPD-producing enzyme and an NADPH recycling system was carried out by successive feeding of HPPO. A total (R)-PPD yield of 8.9 g/l was produced in 16 h. The molar yield was 76%, and the optical purity of the (R)-PPD produced was over 99% e.e.

  5. CYP287A1 is a carotenoid 2-β-hydroxylase required for deinoxanthin biosynthesis in Deinococcus radiodurans R1.

    Science.gov (United States)

    Zhou, Zhengfu; Zhang, Wei; Su, Shiyou; Chen, Ming; Lu, Wei; Lin, Min; Molnár, István; Xu, Yuquan

    2015-12-01

    The carotenoid deinoxanthin is a crucial resistance factor against various stresses in the radiation-resistant bacterium Deinococcus radiodurans. Disruption of the gene dr2473 encoding the cytochrome P450 CYP287A1 led to the accumulation of 2-deoxydeinoxanthin in D. radiodurans, demonstrating that CYP287A1 is a novel β-carotene 2-hydroxylase. The dr2473 knockout mutant was shown to be more sensitive to UV radiation and oxidative stress than the wild-type strain D. radiodurans R1, indicating that the C2 alcohol of deinoxanthin is important for antioxidant activity.

  6. Regulamentação do sistema elétrico do reator IEA-R1

    OpenAIRE

    José Roberto de Mello

    2016-01-01

    O reator IEA-R1 do Instituto de Pesquisas Energéticas e Nucleares (IPENCNEN/ SP) é um reator de pesquisa tipo piscina aberta, projetado e construído pela empresa norte-americana \\"Babcock & Wilcox\\", tendo, como refrigerante e moderador, água leve deionizada e berílio e grafite como refletores. Até cerca de 1988, os sistemas de segurança do reator recebiam alimentação de uma única fonte de energia. Nos anos de 1989 e 1990, uma reforma de modernização do sistema elétrico para aumentar a potênc...

  7. One-pot synthesis of (R)-1-(pyridin-4-yl)ethyl acetate using tandem catalyst prepared by co-immobilization of palladium and lipase on mesoporous foam: Optimization and kinetic modeling.

    Science.gov (United States)

    Magadum, Deepali B; Yadav, Ganapati D

    2017-12-01

    The synthesis of (R)-1-(pyridin-4-yl)ethyl acetate was achieved over tandem palladium-lipase catalyst with 100% selectivity using 4-acetyl pyridine as a reactant. The 2% w/w palladium and lipase catalyst was successfully co-immobilized in the microenvironment of the mesocellular foam and characterized by various techniques. The palladium metal from catalyst hydrogenated 4-acetyl pyridine to form 1-(pyridin-4-yl)ethanol. The generated intermediate product then underwent kinetic resolution over lipase and selectively gave (R)-1-(pyridin-4- yl)ethyl acetate. The catalytic conditions were then studied for optimal performance of both steps. The reaction conditions were optimized to 50 °C and toluene as a solvent. Both chemical and enzymatic kinetic models of the reaction were developed for a given set of reaction conditions and kinetic parameters were predicted. At optimal conditions, the obtained selectivity of intermediate (1-(pyridin-4-yl)ethanol) was 51.38%. The final product yield of ((R)-1-(pyridin-4-yl)ethyl acetate) was 48.62%. © 2017 Wiley Periodicals, Inc.

  8. Improved Complete Genome Sequence of the Extremely Radioresistant Bacterium Deinococcus radiodurans R1 Obtained Using PacBio Single-Molecule Sequencing

    OpenAIRE

    Hua, Xiaoting; Hua, Yuejin

    2016-01-01

    The genome sequence of Deinococcus radiodurans R1 was published in 1999. We resequenced D.?radiodurans R1 using PacBio and compared the sequence with the published one. Large insertions and single nucleotide polymorphisms (SNPs) were observed among the genome sequences. A more accurate genome sequence will be helpful to studies of D.?radiodurans.

  9. Short-range fundamental forces

    CERN Document Server

    Antoniadis, I; Buchner, M; Fedorov, V V; Hoedl, S; Lambrecht, A; Nesvizhevsky, V V; Pignol, G; Protasov, K V; Reynaud, S; Sobolev, Yu

    2011-01-01

    We consider theoretical motivations to search for extra short-range fundamental forces as well as experiments constraining their parameters. The forces could be of two types: 1) spin-independent forces, 2) spin-dependent axion-like forces. Differe nt experimental techniques are sensitive in respective ranges of characteristic distances. The techniques include measurements of gravity at short distances, searches for extra interactions on top of the Casimir force, precision atomic and neutron experim ents. We focus on neutron constraints, thus the range of characteristic distances considered here corresponds to the range accessible for neutron experiments.

  10. A regulatory gene network related to the porcine umami taste receptor (TAS1R1/TAS1R3).

    Science.gov (United States)

    Kim, J M; Ren, D; Reverter, A; Roura, E

    2016-02-01

    Taste perception plays an important role in the mediation of food choices in mammals. The first porcine taste receptor genes identified, sequenced and characterized, TAS1R1 and TAS1R3, were related to the dimeric receptor for umami taste. However, little is known about their regulatory network. The objective of this study was to unfold the genetic network involved in porcine umami taste perception. We performed a meta-analysis of 20 gene expression studies spanning 480 porcine microarray chips and screened 328 taste-related genes by selective mining steps among the available 12,320 genes. A porcine umami taste-specific regulatory network was constructed based on the normalized coexpression data of the 328 genes across 27 tissues. From the network, we revealed the 'taste module' and identified a coexpression cluster for the umami taste according to the first connector with the TAS1R1/TAS1R3 genes. Our findings identify several taste-related regulatory genes and extend previous genetic background of porcine umami taste. © 2015 Stichting International Foundation for Animal Genetics.

  11. Bioactive Benzofuran Derivatives from Cortex Mori Radicis, and Their Neuroprotective and Analgesic Activities Mediated by mGluR1

    Directory of Open Access Journals (Sweden)

    Ya-Nan Wang

    2017-02-01

    Full Text Available Four new benzofuran-type stilbene glycosides and 14 known compounds including 8 benzofuran-type stilbenes and 6 flavonoids were isolated from the traditional Chinese medicine, Cortex Mori Radicis. The new compounds were identified as (9R-moracin P 3′-O-α-l-arabinopyranoside (1, (9R-moracin P 9-O-β-d-glucopyranoside (2, (9R-moracin P 3′-O-β-d-glucopyranoside (3, and (9R-moracin O 10-O-β-d-glucopyranoside (4 based on the spectroscopic interpretation and chemical analysis. Three benzofuran-type stilbenes, moracin O (5, R (7, and P (8 showed significant neuroprotective activity against glutamate-induced cell death in SK-N-SH cells. In addition, moracin O (5 and P (8 also demonstrated a remarkable inhibition of the acetic acid-induced pain. The molecular docking with metabotropic glutamate receptor 1 (mGluR1 results indicated that these neuroprotective benzofuran-type stilbenes might be the active analgesic components of the genus Morus, and acted by mediating the mGluR1 pathway.

  12. Common Variants in CYP2R1 and GC Genes Predict Vitamin D Concentrations in Healthy Danish Children and Adults

    DEFF Research Database (Denmark)

    Nissen, Ioanna; Rasmussen, Lone Banke; Ravn-Haren, Gitte

    2014-01-01

    . We aimed to analyse previously reported vitamin D-related polymorphisms in relation to serum 25(OH)D concentrations in 201 healthy Danish families with dependent children in late summer in Denmark. Serum 25(OH)D concentrations and a total of 25 SNPs in GC, VDR, CYP2R1, CYP24A1, CYP27B1, C10or88......Environmental factors such as diet, intake of vitamin D supplements and exposure to sunlight are known to influence serum vitamin D concentrations. Genetic epidemiology of vitamin D is in its infancy and a better understanding on how genetic variation influences vitamin D concentration is needed......, rs16846876 and rs17467825) were statistically significantly associated with serum 25(OH)D concentrations in children, adults and all combined. Several of the SNPs were in strong linkage disequilibrium, and the associations were driven by CYP2R1-rs10741657 and rs10766197, and by GC-rs4588 and rs842999...

  13. Common genetic variations in the CYP2R1 and GC genes are determinants of vitamin D status in Danes

    DEFF Research Database (Denmark)

    Nissen, Ioanna

    Vitamin D is considered a key fat-soluble vitamin critically important for good bone- and overall health throughout life. Vitamin D deficiency increases the risk of developing rickets, osteomalacia and osteoporosis, and moreover increases the risk of various non-skeletal adverse health outcomes i...... (SNPs) in CYP2R1, CYP24A1, CYP27B1, C10orf88, DHCR7/NADSYN1, GC and VDR genes to be associated with vitamin D status. The main hypothesis of this work was that genetically determined variation in vitamin D metabolism would influence the effect of vitamin D sources (vitamin D......-supplementation and ultraviolet (UV)-B) on vitamin D status. This was done by assessing the association between 25 SNPs located in the CYP2R1, CYP24A1, CYP27B1, C10orf88, DHCR7/NADSYN1, GC and VDR genes and vitamin D status in 756 participants in the VitmaD study in late summer (paper I), at the end of a winter season (paper II...

  14. Structure and magnetism in S r1 -xAxTc O3 perovskites: Importance of the A -site cation

    Science.gov (United States)

    Reynolds, Emily; Avdeev, Maxim; Thorogood, Gordon J.; Poineau, Frederic; Czerwinski, Kenneth R.; Kimpton, Justin A.; Yu, Michelle; Kayser, Paula; Kennedy, Brendan J.

    2017-02-01

    The S r1 -xB axTc O3 (x =0 , 0.1, 0.2) oxides were prepared and their solid-state and magnetic structure studied as a function of temperature by x-ray and neutron powder diffraction. The refined Tc moments at room temperature and Néel temperatures for B a0.1S r0.9Tc O3 and B a0.2S r0.8Tc O3 were 2.32 (14 ) μβ and 2.11 (13 ) μβ and 714 ∘C and 702 ∘C , respectively. In contrast to expectations, the Néel temperature in the series S r1 -xAxTc O3 decreases with increasing Ba content. This observation is consistent with previous experimental measurements for the two series A M O3 (M =Ru , Mn; A =Ca , Sr, Ba) where the maximum magnetic ordering temperature was observed for A =Sr . Taken with these previous results the current work demonstrates the critical role of the A -site cation in the broadening of the π* bandwidth and ultimately the magnetic ordering temperature.

  15. IL18 and IL18R1 polymorphisms, lung CT and fibrosis: a longitudinal study in coal miners

    Energy Technology Data Exchange (ETDEWEB)

    Nadif, R.; Mintz, M.; Marzec, J.; Jedlicka, A.; Kauffmann, F.; Kleeberger, S.R. [INSERM, U780, Villejuif (France)

    2006-12-15

    It has been suggested that interleukin (IL)-18 plays a role in the development of inflammatory and fibrosing lung diseases. Associations of polymorphisms in the genes coding for IL-18 (108 /G-656T, C-607A, G-137C, T113G, C127T) and its receptor (IL8R1/C-69T) with coal workers' pneumoconiosis (CWP) were studied in 200 miners who were examined in 1990, 1994 and 1999. Coal-dust exposure was assessed according to job history and ambient measures. The main health outcome was lung computed tomography (CT) score in 1990. Internal coherence was assessed by studying CT score in 1994, 4-yr change in CT score and CWP incidence and prevalence. CT score in 1990 was a good predictor of radiographic grade in 1999 and, therefore, an appropriate subclinical quantitative trait. The IL18 -137C allele was associated with lower CT score in 1990 and 1994 (11.24 versus 1.69 and 1.57 versus 2.46, respectively), slower progression of CT score between 1990 and 1994 and lower pneumoconiosis prevalence in 1999 relative to the G allele (0.33 versus 0.77 and 8.2 versus 19.6%, respectively). Smoking- or dust-adjustment, and stratification on IL18R1 genotype and adjustment for haplotype effects did not change the conclusions. In conclusion, the results of the present study suggest a role for IL18 in reducing the development of this fibrosing lung disease.

  16. A major Y-chromosome haplogroup R1b Holocene era founder effect in Central and Western Europe.

    Science.gov (United States)

    Myres, Natalie M; Rootsi, Siiri; Lin, Alice A; Järve, Mari; King, Roy J; Kutuev, Ildus; Cabrera, Vicente M; Khusnutdinova, Elza K; Pshenichnov, Andrey; Yunusbayev, Bayazit; Balanovsky, Oleg; Balanovska, Elena; Rudan, Pavao; Baldovic, Marian; Herrera, Rene J; Chiaroni, Jacques; Di Cristofaro, Julie; Villems, Richard; Kivisild, Toomas; Underhill, Peter A

    2011-01-01

    The phylogenetic relationships of numerous branches within the core Y-chromosome haplogroup R-M207 support a West Asian origin of haplogroup R1b, its initial differentiation there followed by a rapid spread of one of its sub-clades carrying the M269 mutation to Europe. Here, we present phylogeographically resolved data for 2043 M269-derived Y-chromosomes from 118 West Asian and European populations assessed for the M412 SNP that largely separates the majority of Central and West European R1b lineages from those observed in Eastern Europe, the Circum-Uralic region, the Near East, the Caucasus and Pakistan. Within the M412 dichotomy, the major S116 sub-clade shows a frequency peak in the upper Danube basin and Paris area with declining frequency toward Italy, Iberia, Southern France and British Isles. Although this frequency pattern closely approximates the spread of the Linearbandkeramik (LBK), Neolithic culture, an advent leading to a number of pre-historic cultural developments during the past ≤10 thousand years, more complex pre-Neolithic scenarios remain possible for the L23(xM412) components in Southeast Europe and elsewhere.

  17. Self-organizing maps of Kohonen (SOM) applied to multidimensional monitoring data of the IEA-R1 nuclear research reactor

    Energy Technology Data Exchange (ETDEWEB)

    Affonso, Gustavo S.; Pereira, Iraci M.; Mesquita, Roberto N. de, E-mail: rnavarro@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Bueno, Elaine I., E-mail: ebueno@ifsp.gov.b [Instituto Federal de Educacao, Ciencia e Tecnologia de Sao Paulo (IFSP), SP (Brazil)

    2011-07-01

    Multivariate statistics comprise a set of statistical methods used in situations where many variables are database space subsets. Initially applied to human, social and biological sciences, these methods are being applied to many other areas such as education, geology, chemistry, physics, engineering, and many others. This spectra expansion was possible due to recent technological development of computation hardware and software that allows high and complex databases to be treated iteratively enabling further analysis. Following this trend, the neural networks called Self-Organizing Maps are turning into a powerful tool on visualization of implicit and unknown correlations in big sized database sets. Originally created by Kohonen in 1981, it was applied to speech recognition tasks. The SOM is being used as a comparative parameter to evaluate the performance of new multidimensional analysis methodologies. Most of methods require good variable input selection criteria and SOM has contributed to clustering, classification and prediction of multidimensional engineering process variables. This work proposes a method of applying SOM to a set of 58 IEA-R1 operational variables at IPEN research reactor which are monitored by a Data Acquisition System (DAS). This data set includes variables as temperature, flow mass rate, coolant level, nuclear radiation, nuclear power and control bars position. DAS enables the creation and storage of historical data which are used to contribute to Failure Detection and Monitoring System development. Results show good agreement with previous studies using other methods as GMDH and other predictive methods. (author)

  18. Reference ranges of some haematological parameters in healthy ...

    African Journals Online (AJOL)

    Background: The haematological values of populations differ due to numerous factors. It is essential to establish the normal haematological values in every population to ensure appropriate interpretation of results in health and disease states. Materials and Methods: A total of 184 consenting apparently healthy adults (62 ...

  19. Long-range hydrometeorological ensemble predictions of drought parameters

    Science.gov (United States)

    Fundel, F.; Jörg-Hess, S.; Zappa, M.

    2012-06-01

    Low streamflow as consequence of a drought event affects numerous aspects of life. Economic sectors that may be impacted by drought are, e.g. power production, agriculture, tourism and water quality management. Numerical models have increasingly been used to forecast low-flow and have become the focus of recent research. Here, we consider daily ensemble runoff forecasts for the river Thur, which has its source in the Swiss Alps. We focus on the low-flow indices duration, severity and magnitude, with a forecast lead-time of one month, to assess their potential usefulness for predictions. The ECMWF VarEPS 5 member reforecast, which covers 18 yr, is used as forcing for the hydrological model PREVAH. A thorough verification shows that, compared to peak flow, probabilistic low-flow forecasts are skillful for longer lead-times, low-flow index forecasts could also be beneficially included in a decision-making process. The results suggest monthly runoff forecasts are useful for accessing the risk of hydrological droughts.

  20. Successful Establishment of Plasmids R1 and pMV158 in a New Host Requires the Relief of the Transcriptional Repression of Their Essential rep Genes

    Directory of Open Access Journals (Sweden)

    José Á. Ruiz-Masó

    2017-12-01

    Full Text Available Although differing in size, encoded traits, host range, and replication mechanism, both narrow-host-range theta-type conjugative enterobacterial plasmid R1 and promiscuous rolling-circle-type mobilizable streptococcal plasmid pMV158 encode a transcriptional repressor protein, namely CopB in R1 and CopG in pMV158, involved in replication control. The gene encoding CopB or CopG is cotranscribed with a downstream gene that encodes the replication initiator Rep protein of the corresponding plasmid. However, whereas CopG is an auto-repressor that inhibits transcription of the entire copG-repB operon, CopB is expressed constitutively and represses a second, downstream promoter that directs transcription of repA. As a consequence of the distinct regulatory pathways implied by CopB and CopG, these repressor proteins play a different role in control of plasmid replication during the steady state: while CopB has an auxiliary role by keeping repressed the regulated promoter whenever the plasmid copy number is above a low threshold, CopG plays a primary role by acting coordinately with RNAII. Here, we have studied the role of the regulatory circuit mediated by these transcriptional repressors during the establishment of these two plasmids in a new host cell, and found that excess Cop repressor molecules in the recipient cell result in a severe decrease in the frequency and/or the velocity of appearance of transformant colonies for the cognate plasmid but not for unrelated plasmids. Using the pMV158 replicon as a model system, together with highly sensitive real-time qPCR and inverse PCR methods, we have also analyzed the effect of CopG on the kinetics of repopulation of the plasmid in Streptococcus pneumoniae. We show that, whereas in the absence of CopG pMV158 repopulation occurs mainly during the first 45 min following plasmid transfer, the presence of the transcriptional repressor in the recipient cell severely impairs the replicon repopulation and makes

  1. Development of methodology for characterization of cartridge filters from the IEA-R1 using the Monte Carlo method; Desenvolvimento de uma metodologia para caracterizacao do filtro cuno do reator IEA-R1 utilizando o Metodo Monte Carlo

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Priscila

    2014-07-01

    The Cuno filter is part of the water processing circuit of the IEA-R1 reactor and, when saturated, it is replaced and becomes a radioactive waste, which must be managed. In this work, the primary characterization of the Cuno filter of the IEA-R1 nuclear reactor at IPEN was carried out using gamma spectrometry associated with the Monte Carlo method. The gamma spectrometry was performed using a hyperpure germanium detector (HPGe). The germanium crystal represents the detection active volume of the HPGe detector, which has a region called dead layer or inactive layer. It has been reported in the literature a difference between the theoretical and experimental values when obtaining the efficiency curve of these detectors. In this study we used the MCNP-4C code to obtain the detector calibration efficiency for the geometry of the Cuno filter, and the influence of the dead layer and the effect of sum in cascade at the HPGe detector were studied. The correction of the dead layer values were made by varying the thickness and the radius of the germanium crystal. The detector has 75.83 cm{sup 3} of active volume of detection, according to information provided by the manufacturer. Nevertheless, the results showed that the actual value of active volume is less than the one specified, where the dead layer represents 16% of the total volume of the crystal. A Cuno filter analysis by gamma spectrometry has enabled identifying energy peaks. Using these peaks, three radionuclides were identified in the filter: {sup 108m}Ag, {sup 110m}Ag and {sup 60}Co. From the calibration efficiency obtained by the Monte Carlo method, the value of activity estimated for these radionuclides is in the order of MBq. (author)

  2. The complement receptor C5aR1 contributes to renal damage but protects the heart in angiotensin II-induced hypertension.

    Science.gov (United States)

    Weiss, Sebastian; Rosendahl, Alva; Czesla, Daniel; Meyer-Schwesinger, Catherine; Stahl, Rolf A K; Ehmke, Heimo; Kurts, Christian; Zipfel, Peter F; Köhl, Jörg; Wenzel, Ulrich O

    2016-06-01

    Adaptive and innate immune responses contribute to hypertension and hypertensive end-organ damage. Here, we determined the role of anaphylatoxin C5a, a major inflammatory effector of the innate immune system that is generated in response to complement activation, in hypertensive end-organ damage. For this purpose, we assessed the phenotype of C5a receptor 1 (C5aR1)-deficient mice in ANG II-induced renal and cardiac injury. Expression of C5aR1 on infiltrating and resident renal as well as cardiac cells was determined using a green fluorescent protein (GFP)-C5aR1 reporter knockin mouse. Flow cytometric analysis of leukocytes isolated from the kidney of GFP-C5aR1 reporter mice showed that 28% of CD45-positive cells expressed C5aR1. Dendritic cells were identified as the major C5aR1-expressing population (88.5%) followed by macrophages and neutrophils. Using confocal microscopy, we detected C5aR1 in the kidney mainly on infiltrating cells. In the heart, only infiltrating cells stained C5aR1 positive. To evaluate the role of C5aR1 deficiency in hypertensive injury, an aggravated model of hypertension was used. Unilateral nephrectomy was performed followed by infusion of ANG II (1.5 ng·g(-1)·min(-1)) and salt in wild-type (n = 34) and C5aR1-deficient mice (n = 32). C5aR1-deficient mice exhibited less renal injury, as evidenced by significantly reduced albuminuria. In contrast, cardiac injury was accelerated with significantly increased cardiac fibrosis and heart weight in C5aR1-deficient mice after ANG II infusion. No effect was found on blood pressure. In summary, the C5a:C5aR1 axis drives end-organ damage in the kidney but protects from the development of cardiac fibrosis and hypertrophy in experimental ANG II-induced hypertension. Copyright © 2016 the American Physiological Society.

  3. Blast waves from detonated military explosive reduce GluR1 and synaptophysin levels in hippocampal slice cultures.

    Science.gov (United States)

    Smith, Marquitta; Piehler, Thuvan; Benjamin, Richard; Farizatto, Karen L; Pait, Morgan C; Almeida, Michael F; Ghukasyan, Vladimir V; Bahr, Ben A

    2016-12-01

    Explosives create shockwaves that cause blast-induced neurotrauma, one of the most common types of traumatic brain injury (TBI) linked to military service. Blast-induced TBIs are often associated with reduced cognitive and behavioral functions due to a variety of factors. To study the direct effects of military explosive blasts on brain tissue, we removed systemic factors by utilizing rat hippocampal slice cultures. The long-term slice cultures were briefly sealed air-tight in serum-free medium, lowered into a 37°C water-filled tank, and small 1.7-gram assemblies of cyclotrimethylene trinitramine (RDX) were detonated 15cm outside the tank, creating a distinct shockwave recorded at the culture plate position. Compared to control mock-treated groups of slices that received equal submerge time, 1-3 blast impacts caused a dose-dependent reduction in the AMPA receptor subunit GluR1. While only a small reduction was found in hippocampal slices exposed to a single RDX blast and harvested 1-2days later, slices that received two consecutive RDX blasts 4min apart exhibited a 26-40% reduction in GluR1, and the receptor subunit was further reduced by 64-72% after three consecutive blasts. Such loss correlated with increased levels of HDAC2, a histone deacetylase implicated in stress-induced reduction of glutamatergic transmission. No evidence of synaptic marker recovery was found at 72h post-blast. The presynaptic marker synaptophysin was found to have similar susceptibility as GluR1 to the multiple explosive detonations. In contrast to the synaptic protein reductions, actin levels were unchanged, spectrin breakdown was not detected, and Fluoro-Jade B staining found no indication of degenerating neurons in slices exposed to three RDX blasts, suggesting that small, sub-lethal explosives are capable of producing selective alterations to synaptic integrity. Together, these results indicate that blast waves from military explosive cause signs of synaptic compromise without

  4. Invisible watermarking optical camera communication and compatibility issues of IEEE 802.15.7r1 specification

    Science.gov (United States)

    Le, Nam-Tuan

    2017-05-01

    Copyright protection and information security are two most considered issues of digital data following the development of internet and computer network. As an important solution for protection, watermarking technology has become one of the challenged roles in industry and academic research. The watermarking technology can be classified by two categories: visible watermarking and invisible watermarking. With invisible technique, there is an advantage on user interaction because of the visibility. By applying watermarking for communication, it will be a challenge and a new direction for communication technology. In this paper we will propose one new research on communication technology using optical camera communications (OCC) based invisible watermarking. Beside the analysis on performance of proposed system, we also suggest the frame structure of PHY and MAC layer for IEEE 802.15.7r1 specification which is a revision of visible light communication (VLC) standardization.

  5. Transient cases analyses of the TRIGA IPR-R1 using thermal hydraulic and neutron kinetic coupled codes

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Patricia A.L.; Costa, Antonella L.; Pereira, Claubia; Veloso, Maria A.F.; Scari, Maria E., E-mail: patricialire@yahoo.com.br, E-mail: antonella@nuclear.ufmg.br, E-mail: claubia@nuclear.ufmg.br, E-mail: dora@nuclear.ufmg.br, E-mail: melizabethscari@yahoo.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Instituto Nacional de Ciencias e Tecnologia de Reatores Nucleares Inovadores (INCT/CNPq), Belo Horizonte (Brazil); Miro, Rafael; Verdu, Gumersindo, E-mail: rmiro@iqn.upv.es, E-mail: gverdu@iqn.upv.es [Universidad Politecnica de Valencia (Spain). Departamento de Ingenieria Quimica y Nuclear

    2015-07-01

    Simulations and analyses of nuclear reactors have been improved by utilization of coupled thermal-hydraulic (TH) and neutron kinetics (NK) system codes especially to simulate transients that involve strong feedback effects between NK and TH. The TH-NK coupling technique was initially developed and used to simulate the behavior of power reactors; however, several coupling methodologies are now being applied for research reactors. This work presents the coupling methodology application between RELAP5 and PARCS codes using as a model the TRIGA IPR-R1 research reactor. Analyses of steady state and transient conditions and comparisons with results from simulations using only the RELAP5 code are being presented in this paper. (author)

  6. A simple approach to solving the kinematics of the 4-UPS/PS (3R1T) parallel manipulator

    Energy Technology Data Exchange (ETDEWEB)

    Gallardo-Alvarado, Jaime; Gracio-Murillo, Mario A. [Instituto Tecnologico de Celaya, Celaya (Mexico); Islam, Md. Nazrul [Universiti Malasya Sabah, Sabah (Malaysia); Abedinnasab, Mohammad H. [Rowan University, New Jersey (United States)

    2016-05-15

    This work reports on the position, velocity and acceleration analyses of a four-degrees-of-freedom parallel manipulator, 4-DoF-PM for brevity, which generates Three-rotation-one-translation (3R1T) motion. Nearly closed-form solutions to solve the forward displacement analysis are easily obtained based on closure equations formulated upon linear combinations of the coordinates of three non-collinear points embedded in the moving platform. Then, the input-output equations of velocity and acceleration of the robot manipulator are systematically established by resorting to the theory of screws. To this end, the Klein form of the Lie algebra se(3) of the Euclidean group SE(3) is systematically applied to the velocity and reduced acceleration state in screw form of the moving platform cancelling the passive joint rates of the parallel manipulator. Numerical examples, which are confirmed by means of commercially available software, are provided to show the application of the method.

  7. Analysis of the R1b-DF27 haplogroup shows that a large fraction of Iberian Y-chromosome lineages originated recently in situ.

    Science.gov (United States)

    Solé-Morata, Neus; Villaescusa, Patricia; García-Fernández, Carla; Font-Porterias, Neus; Illescas, María José; Valverde, Laura; Tassi, Francesca; Ghirotto, Silvia; Férec, Claude; Rouault, Karen; Jiménez-Moreno, Susana; Martínez-Jarreta, Begoña; Pinheiro, Maria Fátima; Zarrabeitia, María T; Carracedo, Ángel; de Pancorbo, Marian M; Calafell, Francesc

    2017-08-04

    Haplogroup R1b-M269 comprises most Western European Y chromosomes; of its main branches, R1b-DF27 is by far the least known, and it appears to be highly prevalent only in Iberia. We have genotyped 1072 R1b-DF27 chromosomes for six additional SNPs and 17 Y-STRs in population samples from Spain, Portugal and France in order to further characterize this lineage and, in particular, to ascertain the time and place where it originated, as well as its subsequent dynamics. We found that R1b-DF27 is present in frequencies ~40% in Iberian populations and up to 70% in Basques, but it drops quickly to 6-20% in France. Overall, the age of R1b-DF27 is estimated at ~4,200 years ago, at the transition between the Neolithic and the Bronze Age, when the Y chromosome landscape of W Europe was thoroughly remodeled. In spite of its high frequency in Basques, Y-STR internal diversity of R1b-DF27 is lower there, and results in more recent age estimates; NE Iberia is the most likely place of origin of DF27. Subhaplogroup frequencies within R1b-DF27 are geographically structured, and show domains that are reminiscent of the pre-Roman Celtic/Iberian division, or of the medieval Christian kingdoms.

  8. SIGN-R1 and complement factors are involved in the systemic clearance of radiation-induced apoptotic cells in whole-body irradiated mice

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jin-Yeon; Loh, SoHee; Cho, Eun-hee [Department of Biomedical Science & Technology, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of); Choi, Hyeong-Jwa [Division of Radiation Effect, Korea Institute of Radiological and Medical Sciences, 215-4, 75 Nowon gil Nowon-Gu, Seoul, 139-706 (Korea, Republic of); Na, Tae-Young [College of Pharmacy, Seoul National University, 1 Gwanak-ro, Gwanak-gu, Seoul 151-741 (Korea, Republic of); Nemeno, Judee Grace E.; Lee, Jeong Ik [Regenerative Medicine Laboratory, Department of Veterinary Medicine, College of Veterinary Medicine, Konkuk University, Seoul, 143-701 (Korea, Republic of); Yoon, Taek Joon [Department of Food and Nutrition, Yuhan College, Bucheon, Gyeonggi-do, 422-749 (Korea, Republic of); Choi, In-Soo [Department of Infectious Diseases, College of Veterinary Medicine, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of); Lee, Minyoung [Division of Radiation Effect, Korea Institute of Radiological and Medical Sciences, 215-4, 75 Nowon gil Nowon-Gu, Seoul, 139-706 (Korea, Republic of); Lee, Jae-Seon [Department of Biomedical Sciences, College of Medicine, Inha University, Incheon, 400-712 (Korea, Republic of); Kang, Young-Sun, E-mail: kangys1967@naver.com [Department of Biomedical Science & Technology, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of); Department of Veterinary Pharmacology and Toxicology, College of Veterinary Medicine, Konkuk University, 1 Hwayang-dong, Gwangjin-gu, Seoul, 143-701 (Korea, Republic of)

    2015-08-07

    Although SIGN-R1-mediated complement activation pathway has been shown to enhance the systemic clearance of apoptotic cells, the role of SIGN-R1 in the clearance of radiation-induced apoptotic cells has not been characterized and was investigated in this study. Our data indicated that whole-body γ-irradiation of mice increased caspase-3{sup +} apoptotic lymphocyte numbers in secondary lymphoid organs. Following γ-irradiation, SIGN-R1 and complements (C4 and C3) were simultaneously increased only in the mice spleen tissue among the assessed tissues. In particular, C3 was exclusively activated in the spleen. The delayed clearance of apoptotic cells was markedly prevalent in the spleen and liver of SIGN-R1 KO mice, followed by a significant increase of CD11b{sup +} cells. These results indicate that SIGN-R1 and complement factors play an important role in the systemic clearance of radiation-induced apoptotic innate immune cells to maintain tissue homeostasis after γ-irradiation. - Highlights: • Splenic SIGN-R1{sup +} macrophages are activated after γ-irradiation. • C3 and C4 levels increased and C3 was activated in the spleen after γ-irradiation. • SIGN-R1 mediated the systemic clearance of radiation-induced apoptotic cells in spleen and liver.

  9. The impact of R1and R3a genes on tuber resistance to late blight of the potato breeding clones

    Directory of Open Access Journals (Sweden)

    Zoteyeva Nadezhda

    2016-04-01

    Full Text Available Potato breeding clones were evaluated for resistance to late blight (agent Phytophthora infestans using tuber inoculation tests and for presence of the resistance alleles of R1 and R3a genes in polymerase chain reaction tests. Among clones tested those expressing high, moderate and low resistance were identified. The data were analysed for the impact of R1 and R3a genes on tuber resistance to late blight in tested plant material. In previous evaluations performed on smaller amount of clones the tuber resistance levels significantly depended on presence/absence of the resistance allele of R3a gene and did not depend on presence of R1 gene allele. In the current study the statistical analyses did not prove the significant difference in resistance levels depending on presence of the resistance alleles, neither of R1 gene, nor of R3a gene. Tuber resistant clones bearing R3a gene resistance alleles still noticeably prevailed over the clones bearing the alleles of R1 gene as well as over the clones bearing the no resistance alleles of both genes. In several cases the resistance of clones with detected resistance allele of R1 gene was higher compared to those derived from the same crosses and showing amplification of the allele of R3a gene or those with no resistance alleles. Clones accumulating the resistance alleles of both (R1 and R3a genes expressed high tuber resistance accompanied by necrotic reaction.

  10. [3H]Azidodantrolene photoaffinity labeling, synthetic domain peptides and monoclonal antibody reactivity identify the dantrolene binding sequence on RyR1

    Energy Technology Data Exchange (ETDEWEB)

    Paul-Pletzer, Kalanethee; Yamamoto, Takeshi; Bhat, Manju B.; Ma, Jianjie; Ikemoto, Noriaki; Jimenez, Leslie S.; Morimoto, Hiromi; Williams, Philip G.; Parness, Jerome

    2002-06-14

    Dantrolene is a drug that suppresses intracellular Ca2+ release from sarcoplasmic reticulum in normal skeletal muscle and is used as a therapeutic agent in individuals susceptible to malignant hyperthermia. Though its precise mechanism of action has not been elucidated, we have identified the N-terminal region (amino acids 1-1400) of the skeletal muscle isoform of the ryanodine receptor (RyR1), the primary Ca2+ release channel in sarcoplasmic reticulum, as a molecular target for dantrolene using the photoaffinity analog [3H]azidodantrolene(1). Here, we demonstrate that heterologously expressed RyR1 retains its capacity to be specifically labeled with [3H]azidodantrolene,indicating that muscle specific factors are not required for this ligand-receptor interaction. Synthetic domain peptides of RyR1, previously shown to affect RyR1 function in vitro and in vivo, were exploited as potential drug binding site mimics and used in photoaffinity labeling experiments. Only DP1 and DP1-2, peptide s containing the amino acid sequence corresponding to RyR1 residues 590-609, were specifically labeled by [3H]azidodantrolene. A monoclonal anti-RyR1 antibody which recognizes RyR1 and its 1400 amino acid N-terminal fragment, recognizes DP1 and DP1-2 in both Western blots and immunoprecipitation assays, and specifically inhibits [3H]azidodantrolene photolabeling of RyR1 and its N-terminal fragment in sarcoplasmic reticulum. Our results indicate that synthetic domain peptides can mimic a native, ligand binding conformation in vitro, and that the dantrolene binding site and the epitope for the monoclonal antibody on RyR1 are equivalent and composed of amino-acids 590-609.

  11. Iron-regulatory proteins DmdR1 and DmdR2 of Streptomyces coelicolor form two different DNA-protein complexes with iron boxes.

    OpenAIRE

    Flores, Francisco J; Martín, Juan F

    2004-01-01

    In high G+C Gram-positive bacteria, the control of expression of genes involved in iron metabolism is exerted by a DmdR [divalent (bivalent) metal-dependent regulatory protein] in the presence of Fe2+ or other bivalent ions. The dmdR1 and dmdR2 genes of Streptomyces coelicolor were overexpressed in Escherichia coli and the DmdR1 and DmdR2 proteins were purified to homogeneity. Electrophoretic mobility-shift assays showed that both DmdR1 and DmdR2 bind to the 19-nt tox and desA iron boxes form...

  12. N-glycosylation of mouse TRAIL-R and human TRAIL-R1 enhances TRAIL-induced death : N-glycosylation of TRAIL receptors

    OpenAIRE

    Dufour, Florent; Rattier, Thibault; Shirley, Sarah; Picarda, Gaelle; Constantinescu, Andrei Alexandru; Morlé, Aymeric; Zakaria, Al Batoul; Marcion, Guillaume; Causse, Sebastien; Szegezdi, Eva; Zajonc, Dirk Michael; Seigneuric, Renaud; Guichard, Gilles; Gharbi, Tijani; Picaud, Fabien

    2017-01-01

    International audience; APO2L/TRAIL (TNF-related apoptosis-inducing ligand) induces death of tumor cells through two agonist receptors, TRAIL-R1 and TRAIL-R2. We demonstrate here that N-linked glycosylation (N-glyc) plays also an important regulatory role for TRAIL-R1-mediated and mouse TRAIL receptor (mTRAIL-R)-mediated apoptosis, but not for TRAIL-R2, which is devoid of N-glycans. Cells expressing N-glyc-defective mutants of TRAIL-R1 and mouse TRAIL-R were less sensitive to TRAIL than their...

  13. Considerations about decommissioning of the IEA-R1 research reactor and the future of its installations after shutdown; Consideracoes sobre o descomissionamento do reator de pesquisa IEA-R1 e futuro de suas instalacoes apos o seu desligamento

    Energy Technology Data Exchange (ETDEWEB)

    Frajndlich, Roberto

    2014-07-01

    The IEA-R1 Nuclear Research Reactor, in operation since 1957, in the Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), is one of the oldest research reactors in the world. However at some point in time in the future, as example of the other reactors, it will be shutdown definitively. Before that time actually arrives, the operational organization needs to plan the future of its installations and define the final destination of equipment and radioactive as well as non-radioactive material contained inside the installations. These and other questions should be addressed in the so called Preliminary decommissioning plan of the installation, which is the subject of this work. The work initially presents an over view about the theme and defines the general and specific objectives describing, in succession, the directions that the operating organization should consider for the formulation of a decommissioning plan. The present structure of the Brazilian nuclear sector emphasizing principally the norms utilized in the management of radioactive waste is also presented. A description of principle equipment of the IEA-R1 reactor which constitutes its inventory of radioactive and non-radioactive material is given. The work emphasizes the experience of the reactor technicians, acquired during several reforms and modifications of the reactor installations realized during its useful life time. This experience may be of great help for the decommissioning in the future. An experiment using the high resolution gamma spectrometric method and computer calculation using Monte Carlo theory were performed with the objective of obtaining an estimate of the radioactive waste produced from dismantling of the reactor pool walls. The cost of reactor decommissioning for different choices of strategies was determined using the CERREX code. Finally, a discussion about different strategies is presented. On the basis of these discussions it is concluded that the most advantageous

  14. Homoeologous Recombination of the V1r1-V1r2 Gene Cluster of Pheromone Receptors in an Allotetraploid Lineage of Teleosts

    Directory of Open Access Journals (Sweden)

    Lei Zhong

    2017-11-01

    Full Text Available In contrast to other olfactory receptor families that exhibit frequent lineage-specific expansions, the vomeronasal type 1 receptor (V1R family exhibits a canonical six-member repertoire in teleosts. V1r1 and V1r2 are present in no more than one copy in all examined teleosts, including salmons, which are ancient polyploids, implying strict evolutionary constraints. However, recent polyploids have not been examined. Here, we identified a young allotetraploid lineage of weatherfishes and investigated their V1r1-V1r2 cluster. We found a novel pattern that the parental V1r1-V1r2 clusters had recombined in the tetraploid genome and that the recombinant was nearly fixed in the tetraploid population. Subsequent analyses suggested strong selective pressure, for both a new combination of paralogs and homogeneity among gene duplicates, acting on the V1r1-V1r2 pair.

  15. Development and implementation of a new pneumatic transfer system for materials irradiation at IEA-R1 reactor; Desenvolvimento e implementacao de um novo sistema pneumatico de transferencia para irradiacao de materiais no reator IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Fernando, Alberto de Jesus

    2011-07-01

    Pneumatic Transfer Systems (PTS) are classified as mechanical equipment largely operated all over the world for transport of a huge sort of objects, samples and materials located at nearly terminals or even at separated ones. System applicability is often recognized in many activities, such as medicine (hospital settings, clinical analysis labs), industry (steel, automobiles, mining, chemical, food, construction), trading (gas station, movies, supermarkets, banks, e-commerce) and federal agencies (post services, federal courts, public enterprises). In the nuclear settings, PTS shows also a vast array of applications, being a part of radioisotope production, as well as short-lived radiopharmaceuticals, including 67 Ga, 201 Tl, 18 F and 123 I-ultra pure. Besides, PTS are also used at radioactive waste management plants and research institutes that apply neutron activation analysis (NAA). This work was directed toward the design and operation of a new PTS for the IEA-R1 nuclear research reactor settled at Instituto de Pesquisas Energeticas e Nucleares (IPEN) for NAA application. With this aim, it was calculated the charge of reactor core grid plate and sample transport testing. Neutron flux at irradiating position was determined as 3,70 {+-} 0,26 10{sup 12} n cm{sup -2} s{sup -1}. (author)

  16. Irradiations of diamonds 'with layers' in nuclear reactor IPR-R1; Irradiacoes de diamantes 'com capas' no reator nuclear IPR-R1

    Energy Technology Data Exchange (ETDEWEB)

    Stasiulevicius, Roberto; Kastner, Geraldo F. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), Belo Horizonte, MG (Brazil); Chaves, Mario L.S.C.; Bottino, Elaine C.C. Bottino [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Museu de Historia Natural. Inst. de Geociencias e Grupo de Estudos de Mineralogia (GEMA)

    2000-07-01

    The experimental results on the effects of diamonds irradiation with neutrons and other radiations, are presented. These results pointed out the consequent changing effects on the original colours and also on the determination of the regional characteristic impurities, pointed as the responsible for the changes in the corresponding coloration centers. Diamond samples containing a green, brown or yellow tiny film, and also colorless ones, were studied. Their typical occurrence is in some sedimentary deposits of the most important producing areas in the State of Minas Gerais. The samples were submitted to irradiations in the rotative rack of the nuclear reactor IPR-R1 TRIGA Mark I (100 kW), with a thermal neutron flux of 6,6 x 10{sup 11} n.cm{sup -2}.s{sup -1}. The results, obtained by the conventional neutron activation analysis methods associated with k0 technique, are represented by typical traces of the detected impurities. The two main hypotheses formulated for the origin of the layers, are: in situ irradiation from radioactive materials existing in the neighborhoods, or the presence of certain 'chromoforous' elements located in the outer layer of the crystals, inducing the coloration. The obtained data analysis showed an association among the two factors, depending on the beds' location with the direct presence of characteristic radioactive minerals, in this case: monazite and zircon, present in the vicinities of some investigated deposits. (author)

  17. Military display performance parameters

    Science.gov (United States)

    Desjardins, Daniel D.; Meyer, Frederick

    2012-06-01

    The military display market is analyzed in terms of four of its segments: avionics, vetronics, dismounted soldier, and command and control. Requirements are summarized for a number of technology-driving parameters, to include luminance, night vision imaging system compatibility, gray levels, resolution, dimming range, viewing angle, video capability, altitude, temperature, shock and vibration, etc., for direct-view and virtual-view displays in cockpits and crew stations. Technical specifications are discussed for selected programs.

  18. Improved Complete Genome Sequence of the Extremely Radioresistant Bacterium Deinococcus radiodurans R1 Obtained Using PacBio Single-Molecule Sequencing.

    Science.gov (United States)

    Hua, Xiaoting; Hua, Yuejin

    2016-09-01

    The genome sequence of Deinococcus radiodurans R1 was published in 1999. We resequenced D. radiodurans R1 using PacBio and compared the sequence with the published one. Large insertions and single nucleotide polymorphisms (SNPs) were observed among the genome sequences. A more accurate genome sequence will be helpful to studies of D. radiodurans. Copyright © 2016 Hua and Hua.

  19. Prevention of Alcohol-Heightened Aggression by CRF-R1 Antagonists in Mice: Critical Role for DRN-PFC Serotonin Pathway

    OpenAIRE

    Quadros, Isabel M.; Hwa, Lara S.; Shimamoto, Akiko; Carlson, Julia; DeBold, Joseph F.; Miczek, Klaus A.

    2014-01-01

    Alcohol can escalate aggressive behavior in a significant subgroup of rodents, humans, and nonhuman primates. The present study investigated whether blockade of corticotropin-releasing factor receptor type 1 (CRF-R1) could prevent the emergence of alcohol-heightened aggression in mice. The serotonin (5-HT) pathway from the dorsal raphe nucleus (DRN) to the medial prefrontal cortex (mPFC) by CRF-R1 was investigated as a possible target for the prevention of alcohol-heightened aggressive behavi...

  20. Crystal structure of a PP2A B56-BubR1 complex and its implications for PP2A substrate recruitment and localization

    Directory of Open Access Journals (Sweden)

    Jiao Wang

    2016-06-01

    Full Text Available ABSTRACT Protein phosphatase 2A (PP2A accounts for the majority of total Ser/Thr phosphatase activities in most cell types and regulates many biological processes. PP2A holoenzymes contain a scaffold A subunit, a catalytic C subunit, and one of the regulatory/targeting B subunits. How the B subunit controls PP2A localization and substrate specificity, which is a crucial aspect of PP2A regulation, remains poorly understood. The kinetochore is a critical site for PP2A functioning, where PP2A orchestrates chromosome segregation through its interactions with BubR1. The PP2A-BubR1 interaction plays important roles in both spindle checkpoint silencing and stable microtubule-kinetochore attachment. Here we present the crystal structure of a PP2A B56-BubR1 complex, which demonstrates that a conserved BubR1 LxxIxE motif binds to the concave side of the B56 pseudo-HEAT repeats. The BubR1 motif binds to a groove formed between B56 HEAT repeats 3 and 4, which is quite distant from the B56 binding surface for PP2A catalytic C subunit and thus is unlikely to affect PP2A activity. In addition, the BubR1 binding site on B56 is far from the B56 binding site of shugoshin, another kinetochore PP2A-binding protein, and thus BubR1 and shugoshin can potentially interact with PP2A-B56 simultaneously. Our structural and biochemical analysis indicates that other proteins with the LxxIxE motif may also bind to the same PP2A B56 surface. Thus, our structure of the PP2A B56-BubR1 complex provides important insights into how the B56 subunit directs the recruitment of PP2A to specific targets.

  1. Pseudogenization of the umami taste receptor gene Tas1r1 in the giant panda coincided with its dietary switch to bamboo.

    Science.gov (United States)

    Zhao, Huabin; Yang, Jian-Rong; Xu, Huailiang; Zhang, Jianzhi

    2010-12-01

    Although it belongs to the order Carnivora, the giant panda is a vegetarian with 99% of its diet being bamboo. The draft genome sequence of the giant panda shows that its umami taste receptor gene Tas1r1 is a pseudogene, prompting the proposal that the loss of the umami perception explains why the giant panda is herbivorous. To test this hypothesis, we sequenced all six exons of Tas1r1 in another individual of the giant panda and five other carnivores. We found that the open reading frame (ORF) of Tas1r1 is intact in all these carnivores except the giant panda. The rate ratio (ω) of nonsynonymous to synonymous substitutions in Tas1r1 is significantly higher for the giant panda lineage than for other carnivore lineages. Based on the ω change and the observed number of ORF-disrupting substitutions, we estimated that the functional constraint on the giant panda Tas1r1 was relaxed ∼ 4.2 Ma, with its 95% confidence interval between 1.3 and 10 Ma. Our estimate matches the approximate date of the giant panda's dietary switch inferred from fossil records. It is probable that the giant panda's decreased reliance on meat resulted in the dispensability of the umami taste, leading to Tas1r1 pseudogenization, which in turn reinforced its herbivorous life style because of the diminished attraction of returning to meat eating in the absence of Tas1r1. Nonetheless, additional factors are likely involved because herbivores such as cow and horse still retain an intact Tas1r1.

  2. NtWRKY-R1, a Novel Transcription Factor, Integrates IAA and JA Signal Pathway under Topping Damage Stress in Nicotiana tabacum

    Directory of Open Access Journals (Sweden)

    Weihuan Jin

    2018-01-01

    Full Text Available Topping damage can induce the nicotine synthesis in tobacco roots, which involves the activation of JA and auxin signal transduction. It remains unclear how these hormone signals are integrated to regulate nicotine synthesis. Here we isolated a transcription factor NtWRKY-R1 from the group IIe of WRKY family and it had strong negative correlation with the expression of putrescine N-methyltransferase, the key enzyme of nicotine synthesis pathway. NtWRKY-R1 was specifically and highly expressed in tobacco roots, and it contains two transcriptional activity domains in the N- and C-terminal. The promoter region of NtWRKY-R1 contains two cis-elements which are responding to JA and auxin signals, respectively. Deletion of NtWRKY-R1 promoter showed that JA and auxin signals were subdued by NtWRKY-R1, and the expression of NtWRKY-R1 was more sensitive to auxin than JA. Furthermore, Yeast two-hybrid experiment demonstrated that NtWRKY-R1 can interact with the actin-binding protein. Our data showed that the intensity of JA and auxin signals can be translated into the expression of NtWRKY-R1, which regulates the balance of actin polymerization and depolymerization through binding actin-binding protein, and then regulates the expression of genes related to nicotine synthesis. The results will help us better understand the function of the WRKY-IIe family in the signaling crosstalk of JA and auxin under damage stress.

  3. Weighted two-parameter Bergman space inequalities

    OpenAIRE

    Wilson, J. Michael

    2003-01-01

    For f , a function defined on Rd1 ×Rd2 , take u to be its biharmonic extension into R+ +1 × Rd2 +1 . In this paper we prove strong d1 + sufficient conditions on measures µ and weights v such that the inequality 1/q q ∇2 u dµ(x1 , x2 , y1 , y2 ) d +1 d +1 R+1 ×R+2 1/p ≤ f p v dx Rd1 ×Rd2 will hold for all f in a reasonable test class, for 1 < p ≤ 2 ≤ q < ∞. Our result generalizes earlier work by R. L. Wheeden and the author on one-parameter harmonic extensions. We also obtain sufficient conditions ...

  4. The gravity field model IGGT_R1 based on the second invariant of the GOCE gravitational gradient tensor

    Science.gov (United States)

    Lu, Biao; Luo, Zhicai; Zhong, Bo; Zhou, Hao; Flechtner, Frank; Förste, Christoph; Barthelmes, Franz; Zhou, Rui

    2017-11-01

    Based on tensor theory, three invariants of the gravitational gradient tensor (IGGT) are independent of the gradiometer reference frame (GRF). Compared to traditional methods for calculation of gravity field models based on the gravity field and steady-state ocean circulation explorer (GOCE) data, which are affected by errors in the attitude indicator, using IGGT and least squares method avoids the problem of inaccurate rotation matrices. The IGGT approach as studied in this paper is a quadratic function of the gravity field model's spherical harmonic coefficients. The linearized observation equations for the least squares method are obtained using a Taylor expansion, and the weighting equation is derived using the law of error propagation. We also investigate the linearization errors using existing gravity field models and find that this error can be ignored since the used a-priori model EIGEN-5C is sufficiently accurate. One problem when using this approach is that it needs all six independent gravitational gradients (GGs), but the components V_{xy} and V_{yz} of GOCE are worse due to the non-sensitive axes of the GOCE gradiometer. Therefore, we use synthetic GGs for both inaccurate gravitational gradient components derived from the a-priori gravity field model EIGEN-5C. Another problem is that the GOCE GGs are measured in a band-limited manner. Therefore, a forward and backward finite impulse response band-pass filter is applied to the data, which can also eliminate filter caused phase change. The spherical cap regularization approach (SCRA) and the Kaula rule are then applied to solve the polar gap problem caused by GOCE's inclination of 96.7° . With the techniques described above, a degree/order 240 gravity field model called IGGT_R1 is computed. Since the synthetic components of V_{xy} and V_{yz} are not band-pass filtered, the signals outside the measurement bandwidth are replaced by the a-priori model EIGEN-5C. Therefore, this model is practically a

  5. Effects of conformational peptide probe DP4 on bidirectional signaling between DHPR and RyR1 calcium channels in voltage-clamped skeletal muscle fibers.

    Science.gov (United States)

    Olojo, Rotimi O; Hernández-Ochoa, Erick O; Ikemoto, Noriaki; Schneider, Martin F

    2011-05-18

    In skeletal muscle, excitation-contraction coupling involves the activation of dihydropyridine receptors (DHPR) and type-1 ryanodine receptors (RyR1) to produce depolarization-dependent sarcoplasmic reticulum Ca²⁺ release via orthograde signaling. Another form of DHPR-RyR1 communication is retrograde signaling, in which RyRs modulate the gating of DHPR. DP4 (domain peptide 4), is a peptide corresponding to residues Leu²⁴⁴²-Pro²⁴⁷⁷ of the central domain of the RyR1 that produces RyR1 channel destabilization. Here we explore the effects of DP4 on orthograde excitation-contraction coupling and retrograde RyR1-DHPR signaling in isolated murine muscle fibers. Intracellular dialysis of DP4 increased the peak amplitude of Ca²⁺ release during step depolarizations by 64% without affecting its voltage-dependence or kinetics, and also caused a similar increase in Ca²⁺ release during an action potential waveform. DP4 did not modify either the amplitude or the voltage-dependence of the intramembrane charge movement. However, DP4 augmented DHPR Ca²⁺ current density without affecting its voltage-dependence. Our results demonstrate that the conformational changes induced by DP4 regulate both orthograde E-C coupling and retrograde RyR1-DHPR signaling. Copyright © 2011 Biophysical Society. Published by Elsevier Inc. All rights reserved.

  6. Blink R1 latency utility in diagnosis and treatment assessment of polyradiculoneuropathy-organomegaly-endocrinopathy-monoclonal protein-skin changes and chronic inflammatory demyelinating polyradiculoneuropathy.

    Science.gov (United States)

    Wang, Wei; Litchy, William J; Mauermann, Michelle L; Dyck, P James B; Dispenzieri, Angela; Mandrekar, Jay; Dyck, Peter J; Klein, Christopher J

    2018-01-01

    In polyradiculoneuropathy-organomegaly-endocrinopathy-monoclonal protein-skin changes (POEMS) and chronic inflammatory demyelinating polyradiculoneuropathy (CIDP), limb nerve conduction studies (NCSs) are limited in identifying demyelination and in detecting treatment effects in severely affected patients. Blink R1 latency may improve these assessments. POEMS and CIDP patients who had undergone NCS and blink reflex were identified. Correlations among R1 latency, limb NCS, and neuropathy impairment scores (NIS) were compared. Among 182 patients (124 POEMS, 58 CIDP) who were identified, R1 prolongation (>13 ms) occurred in 64.3% (65.3% POEMS, 62.1% CIDP). R1 prolongation correlated with more severely affected NCS in both POEMS (ulnar CMAP 2.6 mV vs. 4.5 mV, P = 0.001) and CIDP (2.0 mV vs. 6.1 mV, P 13 ms) helped establish demyelination. In 31 patients (16 POEMS, 15 CIDP), the R1 latency changes were concordant with NIS changes in 94% of patients with POEMS and 60% of patients with CIDP. Blink R1 latencies are valuable in defining demyelination and detecting improvement in severely affected POEMS and CIDP patients. Muscle Nerve 57: E8-E13, 2018. © 2017 Wiley Periodicals, Inc.

  7. MadR1, a Mycobacterium tuberculosis cell cycle stress response protein that is a member of a widely conserved protein class of prokaryotic, eukaryotic and archeal origin.

    Science.gov (United States)

    Crew, Rebecca; Ramirez, Melissa V; England, Kathleen; Slayden, Richard A

    2015-05-01

    Stress-induced molecular programs designed to stall division progression are nearly ubiquitous in bacteria, with one well-known example being the participation of the SulA septum inhibiting protein in the SOS DNA damage repair response. Mycobacteria similarly demonstrate stress-altered growth kinetics, however no such regulators have been found in these organisms. We therefore set out to identify SulA-like regulatory proteins in Mycobacterium tuberculosis. A bioinformatics modeling-based approach led to the identification of rv2216 as encoding for a protein with weak similarity to SulA, further analysis distinguished this protein as belonging to a group of uncharacterized growth promoting proteins. We have named the mycobacterial protein encoded by rv2216 morphology altering division regulator protein 1, MadR1. Overexpression of madR1 modulated cell length while maintaining growth kinetics similar to wild-type, and increased the proportion of bent or V-form cells in the population. The presence of MadR1-GFP at regions of cellular elongation (poles) and morphological differentiation (V-form) suggests MadR1 involvement in phenotypic heterogeneity and longitudinal cellular growth. Global transcriptional analysis indicated that MadR1 functionality is linked to lipid editing programs required for growth and persistence. This is the first report to differentiate the larger class of these conserved proteins from SulA proteins and characterizes MadR1 effects on the mycobacterial cell. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. UV-dependent production of 25-hydroxyvitamin D{sub 2} in the recombinant yeast cells expressing human CYP2R1

    Energy Technology Data Exchange (ETDEWEB)

    Yasuda, Kaori; Endo, Mariko; Ikushiro, Shinichi; Kamakura, Masaki [Department of Biotechnology, Faculty of Engineering, Toyama Prefectural University, 5180 Kurokawa, Imizu, Toyama 939-0398 (Japan); Ohta, Miho [Department of Food and Nutrition Management Studies, Faculty of Human Development, Soai University, 4-4-1 Nanko-naka, Suminoe-ku, Osaka 559-0033 (Japan); Sakaki, Toshiyuki, E-mail: tsakaki@pu-toyama.ac.jp [Department of Biotechnology, Faculty of Engineering, Toyama Prefectural University, 5180 Kurokawa, Imizu, Toyama 939-0398 (Japan)

    2013-05-03

    Highlights: •We produce 25-hydroxyvitamin D in the recombinant yeast expressing human CYP2R1. •Vitamin D2 is produced in yeast from endogenous ergosterol with UV irradiation. •We produce 25-hydroxyvitamin D2 in the recombinant yeast without added substrate. -- Abstract: CYP2R1 is known to be a physiologically important vitamin D 25-hydroxylase. We have successfully expressed human CYP2R1 in Saccharomyces cerevisiae to reveal its enzymatic properties. In this study, we examined production of 25-hydroxylated vitamin D using whole recombinant yeast cells that expressed CYP2R1. When vitamin D{sub 3} or vitamin D{sub 2} was added to the cell suspension of CYP2R1-expressing yeast cells in a buffer containing glucose and β-cyclodextrin, the vitamins were converted into their 25-hydroxylated products. Next, we irradiated the cell suspension with UVB and incubated at 37 °C. Surprisingly, the 25-hydroxy vitamin D{sub 2} was produced without additional vitamin D{sub 2}. Endogenous ergosterol was likely converted into vitamin D{sub 2} by UV irradiation and thermal isomerization, and then the resulting vitamin D{sub 2} was converted to 25-hydroxyvitamin D{sub 2} by CYP2R1. This novel method for producing 25-hydroxyvitamin D{sub 2} without a substrate could be useful for practical purposes.

  9. Bub3-BubR1-dependent sequestration of Cdc20Fizzy at DNA breaks facilitates the correct segregation of broken chromosomes.

    Science.gov (United States)

    Derive, Nicolas; Landmann, Cedric; Montembault, Emilie; Claverie, Marie-Charlotte; Pierre-Elies, Priscillia; Goutte-Gattat, Damien; Founounou, Nabila; McCusker, Derek; Royou, Anne

    2015-11-09

    The presence of DNA double-strand breaks during mitosis is particularly challenging for the cell, as it produces broken chromosomes lacking a centromere. This situation can cause genomic instability resulting from improper segregation of the broken fragments into daughter cells. We recently uncovered a process by which broken chromosomes are faithfully transmitted via the BubR1-dependent tethering of the two broken chromosome ends. However, the mechanisms underlying BubR1 recruitment and function on broken chromosomes were largely unknown. We show that BubR1 requires interaction with Bub3 to localize on the broken chromosome fragments and to mediate their proper segregation. We also find that Cdc20, a cofactor of the E3 ubiquitin ligase anaphase-promoting complex/cyclosome (APC/C), accumulates on DNA breaks in a BubR1 KEN box-dependent manner. A biosensor for APC/C activity demonstrates a BubR1-dependent local inhibition of APC/C around the segregating broken chromosome. We therefore propose that the Bub3-BubR1 complex on broken DNA inhibits the APC/C locally via the sequestration of Cdc20, thus promoting proper transmission of broken chromosomes. © 2015 Derive et al.

  10. On the phosphorylase activity of GH3 enzymes: A β-N-acetylglucosaminidase from Herbaspirillum seropedicae SmR1 and a glucosidase from Saccharopolyspora erythraea.

    Science.gov (United States)

    Ducatti, Diogo R B; Carroll, Madison A; Jakeman, David L

    2016-11-29

    A phosphorolytic activity has been reported for beta-N-acetylglucosaminidases from glycoside hydrolase family 3 (GH3) giving an interesting explanation for an unusual histidine as catalytic acid/base residue and suggesting that members from this family may be phosphorylases [J. Biol. Chem. 2015, 290, 4887]. Here, we describe the characterization of Hsero1941, a GH3 beta-N-acetylglucosaminidase from the endophytic nitrogen-fixing bacterium Herbaspirillum seropedicae SmR1. The enzyme has significantly higher activity against pNP-beta-D-GlcNAcp (Km = 0.24 mM, kcat = 1.2 s-1, kcat/Km = 5.0 mM-1s-1) than pNP-beta-D-Glcp (Km = 33 mM, kcat = 3.3 × 10-3 s-1, kcat/Km = 9 × 10-4 mM-1s-1). The presence of phosphate failed to significantly modify the kinetic parameters of the reaction. The enzyme showed a broad aglycone site specificity, being able to hydrolyze sugar phosphates beta-D-GlcNAc 1P and beta-D-Glc 1P, albeit at a fraction of the rate of hydrolysis of aryl glycosides. GH3 beta-glucosidase EryBI, that does not have a histidine as the general acid/base residue, also hydrolyzed beta-D-Glc 1P, at comparable rates to Hsero1941. These data indicate that Hsero1941 functions primarily as a hydrolase and that phosphorolytic activity is likely adventitious. The prevalence of histidine as a general acid/base residue is not predictive, nor correlative, with GH3 beta-N-acetylglucosaminidases having phosphorolytic activity. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Yersinia enterocolitica-Specific Infection by Bacteriophages TG1 and ϕR1-RT Is Dependent on Temperature-Regulated Expression of the Phage Host Receptor OmpF.

    Science.gov (United States)

    Leon-Velarde, Carlos G; Happonen, Lotta; Pajunen, Maria; Leskinen, Katarzyna; Kropinski, Andrew M; Mattinen, Laura; Rajtor, Monika; Zur, Joanna; Smith, Darren; Chen, Shu; Nawaz, Ayesha; Johnson, Roger P; Odumeru, Joseph A; Griffiths, Mansel W; Skurnik, Mikael

    2016-09-01

    Bacteriophages present huge potential both as a resource for developing novel tools for bacterial diagnostics and for use in phage therapy. This potential is also valid for bacteriophages specific for Yersinia enterocolitica To increase our knowledge of Y. enterocolitica-specific phages, we characterized two novel yersiniophages. The genomes of the bacteriophages vB_YenM_TG1 (TG1) and vB_YenM_ϕR1-RT (ϕR1-RT), isolated from pig manure in Canada and from sewage in Finland, consist of linear double-stranded DNA of 162,101 and 168,809 bp, respectively. Their genomes comprise 262 putative coding sequences and 4 tRNA genes and share 91% overall nucleotide identity. Based on phylogenetic analyses of their whole-genome sequences and large terminase subunit protein sequences, a genus named Tg1virus within the family Myoviridae is proposed, with TG1 and ϕR1-RT (R1RT in the ICTV database) as member species. These bacteriophages exhibit a host range restricted to Y. enterocolitica and display lytic activity against the epidemiologically significant serotypes O:3, O:5,27, and O:9 at and below 25°C. Adsorption analyses of lipopolysaccharide (LPS) and OmpF mutants demonstrate that these phages use both the LPS inner core heptosyl residues and the outer membrane protein OmpF as phage receptors. Based on RNA sequencing and quantitative proteomics, we also demonstrate that temperature-dependent infection is due to strong repression of OmpF at 37°C. In addition, ϕR1-RT was shown to be able to enter into a pseudolysogenic state. Together, this work provides further insight into phage-host cell interactions by highlighting the importance of understanding underlying factors which may affect the abundance of phage host receptors on the cell surface. Only a small number of bacteriophages infecting Y. enterocolitica, the predominant causative agent of yersiniosis, have been previously described. Here, two newly isolated Y. enterocolitica phages were studied in detail, with the aim of

  12. Analysis of occupational doses from the CDTN reactor TRIGA IPR-R1 for radiation protection optimization

    Energy Technology Data Exchange (ETDEWEB)

    Maletta, Paulo G.M.; Leal, Marcos A.; Wakabayashi, Tetsuaki, E-mail: pgmm@cdtn.br, E-mail: amgr@cdtn.br, E-mail: leal@cdtn.br, E-mail: tw@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Guimaraes, Adriana M.; Silva, Teogenes A. da, E-mail: silvata@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Post Graduation Programme in Sciences and Technology of Radiations

    2011-07-01

    Worker and area monitoring have routinely been done around the CDTN TRIGA IPR-R1 research reactor aiming to optimize and assure radiation protection safety. As part of the implementation of the ALARA program, individual doses from planned practices were analyzed. Personnel dose equivalents, Hp(10), from up to 39 occupationally exposed workers were daily reported during their stay in the restricted area. Measurements were done with a RAD-60 Rados electronic personal dosimeter with a 1 {mu}Sv low detection limit. Results of about 5000 measurements in a year obtained during 2009 and 2010 showed that monthly doses did not exceed 60 {mu}Sv, except in very specific cases of non-routine practices. Results also suggested that values of 40, 100 and 800 {mu}Sv could be adopted as weekly, monthly and annual dose constraints. Considering that measured doses were very small when compared to the 20 mSv/year dose limit, it was concluded that the adoption of the dose constraints was enough to assume the compliance with the ALARA principle and that changes in the routine procedure or in the reactor facility design are not needed. (author)

  13. Patterning and gastrulation defects caused by the tw18 lethal are due to loss of Ppp2r1a

    Directory of Open Access Journals (Sweden)

    Lisette Lange

    2017-06-01

    Full Text Available The mouse t haplotype, a variant 20 cM genomic region on Chromosome 17, harbors 16 embryonic control genes identified by recessive lethal mutations isolated from wild mouse populations. Due to technical constraints so far only one of these, the tw5 lethal, has been cloned and molecularly characterized. Here we report the molecular isolation of the tw18 lethal. Embryos carrying the tw18 lethal die from major gastrulation defects commencing with primitive streak formation at E6.5. We have used transcriptome and marker gene analyses to describe the molecular etiology of the tw18 phenotype. We show that both WNT and Nodal signal transduction are impaired in the mutant epiblast, causing embryonic patterning defects and failure of primitive streak and mesoderm formation. By using a candidate gene approach, gene knockout by homologous recombination and genetic rescue, we have identified the gene causing the tw18 phenotype as Ppp2r1a, encoding the PP2A scaffolding subunit PR65alpha. Our work highlights the importance of phosphatase 2A in embryonic patterning, primitive streak formation, gastrulation, and mesoderm formation downstream of WNT and Nodal signaling.

  14. Caught in the act: the dialogue between bacteriophage R17 and the type IV secretion machine of plasmid R1.

    Science.gov (United States)

    Berry, Trista M; Christie, Peter J

    2011-12-01

    Bacteria communicate with each other through contact-independent and -dependent signalling mechanisms. Sensory perception of both types of signals is needed for conjugative transfer of mobile DNA elements via type IV secretion systems (T4SSs) to bacterial or eukaryotic target cells. While the regulatory circuitries coupling extracellular quorum and environmental signals to transcription of T4SS genes are increasingly understood, it remains fundamentally unknown how a potential recipient cell stimulates donor conjugative DNA transfer upon contact. In this issue, Lang et al. (2011) report use of the male-specific bacteriophage R17, a phage that binds conjugative pili elaborated by IncF plasmid R1, to define requirements for phage-contact-mediated T4SS activation and phage penetration. They report that R17 penetrates only through T4SS channels engaged for delivery of their plasmid cargo to recipient cells. Engagement requires docking of catalytically active relaxase TraI bound at oriT with the TraD substrate receptor (also termed the T4CP). The data, together with recent ultrastructural and biochemical findings, support an intriguing new model that the T4CP cumulatively senses an intracellular signal (substrate docking) and an extracellular signal (pilus bound by phage or a recipient cell) to co-ordinate a late stage morphogenetic or gating reaction that enables bidirectional transmission of nucleoprotein substrates through the T4SS. © 2011 Blackwell Publishing Ltd.

  15. An activation domain of plasmid R1 TraI protein delineates stages of gene transfer initiation.

    Science.gov (United States)

    Lang, Silvia; Kirchberger, Paul C; Gruber, Christian J; Redzej, Adam; Raffl, Sandra; Zellnig, Guenther; Zangger, Klaus; Zechner, Ellen L

    2011-12-01

    Bacterial conjugation is a form of type IV secretion that transports protein and DNA to recipient cells. Specific bacteriophage exploit the conjugative pili and cell envelope spanning protein machinery of these systems to invade bacterial cells. Infection by phage R17 requires F-like pili and coupling protein TraD, which gates the cytoplasmic entrance of the secretion channel. Here we investigate the role of TraD in R17 nucleoprotein uptake and find parallels to secretion mechanisms. The relaxosome of IncFII plasmid R1 is required. A ternary complex of plasmid oriT, TraD and a novel activation domain within the N-terminal 992 residues of TraI contributes a key mechanism involving relaxase-associated properties of TraI, protein interaction and the TraD ATPase. Helicase-associated activities of TraI are dispensable. These findings distinguish for the first time specific protein domains and complexes that process extracellular signals into distinct activation stages in the type IV initiation pathway. The study also provided insights into the evolutionary interplay of phage and the plasmids they exploit. Related plasmid F adapted to R17 independently of TraI. It follows that selection for phage resistance drives not only variation in TraA pilins but diversifies TraD and its binding partners in a plasmid-specific manner. © 2011 Blackwell Publishing Ltd.

  16. Metabolism Study of Notoginsenoside R1, Ginsenoside Rg1 and Ginsenoside Rb1 of Radix Panax Notoginseng in Zebrafish

    Directory of Open Access Journals (Sweden)

    Changmei Wang

    2011-08-01

    Full Text Available Zebrafish, a common model organism for studies of vertebrate development and gene function, has been used in pharmaceutical research as a new and powerful tool in recent years. In the present study, we applied zebrafish for the first time in a metabolic study of notoginsenoside (R1, ginsenoside (Rg1 and ginsenoside (Rb1, which are saponins isolated from Panax notoginseng. Metabolites of these three saponin compounds in zebrafish after exposure for 24 h were identified by high performance liquid chromatography - electrospray mass spectrometry (HPLC-ESI-MS with a Zorbax C-18 column for separation using a binary gradient elution of 0.05% formic acid acetonitrile - 0.05% formic acid water. The quasi-molecular ions of compounds were detected in negative mode. Step-wise deglycosylation metabolites and hydroxylation metabolites of the three saponins were found, which were coincide with regular methods for metabolic analysis. Our study demonstrated that the zebrafish model can successfully imitate the current metabolic model with advantages of lower cost, far less amount of compound needed, easy set up and high performance. Our data suggests that the zebrafish metabolic model has the potential for developing a novel method for quickly predicting the metabolism of Chinese herb components, including those of trace compounds.

  17. Identification and molecular mapping of PdR1, a primary resistance gene to Pierce's disease in Vitis.

    Science.gov (United States)

    Krivanek, A F; Riaz, S; Walker, M A

    2006-04-01

    A major quantitative trait locus (QTL) controlling resistance to Pierce's disease (PD) of grape, caused by the bacterium Xylella fastidiosa (Xf), was identified on a Vitis linkage map and denoted as 'Pierce's disease resistance 1' (PdR1). Placement of the locus was accomplished by evaluating a family of full-sib progeny from a cross of two PD-resistant interspecific hybrids with resistance inherited from Vitis arizonica. Resistance was measured under greenhouse conditions by direct quantification of Xf numbers in stem tissues as well as by evaluation of disease symptoms based on leaf scorch and a cane maturation index (CMI). A large QTL (LOD 17.2) accounting for 72% of the phenotypic variance in bacterial numbers was localized to linkage group 14 of the male parent F8909-17. The approximate 95% confidence interval around the QTL peak extended 5.7 cM when using composite interval mapping. The other disease evaluation methods (leaf scorch and CMI, respectively) placed the resistance QTL to the same region on linkage group 14, although at wider 95% confidence intervals (6.0 and 7.5 cM), lower peak LOD scores (11.9 and 7.7) and accounting for less phenotypic variance (59 and 42%). This is the first report of an Xf resistance QTL mapped in any crop species. The relevance of the markers located in the region spanning the QTL will be discussed, addressing their usefulness for the development of PD-resistant grape cultivars.

  18. Dominant gene cpls(r)1 corresponding to premature leaf senescence resistance in cotton (Gossypium hirsutum L.).

    Science.gov (United States)

    Zhao, Jingqing; Jiang, Tengfei; Liu, Zhi; Zhang, Wenwei; Jian, Guiliang; Qi, Fangjun

    2012-08-01

    Cotton (Gossypium hirsutum L.) premature leaf senescence-resistant inbred XLZ33 and senescence-susceptible inbred lines XLZ13 were selected and crossed to produce F(1), F(1)-reciprocal, F(2) and BC(1) generations for evaluation of leaf senescence process and inheritance. The results showed that leaf senescence processes for XLZ13 and XLZ33 were obviously different and leaf senescence traits could be distinguished between the two parents at particular periods of cotton growth. Inheritance anlysis for the cotton premature leaf senescence resistant trait further showed that the segregation in the F(2) fit a 3:1 ratio inheritance pattern, with resistance being dominant. The backcross of F(1) to the susceptible parent produced a 1:1 ratio, confirming that cotton premature leaf senescence resistant trait was from a single gene. The single dominant gene controlling cotton premature leaf senescence resistance in XLZ33 was named as cotton premature leaf senescence resistance 1, with the symbol cpls(r)1. © 2012 Institute of Botany, Chinese Academy of Sciences.

  19. Role of tau kinases (CDK5R1 and GSK3B) in Parkinson's disease: a study from India.

    Science.gov (United States)

    Das, Gautami; Misra, Amar K; Das, Shyamal K; Ray, Kunal; Ray, Jharna

    2012-07-01

    Glycogen synthase kinase-3β (GSK3B) and cyclin-dependent kinase 5 (CDK5) are the 2 major protein kinases involved in abnormal phosphorylation of tau. To determine their potential role in the pathogenesis of Parkinson's disease (PD) we analyzed 2 functional single nucleotide polymorphisms (SNPs) of GSK3B (rs334558 and rs6438552) and rs735555 of CDK5 regulatory subunit 1 (CDK5R1) in 373 PD cases and 346 healthy controls of eastern India. The C,C and T,C haplotypes of GSK3B were respectively moderately associated with increased risk and protection for late onset PD (LOPD) (odds ratio [OR], 1.399; 95% confidence interval [CI], 1.069-1.829; p = 0.015, and OR, 0.436; 95% CI, 0.222-0.853; p = 0.016, respectively). Moreover, moderate to significant interaction between different loci were observed for the entire PD cohort or late onset PD only. However, among these interactions, individuals carrying the (C/C) genotype at both loci (rs6438552 and rs735555) had almost twice the risk of developing PD than those without this genotypic combination (OR, 1.871; 95% CI, 1.181-2.964; p = 0.009). Thus, synergistic effect between the 2 major tau kinases, through these SNPs, appears to determine the risk profile for PD. Copyright © 2012 Elsevier Inc. All rights reserved.

  20. Notoginsenoside R1 Alleviates Oxygen-Glucose Deprivation/Reoxygenation Injury by Suppressing Endoplasmic Reticulum Calcium Release via PLC.

    Science.gov (United States)

    Wang, Yan; Tu, Liu; Li, Yingbo; Chen, Di; Liu, Zhao; Hu, Xuelian; Wang, Shali

    2017-11-24

    As documented in our previous study, notoginsenoside R1 (NGR1) can inhibit neuron apoptosis and the expression of endoplasmic reticulum (ER) stress-associated pro-apoptotic proteins in hypoxic-ischemic encephalopathy. Recent evidence indicates that the Phospholipase C (PLC)/inositol 1,4,5-trisphosphate receptor (IP3R) is important for the regulation of Ca 2+ release in the ER. Ca 2+ imbalance can stimulate ER stress, CAMKII, and cell apoptosis. The purpose of this study was to further investigate the neuroprotective effect of NGR1 and elucidate how NGR1 regulates ER stress and cell apoptosis in the oxygen-glucose deprivation/reoxygenation (OGD/R) model. Cells were exposed to NGR1 or the PLC activator m-3M3FBS. Then, IP3R- and IP3-induced Ca 2+ release (IICR) and activation of the ER stress and CaMKII signal pathway were measured. The results showed that NGR1 inhibited IICR and strengthened the binding of GRP78 with PERK and IRE1. NGR1 also alleviated the activation of the CaMKII pathway. Pretreatment with m-3M3FBS attenuated the neuroprotective effect of NGR1; IICR was activated, activation of the ER stress and CaMKII pathway was increased, and more cells were injured. These results indicate that NGR1 may suppress activation of the PLC/IP3R pathway, subsequently inhibiting ER Ca 2+ release, ER stress, and CaMKII and resulting in suppressed cell apoptosis.

  1. Myocilin is involved in NgR1/Lingo-1-mediated oligodendrocyte differentiation and myelination of the optic nerve.

    Science.gov (United States)

    Kwon, Heung Sun; Nakaya, Naoki; Abu-Asab, Mones; Kim, Hong Sug; Tomarev, Stanislav I

    2014-04-16

    Myocilin is a secreted glycoprotein that belongs to a family of olfactomedin domain-containing proteins. Although myocilin is detected in several ocular and nonocular tissues, the only reported human pathology related to mutations in the MYOCILIN gene is primary open-angle glaucoma. Functions of myocilin are poorly understood. Here we demonstrate that myocilin is a mediator of oligodendrocyte differentiation and is involved in the myelination of the optic nerve in mice. Myocilin is expressed and secreted by optic nerve astrocytes. Differentiation of optic nerve oligodendrocytes is delayed in Myocilin-null mice. Optic nerves of Myocilin-null mice contain reduced levels of several myelin-associated proteins including myelin basic protein, myelin proteolipid protein, and 2'3'-cyclic nucleotide 3'-phosphodiesterase compared with those of wild-type littermates. This leads to reduced myelin sheath thickness of optic nerve axons in Myocilin-null mice compared with wild-type littermates, and this difference is more pronounced at early postnatal stages compared with adult mice. Myocilin also affects differentiation of oligodendrocyte precursors in vitro. Its addition to primary cultures of differentiating oligodendrocyte precursors increases levels of tested markers of oligodendrocyte differentiation and stimulates elongation of oligodendrocyte processes. Myocilin stimulation of oligodendrocyte differentiation occurs through the NgR1/Lingo-1 receptor complex. Myocilin physically interacts with Lingo-1 and may be considered as a Lingo-1 ligand. Myocilin-induced elongation of oligodendrocyte processes may be mediated by activation of FYN and suppression of RhoA GTPase.

  2. Neutron field characterization in the installation for BNCT study in the IEA-R1 reactor; Caracterizacao do campo de neutrons na instalacao para estudo em BNCT no reator IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Carneiro Junior, Valdeci

    2008-07-01

    This work aims to characterize the mixed neutron and gamma field, in the sample irradiation position, in a research installation for Boron Neutron Capture Therapy (BNCT), in the IPEN IEA-R1 reactor. The BNCT technique has been studied as a safe and selective option in the treatment of resistant cancerigenous tumors or considered non-curable by the conventional techniques, for example, the Glioblastoma Multiform - a brain cancerigenous tumor. Neutron flux measurements were carried out: thermal, resonance and fast, as well as neutron and gamma rays doses, in the sample position, using activation foils detectors and thermoluminescent dosimeters. For the determination of the neutron spectrum and intensity, a set of different threshold activation foils and gold foils covered and uncovered with cadmium irradiated in the installation was used, analyzed by a high Pure Germanium semiconductor detector, coupled to an electronic system suitable for gamma spectrometry. The results were processed with the SAND-BP code. The doses due to gamma and neutron rays were determined using thermoluminescent dosimeters TLD 400 and TLD 700 sensitive to gamma and TLD 600, sensitive to neutrons. The TLDs were selected and used for obtaining the calibration curves - dosimeter answer versus dose - from each of the TLD three types, which were necessary to calculate the doses due to neutron and gamma, in the sample position. The radiation field, in the sample irradiation position, was characterized flux for thermal neutrons of 1.39.10{sup 8} {+-} 0,12.10{sup 8} n/cm{sup 2}s the doses due to thermal neutrons are three times higher than those due to gamma radiation and confirm the reproducibility and consistency of the experimental findings obtained. Considering these results, the neutron field and gamma radiation showed to be appropriated for research in BNCT. (author)

  3. Cardioprotective effect of notoginsenoside R1 in a rabbit lung remote ischemic postconditioning model via activation of the TGF-β1/TAK1 signaling pathway.

    Science.gov (United States)

    Ge, Zhi-Ru; Xu, Mao-Chun; Huang, Y U; Zhang, Chen-Jun; Lin, J E; Ruan, Chang-Wu

    2016-06-01

    Pharmacological postconditioning using cardioprotective agents is able to reduce myocardial infarct size. Notoginsenoside R1 (NG-R1), a phytoestrogen isolated from Panax notoginseng saponins (PNS), is considered to have anti-oxidative and anti-apoptotic properties. However, its cardioprotective properties and underlying mechanisms remain largely unknown. The aim of the present study was to determine the cardioprotective and anti-apoptotic effects of NG-R1 in an ischemia-reperfusion (IR)-induced myocardial injury rabbit model. A total of 45 Japanese big-ear rabbits were equally randomized to three groups: Control group, remote ischemic postconditioning (RIP) group and NG-R1 intervention group. At the endpoint of the experiment, the animals were sacrificed to remove myocardial tissues for the detection of transforming growth factor (TGF)-β1-TGF-β activated kinase 1 (TAK1) pathway-related proteins by immunohistochemistry and western blot analysis, the activities of caspase-3, -8 and -9 in myocardial cells by fluorometric assay, and the apoptosis of myocardial cells by terminal deoxynucleotidyl-transferase-mediated dUTP nick end labeling. Right and left lung tissues were stained with hematoxylin and eosin (H&E) to observe the severity of injury. NG-R1 treatment reduced the activity of superoxide dismutase, increased the content of malondialdehyde, reduced the activities of caspase-3, -8 and -9, and inhibited the apoptosis of myocardial cells in rabbits undergoing RIP. In addition, the expression of TGF-β1-TAK1 signaling pathway-related proteins was downregulated following NG-R1 intervention. H&E staining of bilateral lung tissues showed that cell morphology was generally intact without significant alveolar congestion, and there was no significant difference among the three groups. These results indicate that NG-R1 protects the heart against IR injury, possibly by inhibiting the activation of the TGF-β1-TAK1 signaling pathway and attenuating apoptotic stress in the

  4. Exopolysaccharides from Lactobacillus delbrueckii OLL1073R-1 modulate innate antiviral immune response in porcine intestinal epithelial cells.

    Science.gov (United States)

    Kanmani, Paulraj; Albarracin, Leonardo; Kobayashi, Hisakazu; Iida, Hikaru; Komatsu, Ryoya; Humayun Kober, A K M; Ikeda-Ohtsubo, Wakako; Suda, Yoshihito; Aso, Hisashi; Makino, Seiya; Kano, Hiroshi; Saito, Tadao; Villena, Julio; Kitazawa, Haruki

    2017-08-08

    Previous studies demonstrated that the extracellular polysaccharides (EPSs) produced by Lactobacillus delbrueckii OLL1073R-1 (LDR-1) improve antiviral immunity, especially in the systemic and respiratory compartments. However, it was not studied before whether those EPSs are able to beneficially modulate intestinal antiviral immunity. In addition, LDR-1-host interaction has been evaluated mainly with immune cells while its interaction with intestinal epithelial cells (IECs) was not addressed before. In this work, we investigated the capacity of EPSs from LDR-1 to modulate the response of porcine IECs (PIE cells) to the stimulation with the Toll-like receptor (TLR)-3 agonist poly(I:C) and the role of TLR2, TLR4, and TLR negative regulators in the immunoregulatory effect. We showed that innate immune response triggered by TLR3 activation in porcine IECs was differentially modulated by EPS from LDR-1. EPSs treatment induced an increment in the expression of interferon (IFN)-α and IFN-β in PIE cells after the stimulation with poly(I:C) as well as the expression of the antiviral factors MxA and RNase L. Those effects were related to the reduced expression of A20 in EPS-treated PIE cells. EPS from LDR-1 was also able to reduce the expression of IL-6 and proinflammatory chemokines. Although further in vivo studies are needed, our results suggest that these EPSs or a yogurt fermented with LDR-1 have potential to improve intestinal innate antiviral response and protect against intestinal viruses. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. The awareness of the functional and near population with the relation to the research nuclear reactor IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Vanni, Silvia R.; Martins, Maria da Penha S. [Centro Tecnologico da Marinha (CTMSP), SP (Brazil); Sabundjian, Gaiane, E-mail: gdjian@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    After the natural accident that hit Japan in the beginning of March of 2011, and that ended into an accident of great proportions in the nuclear installations of Fukushima, it has now the debate over the lack of information that the population in general has over the nuclear energy. The dissemination of information, about the operation and security of the nuclear reactors, has the purpose of softening the effect that the pessimistic atmosphere has over its using. This study was reinforced by the memories of serious consequences due to other nuclear accidents that have already happened (Chernobyl, Three-Mile and Hiroshima/Nagasaki event), bringing insecurity, fear and even revenge from part of the public. Over all, people are not sufficiently informed about the positives and negatives aspects of the nuclear energy. It is necessary the adoption of a clear and aware policy with the population, about the pacific use of nuclear energy. Today, the international and national organizations of control of nuclear energy, the International Atomic Energy Agency (IAEA) and the Comissao Nacional de Energia Nuclear (CNEN), have respectively, published information about this subject using a more professional way and of hard access for the public in general. This work has the goal of checking the level of information that the population of workers and individuals of the close public to the research nuclear reactor IEA-R1, located in the Institute of Nuclear Research (IPEN), University City, Sao Paulo, Brazil, has over it. The way used for this study, involved questionnaires with straight questions and of simple language over the subject, to people of all different social, economic and cultural classes, from 12 to 80 years old. From the results found after this work, it was verified the necessity to elaborate a project of awareness of information and clarification about the nuclear energy, using ways of communication that exist and that are easy for the public to understand. (author)

  6. TRAPPIST photometry and imaging monitoring of comet C/2013 R1 (Lovejoy): Implications for the origin of daughter species

    Science.gov (United States)

    Opitom, C.; Jehin, E.; Manfroid, J.; Hutsemékers, D.; Gillon, M.; Magain, P.

    2015-12-01

    We report the results of the narrow-band photometry and imaging monitoring of comet C/2013 R1 (Lovejoy) with the robotic telescope TRAPPIST (La Silla observatory). We gathered around 400 images over 8 months pre- and post-perihelion between September 12, 2013 and July 6, 2014. We followed the evolution of the OH, NH, CN, C3, and C2 production rates computed with the Haser model, as well as the evolution of the dust production. All five gas species display an asymmetry about perihelion, since the rate of brightening is steeper than the rate of fading. The study of the coma morphology reveals gas and dust jets that indicate one or several active zone(s) on the nucleus. The dust, C2, and C3 morphologies present some similarities, while the CN morphology is different. OH and NH are enhanced in the tail direction. The study of the evolution of the comet activity shows that the OH, NH, and C2 production rate evolution with the heliocentric distance is correlated to the dust evolution. The CN and, to a lesser extent, the C3 do not display such a correlation with the dust. This evidence and the comparison with parent species production rates indicate that C2 and C3, on one hand, and OH and NH, on the other, could be - at least partially - released from organic - rich grains and icy grains. On the contrary, all evidences point to HCN being the main parent of CN in this comet. Appendix A is available in electronic form at http://www.aanda.org

  7. Notoginsenoside R1 reduces blood pressure in spontaneously hypertensive rats through a long non-coding RNA AK094457.

    Science.gov (United States)

    Yang, Ying; Xi, Peng; Xie, Yuan; Zhao, Cuimei; Xu, Jiahong; Jiang, Jinfa

    2015-01-01

    Notoginsenoside R1 (NR1) is the main bioactive component in panaxnotoginseng, an old herb medicine widely used in Asian countries in the treatment of microcirculatory diseases. However, little is known about the effect of NR1 on antihypertension and the underlying mechanisms are still not clear. This study is aim to investigate the effect and elicit the mechanism of NR1 in antihypertension. Firstly, to assess the ability of NR1 in antihypertension, NR1 was injected in spontaneously hypertensive rats (SHR) via the vena caudalis. Then we examined the rats systolic blood pressure and inducible nitric oxide synthase (iNOS) activation in rats thoracoabdominal aortic. To further investigate the molecular mechanism of NR1 reduce blood pressure, primary SHR and WYK rat vascular endothelial cells (RVECs) were used for next study. LncRNAs related to hypertension were gained from bioinformatics analysis. The role of LncRNAs was finally characterized in RVECs by siRNA. Our results showed that NR1 significantly reduce blood pressure in SHR and induce nitric oxide (NO) generation through increasing the phosphorylation of iNOS. Through bioinformatics analysis and knockdown LncRNA AK094457 in RVECs, we also found LncRNA AK094457 promoted iNOS expression and NO concentration. Thus, we conclude that NR1 reduces the caudal blood pressure of SHR through induction of iNOS regulated by long non-coding RNA AK094457. These findings may have important implications for understanding the mechanisms of NR1 regulation blood pressure.

  8. Hubungan Antara Parameter Model Dan Parameter Peramalan

    OpenAIRE

    Siregar, Salamat

    2011-01-01

    Studies on the relationship between model parameters and forecasting parameter is an urgent and important study carried out in order to obtain some certainty about how exactly the effect of one parameter model for others of other model parameters and forecast parameters. To make the discussion of the issue, selected cases of weather forecasting (weather forecasting) as a model case to study the relationship between model parameters and weather forecasting. The model used was the Numerical Wea...

  9. The evolution of doses in the IEA-R1 reactor environment and tendencies based on the current results; Evolucao das doses no ambiente do Reator IEA-R1 e tendencias com base nos resultados atuais

    Energy Technology Data Exchange (ETDEWEB)

    Toyoda, Eduardo Yoshio

    2016-11-01

    The IPEN / CNEN-SP have a Nuclear Research Reactor-NRR named IEA-R1, in operation from 1957. It is an open swimming pool reactor using light water as shielding, moderator and as cooling, the volume of this pool is 273m{sup 3}.Until 1995 the reactor operated daily at a power of 2,0 MW. From June of that year, after a few safety modifications the reactor began operating in continuous way from Monday to Wednesday without shutdown totalizing 64 hours per week and the power was increased to 4,5MW also. Because of these changes, continuous operation and increased power, workers' doses would tend to increase. In the past several studies were conducted seeking ways to reduce the workers' doses. A study was made on the possibility to introduce a shielding at the top of the reactor core with a hot water layer. Studies have shown that a major limitation for operating a reactor at high power comes from the gamma radiation emitted by the sodium-24. Other elements such as magnesium-27, aluminum-28, Argon-51, contribute considerably to the water activity of the pool. The introduction of a hot water layer on the swimming pool would form a layer of surface, stable and free of radioactive elements with a 1.5m to 2m thickness creates a shielding to radiation from radioactive elements dissolved in water. Optimization studies proved that the installation of the hot layer was not necessary for the regime and the current power reactor operation, because other procedures adopted were more effective. From this decision the Radiological Protection Reactor Team, set up a dose assessment program to ensure them remained in low values based on principles established in national and international standards. The purpose of this paper is to analyze the individual doses of OEI (Occupationally Exposed Individual), which will be checked increasing doses resulting from recent changes in reactor operation regime and suggested viable safety and protection options, in the first instance to

  10. The R1 gene for potato resistance to late blight (Phytophthora infestans) belongs to the leucine zipper/NBS/LRR class of plant resistance genes.

    Science.gov (United States)

    Ballvora, Agim; Ercolano, Maria Raffaella; Weiss, Julia; Meksem, Khalid; Bormann, Christina Angelika; Oberhagemann, Petra; Salamini, Francesco; Gebhardt, Christiane

    2002-05-01

    Late blight caused by the oomycete Phytophthora infestans is the most destructive disease in potato cultivation worldwide. New, more virulent P. infestans strains have evolved which overcome the genetic resistance that has been introgressed by conventional breeding from wild potato species into commercial varieties. R genes (for single-gene resistance) and genes for quantitative resistance to late blight are present in the germplasm of wild and cultivated potato. The molecular basis of single-gene and quantitative resistance to late blight is unknown. We have cloned R1, the first gene for resistance to late blight, by combining positional cloning with a candidate gene approach. The R1 gene is member of a gene family. It encodes a protein of 1293 amino acids with a molecular mass of 149.4 kDa. The R1 gene belongs to the class of plant genes for pathogen resistance that have a leucine zipper motif, a putative nucleotide binding domain and a leucine-rich repeat domain. The most closely related plant resistance gene (36% identity) is the Prf gene for resistance to Pseudomonas syringae of tomato. R1 is located within a hot spot for pathogen resistance on potato chromosome V. In comparison to the susceptibility allele, the resistance allele at the R1 locus represents a large insertion of a functional R gene.

  11. Targeted deletion of the GluR-1 AMPA receptor in mice dissociates general and outcome-specific influences of appetitive rewards on learning.

    Science.gov (United States)

    Johnson, Alexander W; Bannerman, David; Rawlins, Nick; Sprengel, Rolf; Good, Mark A

    2007-12-01

    The authors assessed the hypothesis that deletion of the GluR-1 subtype of the alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptor in mice disrupts the associative activation of a sensory-specific representation of an appetitive reward. In Experiment 1, mice received training on a Pavlovian-instrumental transfer task. In the test stage, conditioned stimulus (CS) presentations enhanced instrumental actions in both groups. However, this effect was specific to the action that shared the same outcome as the CS in wild-type (WT), but not GluR-1-super(-/-), mice. In Experiment 2, the mice were trained on a heterogeneous instrumental chain in which rewards were obtained for emitting 1 response (R1, that was distal to reward delivery), followed by a 2nd response (R2, that was proximal to reward delivery). A change in general motivational state (from hungry to sated) reduced the number of R2 responses in both groups. In contrast, an outcome-specific satiety treatment produced a selective decline in R1 responding only in WT mice. The results support the hypothesis that GluR-1 deletion impairs the associative activation of a representation of the sensory-specific incentive motivational properties of an appetitive reward.

  12. Decreased intracellular [Ca2+] coincides with reduced expression of Dhprα1s, RyR1, and diaphragmatic dysfunction in a rat model of sepsis.

    Science.gov (United States)

    Wang, Meng-Meng; Hao, Li-Ying; Guo, Feng; Zhong, Bin; Zhong, Xiao-Mei; Yuan, Jing; Hao, Yi-Fei; Zhao, Shuang; Sun, Xue-Fei; Lei, Ming; Jiao, Guang-Yu

    2017-12-01

    Sepsis can cause decreased diaphragmatic contractility. Intracellular calcium as a second messenger is central to diaphragmatic contractility. However, changes in intracellular calcium concentration ([Ca 2+ ]) and the distribution and co-localization of relevant calcium channels [dihydropyridine receptors, (DHPRα1s) and ryanodine receptors (RyR1)] remain unclear during sepsis. In this study we investigated the effect of changed intracellular [Ca 2+ ] and expression and distribution of DHPRα1s and RyR1 on diaphragm function during sepsis. We measured diaphragm contractility and isolated diaphragm muscle cells in a rat model of sepsis. The distribution and co-localization of DHPRα1s and RyR1 were determined using immunohistochemistry and immunofluorescence, whereas intracellular [Ca 2+ ] was measured by confocal microscopy and fluorescence spectrophotometry. Septic rat diaphragm contractility, expression of DHPRα1s and RyR1, and intracellular [Ca 2+ ] were significantly decreased in the rat sepsis model compared with controls. Decreased intracellular [Ca 2+ ] coincides with diaphragmatic contractility and decreased expression of DHPRα1s and RyR1 in sepsis. Muscle Nerve 56: 1128-1136, 2017. © 2017 Wiley Periodicals, Inc.

  13. IP3R1 deficiency in the cerebellum/brainstem causes basal ganglia-independent dystonia by triggering tonic Purkinje cell firings in mice

    Directory of Open Access Journals (Sweden)

    Chihiro eHisatsune

    2013-10-01

    Full Text Available The type 1 inositol 1,4,5- trisphosphate receptor (IP3R1 is a Ca2+ channel on the endoplasmic reticulum and is a predominant isoform in the brain among the three types of IP3Rs. Mice lacking IP3R1 show seizure-like behavior; however the cellular and neural circuit mechanism by which IP3R1 deletion causes the abnormal movements is unknown. Here, we found that the conditional knockout mice lacking IP3R1 specifically in the cerebellum and brainstem experience dystonia and show that cerebellar Purkinje cell (PC firing patterns were coupled to specific dystonic movements. Recordings in freely behaving mice revealed epochs of low and high frequency PC complex spikes linked to body extension and rigidity, respectively. Remarkably, dystonic symptoms were independent of the basal ganglia, and could be rescued by inactivation of the cerebellum, inferior olive or in the absence of PCs. These findings implicate IP3R1-dependent PC firing patterns in cerebellum in motor coordination and the expression of dystonia through the olivo-cerebellar pathway.

  14. Range management visual impacts

    Science.gov (United States)

    Bruce R. Brown; David Kissel

    1979-01-01

    Historical overgrazing of western public rangelands has resulted in the passage of the Public Rangeland Improvement Act of 1978. The main purpose of this Act is to improve unsatisfactory range conditions. A contributing factor to unfavorable range conditions is adverse visual impacts. These visual impacts can be identified in three categories of range management: range...

  15. Comparison of two Different Methods for Recording Rotational Motions: a Commercial Eentec R1 versus Array Derived Rotation

    Science.gov (United States)

    Wassermann, J.; Lehndorfer, S.; Igel, H.; Schreiber, U.

    2008-12-01

    The application of rotational motion sensors already proofed to give new ways of measuring seismic wave field properties when comparing the recorded data with seismograms of collocated traditional seismometers. However, the data of these rare test cases were produced either using sophisticated ring laser technology or cumbersome seismic array techniques including some restrictive assumption about the wave field. In addition, all applications presented so far were performed in the far field of the seismic source. In this paper we want to test the performance of one of the first medium priced, commercial rotational motions sensor (Eentec R1) by comparing its output with the aforementioned array derived rotational motions. The data sets for testing consist of seismic array and rotational motion measurements which were recorded 1) during a demolition blast of a 50 m high building in the city of Munich (Germany) and 2) during frequent volcanic explosions at the Mt. Yasur volcano (Vanuatu) as well as some simple laboratory experiments. At least in case of Mt. Yasur the measurement site was within the near field of the seismic source. As a first step in the analysis chain, we simply compare the various outputs. As next step, we classify the performance of the two methods for recording rotational motions by comparing derived wave field properties with the result of more classical seismic array analysis. The results of this experiments demonstrate, that when using array technique for estimating rotational motions much effort in site selection, array design and a priori knowledge of subsurface conditions is needed. It becomes also evident that the performance of an array and its estimated quantities depends strongly on the number of deployed seismic stations. Given the uncertainties in both the array- derived measurements and the rotation sensor transfer function, which in the latter case are apparent when taking into account effects of translational motions on the

  16. Activation of the umami taste receptor (T1R1/T1R3) initiates the peristaltic reflex and pellet propulsion in the distal colon

    Science.gov (United States)

    Kendig, Derek M.; Hurst, Norman R.; Bradley, Zachary L.; Mahavadi, Sunila; Kuemmerle, John F.; Lyall, Vijay; DeSimone, John; Murthy, Karnam S.

    2014-01-01

    Intraluminal nutrients in the gut affect the peristaltic reflex, although the mechanism is not well defined. Recent evidence supports the presence of taste receptors and their signaling components in enteroendocrine cells, although their function is unclear. This study aimed to determine if nutrients modify colonic motility through activation of taste receptors. Colonic sections were immunostained for the umami taste receptor T1R1/T1R3, which mediates the response to umami ligands, such as monosodium glutamate (MSG), in taste cells. Ascending contraction, descending relaxation, and calcitonin gene-related peptide release were measured in three-chamber flat-sheet preparations of rat colon in response to MSG alone or with inosine 5′-monophosphate (IMP). Velocity of artificial fecal pellet propulsion was measured by video recording in guinea pig distal colon. T1R1/T1R3 receptors were present in enteroendocrine cells of colonic sections from human, rat, mouse, and guinea pig. MSG initiated ascending contraction and descending relaxation components of the peristaltic reflex and calcitonin gene-related peptide release in flat-sheet preparations. IMP augmented the MSG-induced effects, suggesting activation of T1R1/T1R3 receptors. In T1R1−/− mice, mucosal stroking, but not MSG, elicited a peristaltic reflex. Intraluminal perfusion of MSG enhanced the velocity of artificial fecal pellet propulsion, which was also augmented by IMP. Propulsion was also increased by l-cysteine, but not l-tryptophan, supporting a role of T1R1/T1R3 receptors. We conclude that T1R1/T1R3 activation by luminal MSG or l-cysteine elicits a peristaltic reflex and CGRP release and increases the velocity of pellet propulsion in distal colon. This mechanism may explain how nutrients regulate colonic propulsion. PMID:25324508

  17. Lack of any prognostic relationship between adiponectin receptor (Adipo R1/R2) expression for early/advanced stage gastric cancer.

    Science.gov (United States)

    Ayyildiz, Talat; Dolar, Enver; Ugras, Nesrin; Dizdar, Oguzhan Sitki; Adim, Saduman Balaban; Yerci, Omer

    2014-01-01

    Adiponectin (ApN) is a complement C1q-related protein, mainly secreted from adipose tissue, that signals through ApN receptor 1 (Adipo-R1) and ApN receptor 2 (Adipo-R2). Low serum ApN concentrations are associated with obesity-related malignancies. However, there are very few studies on any prognostic role of ApN receptors in gastric cancer. The aim of this study is to investigate the relationship between AdipoR1/R2 expression and early/advanced stage gastric cancer in terms of clinicopathologic characteristics and survival. Eighteen patients with early and 39 with advanced stage gastric cancer who underwent surgical gastric resection were included in this study. Adipo-R1 expression was low in 2 of the 18 patients with early stage gastric cancer (11.1%), while 4 had low Adipo-R2 expression (22.2%). In those with advanced stage gastric cancer, 7 of 39 had low Adipo-R1 expression (17.9%) and 16 had low Adipo-R2 expression (41%). Adipo-R2 expression was significantly higher (p=0.011) in moderately differentiated tumors when compared to well-differentiated tumors. While there was nearly a statistically significant relationship between TNM stage (T, tumor size; N, regional lymph node; M, whether distant metastases exist) and Adipo-R2 expression (p=0.054), there was no relationship between Adipo-R1/-R2 expression with tumor stage and survival. Adipo-R1/-R2 expression has no prognostic significance of in early/advanced stage gastric cancer.

  18. Distinct roles for miR-1 and miR-133a in the proliferation and differentiation of rhabdomyosarcoma cells.

    Science.gov (United States)

    Rao, Prakash K; Missiaglia, Edoardo; Shields, Lauren; Hyde, Greg; Yuan, Bingbing; Shepherd, Christopher J; Shipley, Janet; Lodish, Harvey F

    2010-09-01

    Rhabdomyosarcoma is the most common soft tissue sarcoma in the pediatric population. As this tumor has an undifferentiated myogenic phenotype, agents that promote differentiation hold particular promise as part of a novel therapeutic approach to combat this type of cancer. In this report, we focus on the contribution of two microRNAs (miRNAs) in rhabdomyosarcomas. Levels of miR-1 and miR-133a are drastically reduced in representative cell lines from each major rhabdomyosarcoma subtype (embryonal and alveolar). Introduction of miR-1 and miR-133a into an embryonal rhabdomyosarcoma-derived cell line is cytostatic, thereby suggesting a tumor suppressor-like role for these myogenic miRNAs. Transcriptional profiling of cells after miR-1 and miR-133a expression reveals that miR-1 (but not miR-133a) exerts a strong promyogenic influence on these poorly differentiated tumor cells. We identify mRNAs that are down-regulated by these miRNAs and propose roles for miR-1 and miR-133a in repressing isoforms of genes that are normally not expressed in muscle. Finally, we show that mRNA targets of miR-1 and miR-133a are up-regulated in rhabdomyosarcomas, suggesting a causative role for these miRNAs in the development of rhabdomyosarcomas. More important, these results point to the promise of enhancing rhabdomyosarcoma therapy using miRNAs as agents that mediate cytostasis and promote muscle differentiation.

  19. Univalent binding of the Cry1Ab toxin of Bacillus thuringiensis to a conserved structural motif in the cadherin receptor BT-R1.

    Science.gov (United States)

    Griko, Natalya B; Rose-Young, Laura; Zhang, Xuebin; Carpenter, Lindy; Candas, Mehmet; Ibrahim, Mohamed A; Junker, Matthew; Bulla, Lee A

    2007-09-04

    The Cry1Ab toxin produced by Bacillus thuringiensis (Bt) exerts insecticidal action upon binding to BT-R1, a cadherin receptor localized in the midgut epithelium of the tobacco hornworm Manduca sexta [Dorsch, J. A., Candas, M., Griko, N. B., Maaty, W. S., Midboe, E. G., Vadlamudi, R. K., and Bulla, L. A., Jr. (2002) Cry1A toxins of Bacillus thuringiensis bind specifically to a region adjacent to the membrane-proximal extracellular domain of BT-R1 in Manduca sexta: involvement of a cadherin in the entomopathogenicity of Bacillus thuringiensis, Insect Biochem. Mol. Biol. 32, 1025-1036]. BT-R1 represents a family of invertebrate cadherins whose ectodomains (ECs) are composed of multiple cadherin repeats (EC1 through EC12). In the present work, we determined the Cry1Ab toxin binding site in BT-R1 in the context of cadherin structural determinants. Our studies revealed a conserved structural motif for toxin binding that includes two distinct regions within the N- and C-termini of EC12. These regions are characterized by unique sequence signatures that mark the toxin-binding function in BT-R1 as well as in homologous lepidopteran cadherins. Structure modeling of EC12 discloses the conserved motif as a single broad interface that holds the N- and C-termini in close proximity. Binding of toxin to BT-R1, which is univalent, and the subsequent downstream molecular events responsible for cell death depend on the conserved motif in EC12.

  20. [The use of the R1-fish cell culture for detection of toxicity of waste water according to the German Waste Water Act

    Science.gov (United States)

    Ahne, W.; Halder, M.

    1990-01-01

    A fibroblastic cell line (R1) established in 1981 from the liver tissue of rainbow trout (Oncorhynchus mykiss) has been used for cytotoxicity testing of 301 waste water samples. The results obtained were compared with the results of the fish test performed parallely according to the German Waste Water Act. 54% of the samples proved to be neither fish toxic nor cytotoxic, 22% were fish and cytotoxic, 5% only fish toxic and 19% only cytotoxic. The results show that the R1-cell culture is useful to determine cytotoxicity of aquatic pollutants.

  1. Angiotensin II Reduces Cardiac AdipoR1 Expression through AT1 Receptor/ROS/ERK1/2/c-Myc Pathway

    Science.gov (United States)

    Lei, Hong; Wang, Cheng; Wu, Li-Peng; Wang, Jin-Yu; Fu, Feng-Ying; Zhu, Wei-Guo; Wu, Li-Ling

    2013-01-01

    Adiponectin, an abundant adipose tissue-derived protein, exerts protective effect against cardiovascular disease. Adiponectin receptors (AdipoR1 and AdipoR2) mediate the beneficial effects of adiponectin on the cardiovascular system. However, the alteration of AdipoRs in cardiac remodeling is not fully elucidated. Here, we investigated the effect of angiotensin II (AngII) on cardiac AdipoRs expression and explored the possible molecular mechanism. AngII infusion into rats induced cardiac hypertrophy, reduced AdipoR1 but not AdipoR2 expression, and attenuated the phosphorylations of adenosine monophosphate-activated protein kinase and acetyl coenzyme A carboxylase, and those effects were all reversed by losartan, an AngII type 1 (AT1) receptor blocker. AngII reduced expression of AdipoR1 mRNA and protein in cultured neonatal rat cardiomyocytes, which was abolished by losartan, but not by PD123319, an AT2 receptor antagonist. The antioxidants including reactive oxygen species (ROS) scavenger NAC, NADPH oxidase inhibitor apocynin, Nox2 inhibitor peptide gp91 ds-tat, and mitochondrial electron transport chain complex I inhibitor rotenone attenuated AngII-induced production of ROS and phosphorylation of extracellular signal-regulated kinase (ERK) 1/2. AngII-reduced AdipoR1 expression was reversed by pretreatment with NAC, apocynin, gp91 ds-tat, rotenone, and an ERK1/2 inhibitor PD98059. Chromatin immunoprecipitation assay demonstrated that AngII provoked the recruitment of c-Myc onto the promoter region of AdipoR1, which was attenuated by PD98059. Moreover, AngII-induced DNA binding activity of c-Myc was inhibited by losartan, NAC, apocynin, gp91 ds-tat, rotenone, and PD98059. c-Myc small interfering RNA abolished the inhibitory effect of AngII on AdipoR1 expression. Our results suggest that AngII inhibits cardiac AdipoR1 expression in vivo and in vitro and AT1 receptor/ROS/ERK1/2/c-Myc pathway is required for the downregulation of AdipoR1 induced by AngII. PMID

  2. Angiotensin II reduces cardiac AdipoR1 expression through AT1 receptor/ROS/ERK1/2/c-Myc pathway.

    Directory of Open Access Journals (Sweden)

    Li Li

    Full Text Available Adiponectin, an abundant adipose tissue-derived protein, exerts protective effect against cardiovascular disease. Adiponectin receptors (AdipoR1 and AdipoR2 mediate the beneficial effects of adiponectin on the cardiovascular system. However, the alteration of AdipoRs in cardiac remodeling is not fully elucidated. Here, we investigated the effect of angiotensin II (AngII on cardiac AdipoRs expression and explored the possible molecular mechanism. AngII infusion into rats induced cardiac hypertrophy, reduced AdipoR1 but not AdipoR2 expression, and attenuated the phosphorylations of adenosine monophosphate-activated protein kinase and acetyl coenzyme A carboxylase, and those effects were all reversed by losartan, an AngII type 1 (AT1 receptor blocker. AngII reduced expression of AdipoR1 mRNA and protein in cultured neonatal rat cardiomyocytes, which was abolished by losartan, but not by PD123319, an AT2 receptor antagonist. The antioxidants including reactive oxygen species (ROS scavenger NAC, NADPH oxidase inhibitor apocynin, Nox2 inhibitor peptide gp91 ds-tat, and mitochondrial electron transport chain complex I inhibitor rotenone attenuated AngII-induced production of ROS and phosphorylation of extracellular signal-regulated kinase (ERK 1/2. AngII-reduced AdipoR1 expression was reversed by pretreatment with NAC, apocynin, gp91 ds-tat, rotenone, and an ERK1/2 inhibitor PD98059. Chromatin immunoprecipitation assay demonstrated that AngII provoked the recruitment of c-Myc onto the promoter region of AdipoR1, which was attenuated by PD98059. Moreover, AngII-induced DNA binding activity of c-Myc was inhibited by losartan, NAC, apocynin, gp91 ds-tat, rotenone, and PD98059. c-Myc small interfering RNA abolished the inhibitory effect of AngII on AdipoR1 expression. Our results suggest that AngII inhibits cardiac AdipoR1 expression in vivo and in vitro and AT1 receptor/ROS/ERK1/2/c-Myc pathway is required for the downregulation of AdipoR1 induced by AngII.

  3. The pro-resolving lipid mediator maresin 1 (MaR1 attenuates inflammatory signaling pathways in vascular smooth muscle and endothelial cells.

    Directory of Open Access Journals (Sweden)

    Anuran Chatterjee

    Full Text Available Inflammation and its resolution are central to vascular injury and repair. Maresins comprise a new family of bioactive lipid mediators synthesized from docosahexaenoic acid, an ω-3 polyunsaturated fatty acid. They have been found to exert anti-inflammatory and pro-resolving responses in macrophages, neutrophils and bronchial epithelial cells and impart beneficial actions in murine models of peritonitis and colitis. We investigated the impact of maresin-1 (MaR1 on tumor necrosis factor alpha (TNF-α induced inflammatory responses in human vascular endothelial (EC and smooth muscle cells (VSMC.Primary cultures of human saphenous vein EC and VSMC were employed. We tested the naturally occurring MaR1 as modulator of TNF-α effects, with examination of monocyte adhesion, oxidant stress, and intracellular inflammatory signaling pathways.MaR1 attenuated TNF-α induced monocyte adhesion and reactive oxygen species (ROS generation in both EC and VSMC, associated with down-regulated expression (cell surface of the adhesion molecule E-selectin (in EC and NADPH-oxidases (NOX4, NOX1, NOX2. MaR1 attenuated TNF-α induced release of pro-inflammatory mediators by EC and VSMC. MaR1 caused an attenuation of TNF-α induced NF-κB activation in both cell types associated with inhibition of I-κ Kinase (IKK phosphorylation, IκB-α degradation and nuclear translocation of the NF- κB p65 subunit. MaR1 also caused a time-dependent increase in intracellular cyclic AMP (cAMP in both naive and TNF-α stimulated VSMC and EC.MaR1 has broad anti-inflammatory actions on EC and VSMC, which may be partly mediated through up-regulation of cAMP and down-regulation of the transcription factor NF-κB. The results suggest that the pro-resolving lipid mediator MaR1 exerts homeostatic actions on vascular cells that counteract pro-inflammatory signals. These findings may have direct relevance for acute and chronic states of vascular inflammation.

  4. Sensing of amino acids by the gut-expressed taste receptor T1R1-T1R3 stimulates CCK secretion

    OpenAIRE

    Daly, Kristian; Al-Rammahi, Miran; Moran, Andrew; Marcello, Marco; Ninomiya, Yuzo; Shirazi-Beechey, Soraya P.

    2012-01-01

    CCK is secreted by endocrine cells of the proximal intestine in response to dietary components, including amino acids. CCK plays a variety of roles in digestive processes, including inhibition of food intake, consistent with a role in satiety. In the lingual epithelium, the sensing of a broad spectrum of l-amino acids is accomplished by the heteromeric amino acid (umami) taste receptor (T1R1-T1R3). T1R1 and T1R3 subunits are also expressed in the intestine. A defining characteristic of umami ...

  5. Vehicle Based Laser Range Finding in Crops

    OpenAIRE

    Hans-Juergen Horn; Rolf Adamek; Detlef Ehlert

    2009-01-01

    Laser rangefinders and laser scanners are widely used for industrial purposes and for remote sensing. In agriculture information about crop parameters like volume, height, and density can support the optimisation of production processes. In scientific papers the measurement of these parameters by low cost laser rangefinders with one echo has been presented for short ranges. Because the cross section area of the beam increases with the measuring range, it can be expected that laser rangefinder...

  6. Application of the Akinfiev-Diamond equation of state to neutral hydroxides of metalloids (B(OH)3, Si(OH)4, As(OH)3) at infinite dilution in water over a wide range of the state parameters, including steam conditions

    Science.gov (United States)

    Akinfiev, Nikolay N.; Plyasunov, Andrey V.

    2014-02-01

    The Akinfiev and Diamond (2003) equation of state (EoS) for aqueous nonelectrolytes was employed to describe hydroxides of metalloids (B(OH)3, Si(OH)4, As(OH)3) over a wide temperature and pressure ranges, including steam conditions. The EoS is based on the accurate knowledge of solvent (H2O) properties and requires only three empirical parameters to be fitted to experimental data, and these are independent of temperature and pressure. For nonvolatile components thermodynamic properties of species in the ideal gas state were evaluated using quantum chemical computations. The proposed approach has been tested to predict the whole set of thermodynamic properties of solutes (the chemical potential, entropy, molar volume, and molar heat capacity) over a wide range of temperatures (273-1200 K) and pressures (0.1-1000 MPa), including the near-critical region and both low and high density regions of the solvent. Thus it can be used for modeling various geochemical processes over a whole range of solvent densities, including processes in boiling fluids and a vapor phase as well. solubility data in a low density aqueous fluid (ρ1∗ 1 mol kg-1) where polymerization effects may take place (Newton and Manning, 2003); the rest of data, containing the majority of quartz solubility points at 293-1273 K, 0.1-1000 MPa. Only the 3rd part of experimental quartz solubility data has been used in the fitting procedure. Thermodynamic properties of Si(OH)4 in the ideal gas state were recently determined by the analysis of the relevant experimental data in Plyasunov (2011b). The temperature dependence of heat capacity of the molecule was adopted from comprehensive study of Rutz and Bockhorn (2005)where DFT calculations at different levels of theory including CBS-QBS and G3MP2 methods, as well as corrections for hindered rotations and scaling for vibration frequencies were employed. The adopted Cpo (T = 300-1500 K) values for gaseous Si(OH)4 were approximated by a function and used in the

  7. Minnesota Pheasant Range

    Data.gov (United States)

    Minnesota Department of Natural Resources — This dataset delineates the spatial range of wild pheasant populations in Minnesota as of 2002 by dividing the MN state boundary into 2 units: pheasant range and...

  8. Substring Range Reporting

    DEFF Research Database (Denmark)

    Bille, Philip; Gørtz, Inge Li

    2014-01-01

    We revisit various string indexing problems with range reporting features, namely, position-restricted substring searching, indexing substrings with gaps, and indexing substrings with intervals. We obtain the following main results. We give efficient reductions for each of the above problems...... to a new problem, which we call substring range reporting. Hence, we unify the previous work by showing that we may restrict our attention to a single problem rather than studying each of the above problems individually. We show how to solve substring range reporting with optimal query time and little...... for substring range reporting generalize to substring range counting and substring range emptiness variants. We also obtain non-trivial time-space trade-offs for these problems. Our bounds for substring range reporting are based on a novel combination of suffix trees and range reporting data structures...

  9. International Conference on Harmonisation; guidance on S2(R1) Genotoxicity Testing and Data Interpretation for Pharmaceuticals intended for Human Use; availability. Notice.

    Science.gov (United States)

    2012-06-07

    The Food and Drug Administration (FDA) is announcing the availability of a guidance entitled ``S2(R1) Genotoxicity Testing and Data Interpretation for Pharmaceuticals Intended for Human Use'' (ICH S2(R1)). This guidance was prepared under the auspices of the International Conference on Harmonisation of Technical Requirements for Registration of Pharmaceuticals for Human Use (ICH). The ICH S2(R1) combines and replaces two ICH guidances, "S2A Specific Aspects for Regulatory Genotoxicity Tests for Pharmaceuticals'' and "S2B Genotoxicity: A Standard Battery for Genotoxicity Testing of Pharmaceuticals.'' ICH S2(R1) provides guidance to drug sponsors on which tests should be performed to assess potential genotoxicity of pharmaceuticals. It also provides guidance on testing conditions, data interpretation, and followup strategies if a positive response is seen in in vitro assays. This guidance is intended to provide drug sponsors with recommendations to ensure that drugs are appropriately tested for potential to cause genetic damage and to ensure efficient development of new drugs.

  10. Translational control and differential RNA decay are key elements regulating postsegregational expression of the killer protein encoded by the parB locus of plasmid R1

    DEFF Research Database (Denmark)

    Gerdes, K; Helin, K; Christensen, O W

    1988-01-01

    The parB locus of plasmid R1, which mediates plasmid stability via postsegregational killing of plasmid-free cells, encodes two genes, hok and sok. The hok gene product is a potent cell-killing protein. The hok gene is regulated at the translational level by the sok gene-encoded repressor, a small...

  11. Triazole GHS-R1a antagonists JMV4208 and JMV3002 attenuate food intake, body weight, and adipose tissue mass in mice

    Czech Academy of Sciences Publication Activity Database

    Holubová, Martina; Nagelová, Veronika; Lacinová, Z.; Haluzík, M.; Sýkora, D.; Moulin, A.; Blayo, A. L.; Fehrentz, J. A.; Martinez, J.; Stofková, A.; Jurčovičová, J.; Železná, Blanka; Maletínská, Lenka

    2014-01-01

    Roč. 393, 1/2 (2014), s. 120-128 ISSN 0303-7207 Institutional support: RVO:61388963 Keywords : GHS-R1a antagonists * diet-induced obesity * food intake * JMV4208 * JMV3002 * male C57BL/6 mice Subject RIV: CE - Biochemistry Impact factor: 4.405, year: 2014

  12. Role of tyrosine 131 in the active site of paAzoR1, an azoreductase with specificity for the inflammatory bowel disease prodrug balsalazide

    OpenAIRE

    Wang, Chan-Ju; Laurieri, Nicola; Abuhammad, Areej; Lowe, Edward; Westwood, Isaac; Ryan, Ali; Sim, Edith

    2009-01-01

    Tyr131 plays an important role in determining the substrate specificity and thermal stability of azoreductase 1 from P. aeruginosa (pAzoR1). The structure shows that the substrate methyl red binds deeper in the active site of the mutant, which is reflected in the change in enzymic properties.

  13. Identification and characterization of PhbF: A DNA binding protein with regulatory role in the PHB metabolism of Herbaspirillum seropedicae SmR1

    Directory of Open Access Journals (Sweden)

    Pedrosa Fabio O

    2011-10-01

    Full Text Available Abstract Background Herbaspirillum seropedicae SmR1 is a nitrogen fixing endophyte associated with important agricultural crops. It produces polyhydroxybutyrate (PHB which is stored intracellularly as granules. However, PHB metabolism and regulatory control is not yet well studied in this organism. Results In this work we describe the characterization of the PhbF protein from H. seropedicae SmR1 which was purified and characterized after expression in E. coli. The purified PhbF protein was able to bind to eleven putative promoters of genes involved in PHB metabolism in H. seropedicae SmR1. In silico analyses indicated a probable DNA-binding sequence which was shown to be protected in DNA footprinting assays using purified PhbF. Analyses using lacZ fusions showed that PhbF can act as a repressor protein controlling the expression of PHB metabolism-related genes. Conclusions Our results indicate that H. seropedicae SmR1 PhbF regulates expression of phb-related genes by acting as a transcriptional repressor. The knowledge of the PHB metabolism of this plant-associated bacterium may contribute to the understanding of the plant-colonizing process and the organism's resistance and survival in planta.

  14. Sec-containing TrxR1 is essential for self-sufficiency of cells by control of glucose-derived H2O2.

    Science.gov (United States)

    Peng, X; Mandal, P K; Kaminskyy, V O; Lindqvist, A; Conrad, M; Arnér, E S J

    2014-05-22

    It is commonly recognized that diabetic complications involve increased oxidative stress directly triggered by hyperglycemia. The most important cellular protective systems against such oxidative stress have yet remained unclear. Here we show that the selenoprotein thioredoxin reductase 1 (TrxR1), encoded by the Txnrd1 gene, is an essential enzyme for such protection. Individually grown Txnrd1 knockout (Txnrd1(-/-)) mouse embryonic fibroblasts (MEFs) underwent massive cell death directly linked to glucose-induced H2O2 production. This death and excessive H2O2 levels could be reverted by reconstituted expression of selenocysteine (Sec)-containing TrxR1, but not by expression of Sec-devoid variants of the enzyme. Our results show that Sec-containing TrxR1 is absolutely required for self-sufficient growth of MEFs under high-glucose conditions, owing to an essential importance of this enzyme for elimination of glucose-derived H2O2. To our knowledge, this is the first time a strict Sec-dependent function of TrxR1 has been identified as being essential for mammalian cells.

  15. Synthesis, in vitro and in vivo evaluation of [11C]MMTP: a potential PET ligand for mGluR1 receptors

    DEFF Research Database (Denmark)

    Prabhakaran, Jaya; Majo, Vattoly J; Milak, Matthew S

    2010-01-01

    selectively labeled mGluR1 receptors in slide-mounted sections of postmortem human brain containing cerebellum, hippocampus, prefrontal cortex and striatum as demonstrated by in vitro autoradiography using phosphor-imaging. PET studies in anesthetized baboon show that [(11)C]1 penetrates the BBB...

  16. Variations in IL-1R1 Gene Influence Risk for Hepatitis B Virus Infection of Children in a Han Chinese population

    Directory of Open Access Journals (Sweden)

    Jie Fan

    2017-02-01

    Conclusion: Our study confirmed that genetic variant in IL-1R1(rs3917267 has significant association with HBV infection and HBV breakthrough infection in children, which provides new clues for the study of pathogenesis of chronic HBV infection in children.

  17. The architecture of the BubR1 tetratricopeptide tandem repeat defines a protein motif underlying mitotic checkpoint-kinetochore communication.

    Science.gov (United States)

    Bolanos-Garcia, Victor M; Nilsson, Jakob; Blundell, Tom L

    2012-01-01

    The accurate and timely transmission of the genetic material to progeny during successive rounds of cell division is sine qua non for the maintenance of genome stability. Eukaryotic cells have evolved a surveillance mechanism, the mitotic spindle assembly checkpoint (SAC), to prevent premature advance to anaphase before every chromosome is properly attached to microtubules of the mitotic spindle. The architecture of the KNL1-BubR1 complex reveals important features of the molecular recognition between SAC components and the kinetochore. The interaction is important for a functional SAC as substitution of BubR1 residues engaged in KNL1 binding impaired the SAC and BubR1 recruitment into checkpoint complexes in stable cell lines. Here we discuss the implications of the disorder-to-order transition of KNL1 upon BubR1 binding for SAC signaling and propose a mechanistic model of how BUBs binding may affect the recognition of KNL1 by its other interacting partners.

  18. Cross-Correlated Relaxation of Dipolar Coupling and Chemical-Shift Anisotropy in Magic-Angle Spinning R1ρ NMR Measurements: Application to Protein Backbone Dynamics Measurements

    Science.gov (United States)

    Kurauskas, Vilius; Weber, Emmanuelle; Hessel, Audrey; Ayala, Isabel; Marion, Dominique; Schanda, Paul

    2016-01-01

    Transverse relaxation rate measurements in MAS solid-state NMR provide information about molecular motions occurring on nanoseconds-to-milliseconds (ns-ms) time scales. The measurement of heteronuclear (13C, 15N) relaxation rate constants in the presence of a spin-lock radio-frequency field (R1ρ relaxation) provides access to such motions, and an increasing number of studies involving R1ρ relaxation in proteins has been reported. However, two factors that influence the observed relaxation rate constants have so far been neglected, namely (i) the role of CSA/dipolar cross-correlated relaxation (CCR), and (ii) the impact of fast proton spin flips (i.e. proton spin diffusion and relaxation). We show that CSA/D CCR in R1ρ experiments is measurable, and that this cross-correlated relaxation rate constant depends on ns-ms motions, and can thus itself provide insight into dynamics. We find that proton spin-diffusion attenuates this cross-correlated relaxation, due to its decoupling effect on the doublet components. For measurements of dynamics, the use of R1ρ rate constants has practical advantages over the use of CCR rates, and the present manuscript reveals factors that have so far been disregarded and which are important for accurate measurements and interpretation. PMID:27500976

  19. IgE FcɛR1β polymorphism and risk of developing chronic spontaneous urticaria: A study in an ethnic Kashmiri population.

    Science.gov (United States)

    Rasool, R; Shera, I A; Nissar, S; Yousuf, Q; Shah, Z A

    2015-01-01

    The pathogenesis of chronic spontaneous urticaria involves interplay between the genetic and environmental factors, most of which is still poorly understood. It is well-recognized that 30-40% of chronic spontaneous urticaria is autoimmune in nature. Chronic autoimmune urticaria is caused by anti-FcɛR1β and less frequently, by anti-IgE auto antibodies that lead to mast cell and basophil activation, thereby giving rise to the release of histamine and other proinflammatory mediators. We investigated the association between SNP loci in FcɛR1β and chronic spontaneous urticaria and to see its relation with serum IgE levels in Kashmiri population. The autologous serum skin test was used as a screening test for chronic autoimmune urticaria. PCR-RFLP was used to detect the genotype of the SNP loci. Serum IgE levels were assessed by ELISA kit. No significant difference was found between the study population and control group in genotype distribution (wild and variant) among FcɛR1β loci (P value=0.06, odds ratio=0.29). The frequency of FcɛR1β (C109T) in autologous serum skin test positive chronic autoimmune urticaria patients with the CT genotype was found to be statistically non-significant when compared with the wild genotype (P=0.35). Carriers of FcɛR1β (T allele) had a more significant risk of developing CAU than those with C allele (P=0.01). In our population serum total IgE levels did not find any statistical significance with regard to ASST positive & ASST negative patients (P=0.26). There is statistically no significant association between FcɛR1β gene polymorphism and CSU in Kashmiri population; however, there is a probability of developing CSU in patients carrying FcɛR1β T allele. Furthermore, serum total IgE levels had no significant association with the development of CAU. Copyright © 2013 SEICAP. Published by Elsevier Espana. All rights reserved.

  20. Prevention of alcohol-heightened aggression by CRF-R1 antagonists in mice: critical role for DRN-PFC serotonin pathway.

    Science.gov (United States)

    Quadros, Isabel M; Hwa, Lara S; Shimamoto, Akiko; Carlson, Julia; DeBold, Joseph F; Miczek, Klaus A

    2014-11-01

    Alcohol can escalate aggressive behavior in a significant subgroup of rodents, humans, and nonhuman primates. The present study investigated whether blockade of corticotropin-releasing factor receptor type 1 (CRF-R1) could prevent the emergence of alcohol-heightened aggression in mice. The serotonin (5-HT) pathway from the dorsal raphe nucleus (DRN) to the medial prefrontal cortex (mPFC) by CRF-R1 was investigated as a possible target for the prevention of alcohol-heightened aggressive behavior. Male CFW mice that reliably exhibited aggressive behaviors after consuming 1 g/kg of alcohol received systemic or intra-DRN administration of CRF-R1 antagonists, CP-154,526 or MTIP, before a confrontation with a male conspecific. Blockade of DRN CRF-R1 receptors with both antagonists significantly reduced only alcohol-heightened aggression, whereas systemic administration reduced both alcohol-heightened and species-typical aggression. Next, a 5-HT1A agonist, 8-OH-DPAT, was coadministered with CP-154,526 into the DRN to temporarily disrupt 5-HT activity. This manipulation abolished the antiaggressive effects of intra-DRN CP-154,526. In the mPFC, in vivo microdialysis revealed that extracellular 5-HT levels were increased in mice that consumed alcohol and were then injected with CP-154,526, both systemically or intra-DRN. Neither alcohol nor CP-154,526 alone affected 5-HT release in the mPFC. The present results suggest the DRN as a critical site for CRF-R1 to modulate alcohol-heightened aggression via action on the serotonergic DRN-PFC pathway.

  1. Distinct regulation of metabotropic glutamate receptor (mGluR1 alpha) in the developing limbic system following multiple early-life seizures.

    Science.gov (United States)

    Avallone, Jennifer; Gashi, Eleonora; Magrys, Bonaventure; Friedman, Linda K

    2006-11-01

    The effects of repeated neonatal seizures on metabotropic glutamate receptors (mGluRs) during critical periods of brain development are unknown. Therefore, we characterized the expression of Group I (mGluR1 and mGluR5) and Group II (mGluR2/3) metabotropic glutamate receptor proteins in the developing limbic system in response to a varied neonatal seizure history. Status epilepticus was induced with kainic acid (KA) either once (1x KA) on postnatal (P) day (P13), twice (2x KA) on P6 and P9 or P13, or three times (3x KA) on P6, P9, and P13. In control hippocampus, mGluR1alpha protein expression differed at all stages of development examined, whereas mGluR2/3 and mGluR5 protein expression patterns were mature by P15. After KA-induced status epilepticus, there was a significant elevation in mGluR1alpha protein expression within a select group of inhibitory interneurons of the CA1 stratum oriens-alveus that was enhanced with increasing number of neonatal seizures. mGluR2/3 and mGluR5 subtypes were unchanged. Increases were also observed within neurons of the amygdala and piriform cortex. Selective increases of mGluR1alpha subtypes within limbic structures may contribute to the resistance and tolerance of the immature hippocampus from damage. This may occur by excessive stimulation of excitatory synapses to collectively enhance the inhibitory drive of the immature brain by increasing GABA release. Data suggest that the mGluR1alpha subtype plays an important role in regulating hippocampal network activity after early-life seizures.

  2. TRAIL-R1 is a negative regulator of pro-inflammatory responses and modulates long-term sequelae resulting from Chlamydia trachomatis infections in humans.

    Directory of Open Access Journals (Sweden)

    Mufadhal Al-Kuhlani

    Full Text Available The immune system eliminates Chlamydia trachomatis infection through inflammation. However, uncontrolled inflammation can enhance pathology. In mice, TNF-related apoptosis-inducing ligand receptor (TRAIL-R, known for its effects on apoptosis, also regulates inflammation. In humans, the four homologues of TRAIL-R had never been investigated for effects on inflammation. Here, we examined whether TRAIL-R regulates inflammation during chlamydial infection. We examined TRAIL-R1 single nucleotide polymorphisms (SNPs in an Ecuadorian cohort with and without C. trachomatis infections. There was a highly significant association for the TRAIL+626 homozygous mutant GG for infection vs no infection in this population. To confirm the results observed in the human population, primary lung fibroblasts and bone marrow-derived macrophages (BMDMs were isolated from wildtype (WT and TRAIL-R-deficient mice, and TRAIL-R1 levels in human cervical epithelial cells were depleted by RNA interference. Infection of BMDMs and primary lung fibroblasts with C. trachomatis strain L2, or the murine pathogen C. muridarum, led to higher levels of MIP2 mRNA expression or IL-1β secretion from TRAIL-R-deficient cells than WT cells. Similarly, depletion of TRAIL-R1 expression in human epithelial cells resulted in a higher level of IL-8 mRNA expression and protein secretion during C. trachomatis infection. We conclude that human TRAIL-R1 SNPs and murine TRAIL-R modulate the innate immune response against chlamydial infection. This is the first evidence that human TRAIL-R1 is a negative regulator of inflammation and plays a role in modulating Chlamydia pathogenesis.

  3. Ab initio R1 mechanism of photostimulated oxygen isotope exchange reaction on a defect TiO{sub 2} surface: The case of terminal oxygen atom exchange

    Energy Technology Data Exchange (ETDEWEB)

    Kevorkyants, Ruslan, E-mail: ruslan.kevorkyants@gmail.com; Sboev, Mikhail N.; Chizhov, Yuri V.

    2017-05-01

    Highlights: • DFT R1 mechanism of photostimulated oxygen isotope exchange between {sup 16}O{sup 18}O and terminal oxygen atom of a defect surface of nanocrystalline TiO{sub 2} is proposed. • The mechanism involves four adsorption intermediates and five transition states. • Activation energy of the reaction is 0.24 eV. • G-tensors of O{sub 3}{sup −} intermediates match EPR data on O{sub 2} adsorbed on UV-irradiated TiO{sub 2} surface. - Abstract: Based on density functional theory we propose R1 mechanism of photostimulated oxygen isotope exchange (POIEx) reaction between {sup 16}O{sup 18}O and terminal oxygen atom of a defect TiO{sub 2} surface, which is modeled by amorphous Ti{sub 8}O{sub 16} nanocluster in excited S{sup 1} electronic state. The proposed mechanism involves four adsorption intermediates and five transition states. The computed activation energy of the POIEx equals 0.24 eV. The computed g-tensors of the predicted ozonide O{sub 3}{sup −} chemisorption species match well EPR data on O{sub 2} adsorption on UV-irradiated nanocrystalline TiO{sub 2}. This match serves a mean of justification of the proposed R1 mechanism of the POIEx reaction. In addition, it is found that the proposed R1 POIEx reaction’s mechanism differs from R1 mechanism of thermo-assisted OIEx reaction on a surface of supported vanadium oxide catalyst VO{sub x}/TiO{sub 2} reported earlier.

  4. Characterization of a human breast cancer cell line, MCF-7/RU58R-1, resistant to the pure antiestrogen RU 58,668.

    Science.gov (United States)

    Fog, C K; Christensen, I J; Lykkesfeldt, A E

    2005-05-01

    Breast cancer is the most common cancer disease in women in the western world. Tamoxifen has been the standard first line endocrine therapy for patients with estrogen receptor (ER) positive tumors. Unfortunately, almost all patients with advanced disease develop tamoxifen resistance. This has lead to a search for new potent antiestrogens. One of the new compounds under development is the pure antiestrogen RU 58,668. To study the mechanisms behind acquired resistance to RU 58,668, the RU 58,668-resistant cell line MCF-7/RU58(R)-1 (RU58(R)-1) was developed. The RU58(R)-1 cell line was responsive to tamoxifen, but cross-resistant to ICI 182,780 and the estrogen-sensitivity was reduced compared to the parental MCF-7 cell line. The protein levels of ERalpha, IGF-I Receptor (IGF-IR) and Bcl-2 were severely reduced, when RU58(R)-1 cells were cultured with RU 58,668 and the expression of progesterone receptor (PR) was lost. The ERalpha level increased upon withdrawal of RU 58,668 and the ERalpha protein was destabilized by RU 58,668 in both cell lines. Regulation of most of the investigated estrogen-sensitive mRNAs was found to be normal in the resistant cells. The protein levels of IGF-IR, Bcl-2 and the IGF Binding Protein 2 (IGFBP2) reverted towards MCF-7 levels upon RU 58,668 withdrawal, but the resistant phenotype was maintained. Thus, it appears as acquired resistance to RU 58,668 is not a result of loss of the ERalpha expression or function and we suggest that in the presence of RU 58,668, the RU58(R)-1 cell line probably uses other mitogenic pathways than the ERalpha pathway for growth and survival.

  5. Determination of {sup 55}Fe and {sup 63}Ni in spent ion-exchange resins from the IEA-R1 reactor (IPEN-CNEN/SP)

    Energy Technology Data Exchange (ETDEWEB)

    Taddei, Maria Helena T.; Ferreira, Marcelo T., E-mail: mhtaddei@cnen.gov.b, E-mail: ferreira@cnen.gov.b [Brazilian Nuclear Energy Commission (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Lab. of Pocos de Caldas; Vicente, Roberto; Marumo, Julio T.; Terremoto, Luis A. Albiac, E-mail: jtmarumo@ipen.b, E-mail: rvicente@ipen.b, E-mail: laaterre@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Iron and nickel are used in a wide range of metallic alloys employed in reactor core structures and their corresponding activation products are often encountered in reactor-derived solid low-level wastes and effluents. Both {sup 63} Ni and {sup 55} Fe are neutron activation products. {sup 63} Ni is produced by a neutron-gamma reaction of {sup 62} Ni and by a neutron-proton reaction of-{sup 63}Cu. Iron-55 is produced by neutron activation of two major stable iron isotopes: neutron-gamma reaction of {sup 54} Fe and neutron-to-neutron reaction of {sup 56}Fe. Nickel-63 is a pure beta emitter with maximum energy of 66.95 keV and half-life of 100.1 years, and {sup 55}Fe, with a half life of 2.7 years, decays via electron capture to stable {sup 55}Mn with the emission of Auger electrons and 5.89 keV X-rays. {sup 63} Ni is an important radionuclide in safety analysis of nuclear waste repositories and {sup 55} Fe is an important contributor to the radioactivity of nuclear waste in the first few years of storage. In this work, liquid scintillation counting was used for the determination of both radionuclides in spent ion-exchange resins taken from the water retreatment system of the IEA-R1 reactor and stored at the Radioactive Waste Management Laboratory of the Nuclear and Energy Research Institute (IPEN-CNEN/SP). Since nuclear waste usually contains many beta emitters, such as {sup 3}H, {sup 14}C, {sup 60}Co, {sup 90}Sr, and {sup 137}Cs, a highly efficient chemical separation method is required to isolate {sup 55}Fe and {sup 63}Ni from all other radionuclides. Hydroxide precipitation was used to separate {sup 55} Fe and {sup 63}Ni from the waste matrix and ion exchange chromatography was used to separate {sup 55}Fe and {sup 63}Ni from each other as well as from interfering radionuclides. The chemical yield was above 90% for {sup 63}Ni and above 60% for {sup 55}Fe. The results of activity measurements correlated well with the concentration of {sup 60}Co in this waste

  6. Substring Range Reporting

    DEFF Research Database (Denmark)

    Bille, Philip; Gørtz, Inge Li

    2011-01-01

    We revisit various string indexing problems with range reporting features, namely, position-restricted substring searching, indexing substrings with gaps, and indexing substrings with intervals. We obtain the following main results. – We give efficient reductions for each of the above problems...... to a new problem, which we call substring range reporting. Hence, we unify the previous work by showing that we may restrict our attention to a single problem rather than studying each of the above problems individually. – We show how to solve substring range reporting with optimal query time and little...... range reporting are based on a novel combination of suffix trees and range reporting data structures. The reductions are simple and general and may apply to other combinations of string indexing with range reporting....

  7. Generating three-parameter sensor

    Directory of Open Access Journals (Sweden)

    Filinyuk M. A.

    2014-08-01

    Full Text Available Generating sensors provide the possibility of getting remote information and its easy conversion into digital form. Typically, these are one-parameter sensors formed by combination of a primary transmitter (PT and a sine wave generator. Two-parameter sensors are not widely used as their implementation causes a problem with ambiguity output when measuring the PT. Nevertheless, the problem of creating miniature, thrifty multi-parameter RF sensors for different branches of science and industry remains relevant. Considering ways of designing RF sensors, we study the possibility of constructing a three-parameter microwave radio frequency range sensor, which is based on a two-stage three-parameter generalized immitance convertor (GIC. Resistive, inductive and capacitive PT are used as sensing elements. A mathematical model of the sensor, which describes the relation of the sensor parameters to the parameters of GIC and PT was developed. The basic parameters of the sensor, its transfer function and sensitivity were studied. It is shown that the maximum value of the power generated signal will be observed at a frequency of 175 MHz, and the frequency ranges depending on the parameters of the PT will be different. Research results and adequacy of the mathematical model were verified by the experiment. Error of the calculated dependences of the lasing frequency on PT parameters change, compared with the experimental data does not exceed 2 %. The relative sensitivity of the sensor based on two-stage GIC showed that for the resistive channel it is about 1.88, for the capacitive channel –1,54 and for the inductive channel –11,5. Thus, it becomes possible to increase the sensor sensitivity compared with the sensitivity of the PT almost 1,2—2 times, and by using the two stage GIC a multifunctional sensor is provided.

  8. Compact Antenna Range

    Data.gov (United States)

    Federal Laboratory Consortium — Facility consists of a folded compact antenna range including a computer controlled three axis position table, parabolic reflector and RF sources for the measurement...

  9. Dryden Aeronautical Test Range

    Data.gov (United States)

    Federal Laboratory Consortium — Recently redesignated to honor Dr. Hugh L. Dryden, NASA's Dryden Aeronautical Test Range (DATR) supports aerospace flight research and technology integration, space...

  10. On Range of Skill

    DEFF Research Database (Denmark)

    Hansen, Thomas Dueholm; Miltersen, Peter Bro; Sørensen, Troels Bjerre

    2008-01-01

    size (and doubly exponential in its depth). We also provide techniques that yield concrete bounds for unbalanced game trees and apply these to estimate the Range of Skill of Tic-Tac-Toe and Heads-Up Limit Texas Hold'em Poker. In particular, we show that the Range of Skill of Tic-Tac-Toe is more than...

  11. Range Scheduling Aid (RSA)

    Science.gov (United States)

    Logan, J. R.; Pulvermacher, M. K.

    1991-01-01

    Range Scheduling Aid (RSA) is presented in the form of the viewgraphs. The following subject areas are covered: satellite control network; current and new approaches to range scheduling; MITRE tasking; RSA features; RSA display; constraint based analytic capability; RSA architecture; and RSA benefits.

  12. Supersymmetric inversion of effective-range expansions

    OpenAIRE

    Midya, Bikashkali; Evrard, Jérémie; Abramowicz, Sylvain; Ramirez Suarez, Oscar Leonardo; Sparenberg, Jean-Marc

    2015-01-01

    A complete and consistent inversion technique is proposed to derive an accurate interaction potential from an effective-range function for a given partial wave in the neutral case. First, the effective-range function is Taylor or Pad\\'e expanded, which allows high precision fitting of the experimental scattering phase shifts with a minimal number of parameters on a large energy range. Second, the corresponding poles of the scattering matrix are extracted in the complex wave-number plane. Thir...

  13. Home range and travels

    Science.gov (United States)

    Stickel, L.F.; King, John A.

    1968-01-01

    The concept of home range was expressed by Seton (1909) in the term 'home region,' which Burr (1940, 1943) clarified with a definition of home range and exemplified in a definitive study of Peromyscus in the field. Burt pointed out the ever-changing characteristics of home-range area and the consequent absence of boundaries in the usual sense--a finding verified by investigators thereafter. In the studies summarized in this paper, sizes of home ranges of Peromyscus varied within two magnitudes, approximately from 0.1 acre to ten acres, in 34 studies conducted in a variety of habitats from the seaside dunes of Florida to the Alaskan forests. Variation in sizes of home ranges was correlated with both environmental and physiological factors; with habitat it was conspicuous, both in the same and different regions. Food supply also was related to size of home range, both seasonally and in relation to habitat. Home ranges generally were smallest in winter and largest in spring, at the onset of the breeding season. Activity and size also were affected by changes in weather. Activity was least when temperatures were low and nights were bright. Effects of rainfall were variable. Sizes varied according to sex and age; young mice remained in the parents' range until they approached maturity, when they began to travel more widely. Adult males commonly had larger home ranges than females, although there were a number of exceptions. An inverse relationship between population density and size of home range was shown in several studies and probably is the usual relationship. A basic need for activity and exploration also appeared to influence size of home range. Behavior within the home range was discussed in terms of travel patterns, travels in relation to home sites and refuges, territory, and stability of size of home range. Travels within the home range consisted of repeated use of well-worn trails to sites of food, shelter, and refuge, plus more random exploratory travels

  14. [Establishment of two-dimensional electrophoresis proteomic profiles of retinoid acid resistant human acute promyelocytic leukemia NB4-R1 cells with apoptosis induced by realgar].

    Science.gov (United States)

    Qi, Jun; Zhang, Mei; He, Peng-cheng

    2011-03-01

    To establish the comparative proteomic profiles of retinoid acid (RA) resistant human acute promyelocytic leukemia (APL) NB4-R1 cells before and after apoptosis induced by realgar (tetra-arsenic tetra-sulfide, As4S4). First a serial of assays were performed using MTT, transmission electron microscopy, Annexin V FITC/PI double-stain, flow cytometry and confocal laser scanning microscopy to qualitatively and quantitatively observe the in vitro apoptosis inducing effect of realgar on RA-resistant cells. Then the comparative proteomic profile before and after NB4-R1 apoptosis was established using high-resolution two-dimensional electrophoresis system. The inhibition effect of realgar on NB4-R1 cell growth was dose and time dependent. The 24-h 50% inhibiting concentration (IC50) was 24.06 +/- 0.19 micromol/L, and the 48-h IC50 9.50 +/- 0.13 micromol/L, and 72-h IC50 6.55 +/- 0.03 micromol/L, respectively. 24 h and 48 h were the early and late phase of major NB4-R1 apoptotic cell populations induced by 25 micromol/L realgar respectively. Differential proteomic profiles before and after realgar induced NB4-R1 apoptosis were successfully established. Averagely 1069, 975 and 893 spots could be detected of the untreated group (R0), the 24-h treatment group (R24), and the 48-h treatment group (R48), respectively by ImageMaster 2D Platinum Software. The matching rate between R24 and R0 was 79.94% and that between R48 and R0 69.33%, and that between R24 and R48 71.91%. Differential proteomic profiles of realgar induced NB4-R1 apoptosis were successfully established for the first time, which provided a basis for comprehensively understanding the signal transduction of realgar induced apoptosis in RA-resistant APL cells, also for screening new bio-markers and drug targets of hematopoietic malignant tumor.

  15. Homer1a signaling in the amygdala counteracts pain-related synaptic plasticity, mGluR1 function and pain behaviors

    Directory of Open Access Journals (Sweden)

    Kuner Rohini

    2011-05-01

    Full Text Available Abstract Background Group I metabotropic glutamate receptor (mGluR1/5 signaling is an important mechanism of pain-related plasticity in the amygdala that plays a key role in the emotional-affective dimension of pain. Homer1a, the short form of the Homer1 family of scaffolding proteins, disrupts the mGluR-signaling complex and negatively regulates nociceptive plasticity at spinal synapses. Using transgenic mice overexpressing Homer1a in the forebrain (H1a-mice, we analyzed synaptic plasticity, pain behavior and mGluR1 function in the basolateral amygdala (BLA in a model of arthritis pain. Findings In contrast to wild-type mice, H1a-mice mice did not develop increased pain behaviors (spinal reflexes and audible and ultrasonic vocalizations after induction of arthritis in the knee joint. Whole-cell patch-clamp recordings in brain slices showed that excitatory synaptic transmission from the BLA to the central nucleus (CeA did not change in arthritic H1a-mice but increased in arthritic wild-type mice. A selective mGluR1 antagonist (CPCCOEt had no effect on enhanced synaptic transmission in slices from H1a-BLA mice with arthritis but inhibited transmission in wild-type mice with arthritis as in our previous studies in rats. Conclusions The results show that Homer1a expressed in forebrain neurons, prevents the development of pain hypersensitivity in arthritis and disrupts pain-related plasticity at synapses in amygdaloid nuclei. Furthermore, Homer1a eliminates the effect of an mGluR1 antagonist, which is consistent with the well-documented disruption of mGluR1 signaling by Homer1a. These findings emphasize the important role of mGluR1 in pain-related amygdala plasticity and provide evidence for the involvement of Homer1 proteins in the forebrain in the modulation of pain hypersensitivity.

  16. Mandibular movement range in children.

    Science.gov (United States)

    Machado, Barbara Cristina Zanandréa; Medeiros, Ana Paula Magalhães; Felício, Cláudia Maria de

    2009-01-01

    identification of the mandibular movement range is an important procedure in the evaluation of the stomatognathic system. However, there are few studies in children that focus on normal parameters or abnormalities. to determine the average range of mandibular movements in Brazilian children aged 6 to 12 years; to verify the difference between genders, in each age group, and between the different age groups: 6-8 years; 8.1-10 years; and 10.1-12 years. participants of the study were 240 healthy children selected among regular students from local schools of São Paulo State. The maximum mandibular opening, lateral excursion and protrusive movements, and deviation of the medium line, if present, were measured using a digital caliper. Student T test, Analysis of variance and Tukey test were considered significant for p mandibular opening; 7.71mm for lateral excursion to the right; 7.92mm for lateral excursion to the left; 7.45mm for protrusive movements. No statistical difference was observed between genders. There was a gradual increase in the range of mandibular movements, with significant differences mainly between the ages of 6-8 years and 10.1-12 years. during childhood the range of mandibular movements increases. Age should be considered in this analysis for a greater precision in the diagnosis.

  17. The anonymous probe pR1-4 which identifies the locus D13S59 detects a BanII RFLP

    Energy Technology Data Exchange (ETDEWEB)

    Bowcock, A.M.; Hebert, J. (Stanford Univ., CA (USA))

    1989-10-25

    Probe pR1-4 contains a 6.7kb fragment from bacteriophage 13.1 which was subcloned into the HindIII site of PBR322. Cleavage of pR1-4 with HindIII/PstI generates a 2.7kb fragment that can be used as a single copy probe on Southern blots. Phage 13.1 was isolated from a chromosome 13 specific library constructed in Charon 21A. BanII (GPuGCPy/C) detects a two allele polymorphism with fragment lengths of 8.5kb (Al) and 4.9kb (A2). The frequency was estimated from 156 unrelated Caucasoids. It was localized to chromosome 13 on the basis of linkage with other loci/genes including ESD and RB1, known to reside on this chromosome. Co-dominant segregation was observed in 35 families (474 individuals).

  18. New developments and applications of the MP2RAGE sequence--focusing the contrast and high spatial resolution R1 mapping.

    Directory of Open Access Journals (Sweden)

    José P Marques

    Full Text Available MR structural T1-weighted imaging using high field systems (>3T is severely hampered by the existing large transmit field inhomogeneities. New sequences have been developed to better cope with such nuisances. In this work we show the potential of a recently proposed sequence, the MP2RAGE, to obtain improved grey white matter contrast with respect to conventional T1-w protocols, allowing for a better visualization of thalamic nuclei and different white matter bundles in the brain stem. Furthermore, the possibility to obtain high spatial resolution (0.65 mm isotropic R1 maps fully independent of the transmit field inhomogeneities in clinical acceptable time is demonstrated. In this high resolution R1 maps it was possible to clearly observe varying properties of cortical grey matter throughout the cortex and observe different hippocampus fields with variations of intensity that correlate with known myelin concentration variations.

  19. A metallo-keratinase from a newly isolated Acinetobacter sp. R-1 with low collagenase activity and its biotechnological application potential in leather industry.

    Science.gov (United States)

    Zhang, Rong-Xian; Gong, Jin-Song; Zhang, Dan-Dan; Su, Chang; Hou, Ying-Shuo; Li, Heng; Shi, Jin-Song; Xu, Zheng-Hong

    2016-01-01

    Microbial keratinase is a well-recognized enzyme that can specifically degrade insoluble keratins. A keratinase-producing bacterium was isolated from a duck ranch soil and identified as Acinetobacter sp. R-1 based on the biochemical characteristics and 16S rDNA gene sequencing. It showed high keratinase activity and low collagenase activity. The keratinase was purified to electrophoretic homogeneity with 6.69% recovery, 2.68-fold purification and an estimated molecular weight of 25 kDa. Additionally, the keratinase showed optimal activity at 50 °C and pH11. Keratinase activity of Acinetobacter sp. significantly increased in the presence of Li(+), Na(+), and Ca(2+), while it was completely inhibited by EDTA, indicating it was a metallo-keratinase. Moreover, the crude keratinase from Acinetobacter sp. R-1 could thoroughly depilate goat skin and simultaneously modify the wool surface, which indicated its applicable potential in leather and textile industries.

  20. New developments and applications of the MP2RAGE sequence--focusing the contrast and high spatial resolution R1 mapping.

    Science.gov (United States)

    Marques, José P; Gruetter, Rolf

    2013-01-01

    MR structural T1-weighted imaging using high field systems (>3T) is severely hampered by the existing large transmit field inhomogeneities. New sequences have been developed to better cope with such nuisances. In this work we show the potential of a recently proposed sequence, the MP2RAGE, to obtain improved grey white matter contrast with respect to conventional T1-w protocols, allowing for a better visualization of thalamic nuclei and different white matter bundles in the brain stem. Furthermore, the possibility to obtain high spatial resolution (0.65 mm isotropic) R1 maps fully independent of the transmit field inhomogeneities in clinical acceptable time is demonstrated. In this high resolution R1 maps it was possible to clearly observe varying properties of cortical grey matter throughout the cortex and observe different hippocampus fields with variations of intensity that correlate with known myelin concentration variations.

  1. Long range image enhancement

    CSIR Research Space (South Africa)

    Duvenhage, B

    2015-11-01

    Full Text Available and Vision Computing, Auckland, New Zealand, 23-24 November 2015 Long Range Image Enhancement Bernardt Duvenhage Council for Scientific and Industrial Research South Africa Email: bduvenhage@csir.co.za Abstract Turbulent pockets of air...

  2. SNOWY RANGE WILDERNESS, WYOMING.

    Science.gov (United States)

    Houston, Robert S.; Bigsby, Philip R.

    1984-01-01

    A mineral survey of the Snowy Range Wilderness in Wyoming was undertaken and was followed up with more detailed geologic and geochemical surveys, culminating in diamond drilling of one hole in the Snowy Range Wilderness. No mineral deposits were identified in the Snowy Range Wilderness, but inasmuch as low-grade uranium and associated gold resources were identified in rocks similar to those of the northern Snowy Range Wilderness in an area about 5 mi northeast of the wilderness boundary, the authors conclude that the northern half of the wilderness has a probable-resource potential for uranium and gold. Closely spaced drilling would be required to completely evaluate this mineral potential. The geologic terrane precludes the occurrence of fossil fuels.

  3. Atlantic Test Range (ATR)

    Data.gov (United States)

    Federal Laboratory Consortium — ATR controls fully-instrumented and integrated test ranges that provide full-service support for cradle-to-grave testing. Airspace and surface target areas are used...

  4. Light Detection And Ranging

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — LiDAR (Light Detection and Ranging) discrete-return point cloud data are available in the American Society for Photogrammetry and Remote Sensing (ASPRS) LAS format....

  5. Bias correction and verification of extended-range ECMWF forecasts against ground observations in Europe

    Science.gov (United States)

    Monhart, Samuel; Spirig, Christoph; Bhend, Jonas; Liniger, Mark A.; Bogner, Konrad; Schär, Christoph

    2017-04-01

    In recent years large progress has been made in numerical weather prediction. The implementation of ensemble forecasts has led to better predictability especially at longer lead times, including extended-range (monthly) to seasonal time horizons. The verification of such predictions is often done for areal averages of upper air parameters. Only few studies exist that verify the forecasts for surface parameters at point locations although applications often require local information. With this study we aim at providing an extensive station-wise verification of extended range forecasts in Europe. We therefore verified the ECMWF extended-range forecast against approximately 1000 ground based observational time series across Europe. To do so, we made use of 20 years of hindcasts of the forecasting system that was operational from May 2014 to April 2015 (cycle 40r1), yielding an analysis period of May 1995 to June 2014. This data set is large enough to stratify the performance of the forecast system with season and region. Weekly temperature and precipitation of both raw hindcasts and post-processed hindcasts were analyzed. For the post-processing two techniques were compared, a mean debiasing (MD) and a quantile mapping (QM) approach. Various skill scores (RPSS, CRPSS, ROCSS) characterizing different aspects of forecast quality were computed using simple forecasts based on climatology as a benchmark. Overall, skillful forecasts were found in some regions and seasons up to three weeks of lead time in case of temperature and up to two weeks for precipitation, respectively. Bias-corrections allowed to enhance forecast skill in the first two weeks for most of the stations. QM generally performed better in particular concerning the improvement of reliability as illustrated by the resulting spread to error ratios close to one. Spatial and seasonal differences in skill were found both for temperature and precipitation, with winter forecasts generally being better than those

  6. Ghrelin receptor (GHS-R1A antagonism suppresses both alcohol consumption and the alcohol deprivation effect in rats following long-term voluntary alcohol consumption.

    Directory of Open Access Journals (Sweden)

    Petra Suchankova

    Full Text Available Alcohol dependence is a heterogeneous disorder where several signalling systems play important roles. Recent studies implicate that the gut-brain hormone ghrelin, an orexigenic peptide, is a potential mediator of alcohol related behaviours. Ghrelin increases whereas a ghrelin receptor (GHS-R1A antagonist decreases alcohol consumption as well as operant self-administration of alcohol in rodents that have consumed alcohol for twelve weeks. In the present study we aimed at investigating the effect of acute and repeated treatment with the GHS-R1A antagonist JMV2959 on alcohol intake in a group of rats following voluntarily alcohol consumption for two, five and eight months. After approximately ten months of voluntary alcohol consumption the expression of the GHS-R1A gene (Ghsr as well as the degree of methylation of a CpG island found in Ghsr was examined in reward related brain areas. In a separate group of rats, we examined the effect of the JMV2959 on alcohol relapse using the alcohol deprivation paradigm. Acute JMV2959 treatment was found to decrease alcohol intake and the effect was more pronounced after five, compared to two months of alcohol exposure. In addition, repeated JMV2959 treatment decreased alcohol intake without inducing tolerance or rebound increase in alcohol intake after the treatment. The GHS-R1A antagonist prevented the alcohol deprivation effect in rats. There was a significant down-regulation of the Ghsr expression in the ventral tegmental area (VTA in high- compared to low-alcohol consuming rats after approximately ten months of voluntary alcohol consumption. Further analysis revealed a negative correlation between Ghsr expression in the VTA and alcohol intake. No differences in methylation degree were found between high- compared to low-alcohol consuming rats. These findings support previous studies showing that the ghrelin signalling system may constitute a potential target for development of novel treatment strategies

  7. AMIGO3 is an NgR1/p75 co-receptor signalling axon growth inhibition in the acute phase of adult central nervous system injury.

    Directory of Open Access Journals (Sweden)

    Zubair Ahmed

    Full Text Available Axon regeneration in the injured adult CNS is reportedly inhibited by myelin-derived inhibitory molecules, after binding to a receptor complex comprised of the Nogo-66 receptor (NgR1 and two transmembrane co-receptors p75/TROY and LINGO-1. However, the post-injury expression pattern for LINGO-1 is inconsistent with its proposed function. We demonstrated that AMIGO3 levels were significantly higher acutely than those of LINGO-1 in dorsal column lesions and reduced in models of dorsal root ganglion neuron (DRGN axon regeneration. Similarly, AMIGO3 levels were raised in the retina immediately after optic nerve crush, whilst levels were suppressed in regenerating optic nerves, induced by intravitreal peripheral nerve implantation. AMIGO3 interacted functionally with NgR1-p75/TROY in non-neuronal cells and in brain lysates, mediating RhoA activation in response to CNS myelin. Knockdown of AMIGO3 in myelin-inhibited adult primary DRG and retinal cultures promoted disinhibited neurite growth when cells were stimulated with appropriate neurotrophic factors. These findings demonstrate that AMIGO3 substitutes for LINGO-1 in the NgR1-p75/TROY inhibitory signalling complex and suggests that the NgR1-p75/TROY-AMIGO3 receptor complex mediates myelin-induced inhibition of axon growth acutely in the CNS. Thus, antagonizing AMIGO3 rather than LINGO-1 immediately after CNS injury is likely to be a more effective therapeutic strategy for promoting CNS axon regeneration when combined with neurotrophic factor administration.

  8. Cocaine-induced behavioral sensitization in adolescent rats endures until adulthood: lack of association with GluR1 and NR1 glutamate receptor subunits and tyrosine hydroxylase.

    Science.gov (United States)

    Marin, Marcelo T; Cruz, Fábio C; Planeta, Cleopatra S

    2008-11-01

    Exposure to repeated cocaine induces enduring behavioral sensitization, which has been implicated in the psychostimulant-induced craving and psychosis. Adaptations in dopamine and glutamate neurotransmission in the nucleus accumbens (NAc) and medial prefrontal cortex (mPFC) seem to mediate psychostimulant-induced behavioral sensitization. The abuse of drugs often begins during adolescence; however few studies have been devoted to study the effects of drugs of abuse at this age. The aim of our study was to examine whether repeated cocaine during adolescence could induce behavioral sensitization that endures into adulthood. Moreover, the protein levels of Tyrosine Hydroxylase (TH) and the glutamate receptor subunits GluR1 and NR1 in the NAc and mPFC were measured following the behavioral tests. Adolescent rats were treated with cocaine from postnatal day (PND) 30 to PND34 and behavioral sensitization was verified recording locomotor activity after cocaine challenge injection to adolescent (PND37) or adult (PND64 or 94) rats in separate groups at each time point. TH, GluR1, and NR1 protein levels were measured by Western blotting. Rats exposed to cocaine during adolescence expressed behavioral sensitization when tested on PND37 and PND64. In cocaine sensitized rats GluR1 protein was increased in the mPFC on PND37 but not in other ages. Thus, cocaine-induced behavioral sensitization during adolescence endures into early adulthood. However, cocaine pretreatment during adolescence induced a transient increase of GluR1 in the mPFC only when animals were challenged in the same age.

  9. Variations in IL-1R1 Gene Influence Risk for Hepatitis B Virus Infection of Children in a Han Chinese population.

    Science.gov (United States)

    Fan, Jie; Cai, Yiling; Huang, Xin; Wang, Yan; Mu, Lihong; Zhou, Li

    2017-02-01

    Host genetic factors play an important role in the pathogenesis of hepatitis B virus (HBV) infection. However, the role of Interleukin1Receptor, Type I (IL-1R1) gene in HBV infection and breakthrough infection in children remains unclear. The aim of this study was to investigate the association between SNPs in IL-1 family and HBV infection and breakthrough infection in children. A total of 627 Chinese children (274 HBV infected children and 353 controls) ages 6 months to 12 years were recruited from October 2013 to May 2015.Six SNPs were genotyped in IL-1R1, Interleukin-1beta (IL-1B) and Interleukin-18 (IL-18) genes. A statistically significant association was found between genotype AA in rs3917267 (IL-1R1) and HBV infection in children (OR, 1.740; 95%CI, 1.091-2.774; p=0.020), which was also found at allele A (OR, 1.316;95%CI, 1.050-1.648; p=0.017). Furthermore, rs3917267 was also significantly associated with breakthrough infection of HBV in children born of hepatitis B surface antigen (HBsAg) positive mothers (OR,3.675; 95%CI, 1.160-11.646; P=0.027). Our study confirmed that genetic variant in IL-1R1(rs3917267) has significant association with HBV infection and HBV breakthrough infection in children, which provides new clues for the study of pathogenesis of chronic HBV infection in children. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  10. TRH/TRH-R1 receptor signaling in the brain medulla as a pathway of vagally mediated gut responses during the cephalic phase.

    Science.gov (United States)

    Taché, Yvette; Adelson, David; Yang, Hong

    2014-01-01

    Pavlov's seminal findings in the early twentieth century showed that the sight, smell or taste of food in dogs with chronic esophagostomy induces a vagal-dependent gastric acid secretion. These observations established the concept of the cephalic phase of digestion. Compelling experimental evidence in rats indicates that the three amino acid peptide thyrotropin-releasing hormone (TRH) expressed in the brainstem plays a key role in the vagal stimulation of gastric function. Neurons in the dorsal motor nucleus of the vagus (DMN) expressed TRH receptor subtype (TRH-R1) and received efferent input from TRH containing fibers arising from TRH synthesizing neurons in the raphe pallidus, raphe obscurus, and the parapyramidal regions. TRH microinjected into the DMN or intracisternally excites the firing of DMN neurons and stimulates efferent activity in the gastric branch of the vagus nerve and gastric myenteric cholinergic neurons. At the functional level, this results in a vagally-mediated and atropine-sensitive stimulation of gastric epithelial and endocrine cells secreting acid, pepsin, serotonin, histamine and ghrelin, and enteric neurons leading to increased gastric motility and emptying. Importantly, the blockade of TRH or TRH-R1 in the brainstem by pretreatment into the cisterna magna or the DMN with TRH antibody or TRH-R1 oligodeoxynucleotide antisense respectively abolishes the stimulation of gastric acid induced by sham-feeding. The gastric response to TRH injected into the DMN is potentiated by serotonin and the proTRH flanking peptide, Ps4 and suppressed by a number of brainstem peptides and cytokines activated during stress or immune response and inhibiting food intake and gastric acid secretion. These convergent data strongly support a physiological involvement of TRH signaling pathway in the brainstem to stimulate vagal activity and identified TRH-TRH-R1 system as a major effector in the dorsal vagal complex to drive the vagally mediated gut response

  11. Investigating the Role of Fatty Acid Metabolism and DecR1 Expression ErbB2-Driven Mammary Tumorigenesis and Metastasis Using a Transgenic Mouse Model Approach

    Science.gov (United States)

    2011-07-01

    MTB ) maintains expression of the transactivator in the mammary epithelium. In the presence, but not the absence, of doxycycline, doxycycline binds to...tumorigenic process. For this aim, tri-genic mice were generated expressing the MTB transgene with inducible DecR1 and the oncogene NDL. The MMTV-NDL2-5...under induction as of 3 weeks of age, were compared to bi-genic mice without the MTB transgene. Subsequently, uninduced tri-genic mice were added to

  12. Activation of the umami taste receptor (T1R1/T1R3) initiates the peristaltic reflex and pellet propulsion in the distal colon

    OpenAIRE

    Kendig, Derek M.; Hurst, Norman R.; Bradley, Zachary L.; Mahavadi, Sunila; Kuemmerle, John F.; Lyall, Vijay; Desimone, John; Murthy, Karnam S.; Grider, John R.

    2014-01-01

    Intraluminal nutrients in the gut affect the peristaltic reflex, although the mechanism is not well defined. Recent evidence supports the presence of taste receptors and their signaling components in enteroendocrine cells, although their function is unclear. This study aimed to determine if nutrients modify colonic motility through activation of taste receptors. Colonic sections were immunostained for the umami taste receptor T1R1/T1R3, which mediates the response to umami ligands, such as mo...

  13. Low enriched uranium UAl{sub X}-Al targets for the production of Molybdenum-99 in the IEA-R1 and RMB reactors

    Energy Technology Data Exchange (ETDEWEB)

    Domingos, Douglas B.; Silva, Antonio T. e; Joao, Thiago G.; Silva, Jose Eduardo R. da, E-mail: teixeira@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Nishiyama, Pedro J.B. de O., E-mail: pedro.julio@ctmsp.mar.mil.b [Centro Tecnologico da Marinha em Sao Paulo (CTMSP), SP (Brazil)

    2011-07-01

    The IEA-R1 reactor of IPEN/CNEN-SP in Brazil is a pool type research reactor cooled and moderated by demineralized water and having Beryllium and Graphite as reflectors. In 1997 the reactor received the operating licensing for 5 MW. A new research reactor is being planned in Brazil to replace the IEA-R1 reactor. This new reactor, the Brazilian Multipurpose Reactor (RMB), planned for 30 MW, is now in the conception design phase. Low enriched uranium (LEU) (<20% {sup 235}U) UAl{sub x} dispersed in Al targets are being considered for production of Molybdenum-99 ({sup 99}Mo) by fission. Neutronic and thermal-hydraulics calculations were performed, respectively, to compare the production of {sup 99}Mo for these targets in IEA-R1 reactor and RMB and to determine the temperatures achieved in the UAl{sub x}-Al targets during irradiation. For the neutronic calculations were utilized the computer codes HAMMER-TECHNION, CITATION and SCALE and for the thermal-hydraulics calculations was utilized the computer code MTRCR-IEAR1. (author)

  14. Microbial production of the aromatic building-blocks (S)-styrene oxide and (R)-1,2-phenylethanediol from renewable resources.

    Science.gov (United States)

    McKenna, Rebekah; Pugh, Shawn; Thompson, Brian; Nielsen, David R

    2013-12-01

    (S)-Styrene oxide and (R)-1,2-phenylethanediol are chiral aromatic molecular building blocks used commonly as precursors to pharmaceuticals and other specialty chemicals. Two pathways have been engineered in Escherichia coli for their individual biosynthesis directly from glucose. The novel pathways each constitute extensions of the previously engineered styrene pathway, developed by co-expressing either styrene monooxygenase (SMO) or styrene dioxygenase (SDO) to convert styrene to (S)-styrene oxide and (R)-1,2-phenylethanediol, respectively. StyAB from Pseudomonas putida S12 was determined to be the most effective SMO. SDO activity was achieved using NahAaAbAcAd of Pseudomonas sp. NCIB 9816-4, a naphthalene dioxygenase with known broad substrate specificity. Production of phenylalanine, the precursor to both pathways, was systematically enhanced through a number of mutations, most notably via deletion of tyrA and over-expression of tktA. As a result, (R)-1,2-phenylethanediol reached titers as high as 1.23 g/L, and at 1.32 g/L (S)-styrene oxide titers already approach their toxicity limit. As with other aromatics, product toxicity was strongly correlated with a model of membrane accumulation and disruption. This study additionally demonstrates that greater flux through the styrene pathway can be achieved if its toxicity is addressed, as achieved in this case by reacting styrene to less toxic products. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. RNA-Sequencing Reveals the Progression of Phage-Host Interactions between φR1-37 and Yersinia enterocolitica

    Directory of Open Access Journals (Sweden)

    Katarzyna Leskinen

    2016-04-01

    Full Text Available Despite the expanding interest in bacterial viruses (bacteriophages, insights into the intracellular development of bacteriophage and its impact on bacterial physiology are still scarce. Here we investigate during lytic infection the whole-genome transcription of the giant phage vB_YecM_φR1-37 (φR1-37 and its host, the gastroenteritis causing bacterium Yersinia enterocolitica. RNA sequencing reveals that the gene expression of φR1-37 does not follow a pattern typical observed in other lytic bacteriophages, as only selected genes could be classified as typically early, middle or late genes. The majority of the genes appear to be expressed constitutively throughout infection. Additionally, our study demonstrates that transcription occurs mainly from the positive strand, while the negative strand encodes only genes with low to medium expression levels. Interestingly, we also detected the presence of antisense RNA species, as well as one non-coding intragenic RNA species. Gene expression in the phage-infected cell is characterized by the broad replacement of host transcripts with phage transcripts. However, the host response in the late phase of infection was also characterized by up-regulation of several specific bacterial gene products known to be involved in stress response and membrane stability, including the Cpx pathway regulators, ATP-binding cassette (ABC transporters, phage- and cold-shock proteins.

  16. Transfer protein TraM stimulates TraI-catalyzed cleavage of the transfer origin of plasmid R1 in vivo.

    Science.gov (United States)

    Kupelwieser, G; Schwab, M; Högenauer, G; Koraimann, G; Zechner, E L

    1998-01-09

    Factors contributing directly to the cleavage of the conjugative transfer origin of plasmid R1 in Escherichia coli were investigated. The essential transfer protein TraM was identified as a necessary positive effector of the catalytic activity of TraI relaxase at the R1 transfer origin in the absence of protein TraY. The stimulatory effect of TraM on the cleavage reaction in vivo correlated with the capacity of TraM to bind origin DNA. TraM was shown to be essential for heterologous mobilization of recombinant origin DNA. The requirement for TraM to promote mobilization was distinct from the protein's positive effect on transfer gene regulation. Chimeric traM alleles, fusing heterologous amino and carboxyl coding sequences from the traM genes of the R1 and the IncFI plasmid P307, were used to localize the specificity determinant of TraM's DNA binding activity. Use of the chimeric alleles also revealed that the requirement for TraM in mobilization is origin specific but transfer system independent. No evidence was found for a plasmid specific activity of TraM at a stage in the transfer process subsequent to the initial cleavage of origin DNA. In light of TraM's regulatory functions in transfer gene expression, we propose that TraM could control conjugative DNA processing in response to intracellular levels of transfer proteins.

  17. Data Handling and Parameter Estimation

    DEFF Research Database (Denmark)

    Sin, Gürkan; Gernaey, Krist

    2016-01-01

    ). Models have also been used as an integral part of the comprehensive analysis and interpretation of data obtained from a range of experimental methods from the laboratory, as well as pilot-scale studies to characterise and study wastewater treatment plants. In this regard, models help to properly explain...... various kinetic parameters for different microbial groups and their activities in WWTPs by using parameter estimation techniques. Indeed, estimating parameters is an integral part of model development and application (Seber andWild, 1989; Ljung, 1999; Dochain and Vanrolleghem,2001; Omlin and Reichert......, 1999; Brun et al., 2002; Sinet al., 2010) and can be broadly defined as follows: Given a model and a set of data/measurements from the experimental setup in question, estimate all or some of the parameters of the model using an appropriate statistical method. The focus of this chapter is to provide...

  18. In Situ Localization and Rhythmic Expression of Ghrelin and ghs-r1 Ghrelin Receptor in the Brain and Gastrointestinal Tract of Goldfish (Carassius auratus.

    Directory of Open Access Journals (Sweden)

    Aída Sánchez-Bretaño

    Full Text Available Ghrelin is a gut-brain peptide hormone, which binds to the growth hormone secretagogue receptor (GHS-R to regulate a wide variety of biological processes in fish. Despite these prominent physiological roles, no studies have reported the anatomical distribution of preproghrelin transcripts using in situ hybridization in a non-mammalian vertebrate, and its mapping within the different encephalic areas remains unknown. Similarly, no information is available on the possible 24-h variations in the expression of preproghrelin and its receptor in any vertebrate species. The first aim of this study was to investigate the anatomical distribution of ghrelin and GHS-R1a ghrelin receptor subtype in brain and gastrointestinal tract of goldfish (Carassius auratus using immunohistochemistry and in situ hybridization. Our second aim was to characterize possible daily variations of preproghrelin and ghs-r1 mRNA expression in central and peripheral tissues using real-time reverse transcription-quantitative PCR. Results show ghrelin expression and immunoreactivity in the gastrointestinal tract, with the most abundant signal observed in the mucosal epithelium. These are in agreement with previous findings on mucosal cells as the primary synthesizing site of ghrelin in goldfish. Ghrelin receptor was observed mainly in the hypothalamus with low expression in telencephalon, pineal and cerebellum, and in the same gastrointestinal areas as ghrelin. Daily rhythms in mRNA expression were found for preproghrelin and ghs-r1 in hypothalamus and pituitary with the acrophase occurring at nighttime. Preproghrelin, but not ghs-r1a, displayed a similar daily expression rhythm in the gastrointestinal tract with an amplitude 3-fold higher than the rest of tissues. Together, these results described for the first time in fish the mapping of preproghrelin and ghrelin receptor ghs-r1a in brain and gastrointestinal tract of goldfish, and provide the first evidence for a daily regulation

  19. GR SUMOylation and formation of an SUMO-SMRT/NCoR1-HDAC3 repressing complex is mandatory for GC-induced IR nGRE-mediated transrepression.

    Science.gov (United States)

    Hua, Guoqiang; Paulen, Laetitia; Chambon, Pierre

    2016-02-02

    Unique among the nuclear receptor superfamily, the glucocorticoid (GC) receptor (GR) can exert three distinct transcriptional regulatory functions on binding of a single natural (cortisol in human and corticosterone in mice) and synthetic [e.g., dexamethasone (Dex)] hormone. The molecular mechanisms underlying GC-induced positive GC response element [(+)GRE]-mediated activation of transcription are partially understood. In contrast, these mechanisms remain elusive for GC-induced evolutionary conserved inverted repeated negative GC response element (IR nGRE)-mediated direct transrepression and for tethered indirect transrepression that is mediated by DNA-bound NF-κB/activator protein 1 (AP1)/STAT3 activators and instrumental in GC-induced anti-inflammatory activity. We demonstrate here that SUMOylation of lysine K293 (mouse K310) located within an evolutionary conserved sequence in the human GR N-terminal domain allows the formation of a GR-small ubiquitin-related modifiers (SUMOs)-NCoR1/SMRT-HDAC3 repressing complex mandatory for GC-induced IR nGRE-mediated direct repression in vitro, but does not affect transactivation. Importantly, these results were validated in vivo: in K310R mutant mice and in mice ablated selectively for nuclear receptor corepressor 1 (NCoR1)/silencing mediator for retinoid or thyroid-hormone receptors (SMRT) corepressors in skin keratinocytes, Dex-induced direct repression and the formation of repressing complexes on IR nGREs were impaired, whereas transactivation was unaffected. In mice selectively ablated for histone deacetylase 3 (HDAC3) in skin keratinocytes, GC-induced direct repression, but not bindings of GR and of corepressors NCoR1/SMRT, was abolished, indicating that HDAC3 is instrumental in IR nGRE-mediated repression. Moreover, we demonstrate that the binding of HDAC3 to IR nGREs in vivo is mediated through interaction with SMRT/NCoR1. We also show that the GR ligand binding domain (LBD) is not required for SMRT

  20. Patterns of failure after postoperative radiotherapy for incompletely resected (R1) non-small cell lung cancer: implications for radiation target volume design.

    Science.gov (United States)

    Olszyna-Serementa, Marta; Socha, Joanna; Wierzchowski, Marek; Kępka, Lucyna

    2013-05-01

    Overall survival (OS) and pattern of failure in R1-resected non-small cell lung cancer (NSCLC) patients treated with 3D-planned postoperative radiotherapy (PORT) was retrospectively evaluated. The outcomes and patterns of failure in patients with (+) and without (-) extracapsular nodal extension (ECE) were compared and analyzed with respect to the radiation target volume design. Eighty R1-resected (37 ECE+ and 43 ECE-) patients received PORT (60Gy, 2Gy daily) between 2002 and 2011. Patients with N2 disease received limited elective nodal irradiation (ENI); for pN0-1 disease the use of ENI was optional. Among ECE- (extranodal-R1) patients there were 35 pN0-1 and eight pN2 cases; in pN0-1 patients, patterns of failure and outcomes were analyzed with respect to the use of ENI. Loco-regional failure (LRF) was defined as in-field relapse; isolated nodal failure (INF) was defined as out-of-field regional nodal recurrence occurring without LRF, irrespective of distant metastases. The actuarial 3-year OS rate was 36.3% (median: 30 months). Three-year OS rates in the ECE- and ECE+ group were 40.4% and 31.4%, with median OS of 31 and 24 months, respectively (p=0.43). In multivariate analysis, the presence of ECE was correlated with OS (HR=3.02; 95% CI: 1.00-9.16; p=0.05). Three-year cumulative incidence of LRF (CILRF) was 14.5% and 15.5% in the ECE- and ECE+ groups, respectively (p=0.98). Three-year cumulative incidence of INF (CIINF) was 14.1% in the ECE- group and 11.1% in the ECE+ group (p=0.76). For pN0-1 patients treated with and without ENI (13 and 22 patients) 3-year CILRF rates were 7.7% and 20.8%, respectively (p=0.20); 3-year CIINF rates were 9.1% and 16.3%, respectively (p=0.65). PORT resulted in a relatively good survival of R1-resected NSCLC patients. Relatively high incidence of INF was found in both ECE+ and ECE- patients. For ECE+ patients, treated with limited ENI, distant failure remains a major concern, so the design of ENI fields seems of lesser

  1. Essential Genes for In Vitro Growth of the Endophyte Herbaspirillum seropedicae SmR1 as Revealed by Transposon Insertion Site Sequencing.

    Science.gov (United States)

    Rosconi, Federico; de Vries, Stefan P W; Baig, Abiyad; Fabiano, Elena; Grant, Andrew J

    2016-11-15

    The interior of plants contains microorganisms (referred to as endophytes) that are distinct from those present at the root surface or in the surrounding soil. Herbaspirillum seropedicae strain SmR1, belonging to the betaproteobacteria, is an endophyte that colonizes crops, including rice, maize, sugarcane, and sorghum. Different approaches have revealed genes and pathways regulated during the interactions of H. seropedicae with its plant hosts. However, functional genomic analysis of transposon (Tn) mutants has been hampered by the lack of genetic tools. Here we successfully employed a combination of in vivo high-density mariner Tn mutagenesis and targeted Tn insertion site sequencing (Tn-seq) in H. seropedicae SmR1. The analysis of multiple gene-saturating Tn libraries revealed that 395 genes are essential for the growth of H. seropedicae SmR1 in tryptone-yeast extract medium. A comparative analysis with the Database of Essential Genes (DEG) showed that 25 genes are uniquely essential in H. seropedicae SmR1. The Tn mutagenesis protocol developed and the gene-saturating Tn libraries generated will facilitate elucidation of the genetic mechanisms of the H. seropedicae endophytic lifestyle. A focal point in the study of endophytes is the development of effective biofertilizers that could help to reduce the input of agrochemicals in croplands. Besides the ability to promote plant growth, a good biofertilizer should be successful in colonizing its host and competing against the native microbiota. By using a systematic Tn-based gene-inactivation strategy and massively parallel sequencing of Tn insertion sites (Tn-seq), it is possible to study the fitness of thousands of Tn mutants in a single experiment. We have applied the combination of these techniques to the plant-growth-promoting endophyte Herbaspirillum seropedicae SmR1. The Tn mutant libraries generated will enable studies into the genetic mechanisms of H. seropedicae-plant interactions. The approach that we

  2. Range Selection and Median

    DEFF Research Database (Denmark)

    Jørgensen, Allan Grønlund; Larsen, Kasper Green

    2011-01-01

    that supports queries in constant time, needs n1+ (1) space. For data structures that uses n logO(1) n space this matches the best known upper bound. Additionally, we present a linear space data structure that supports range selection queries in O(log k= log log n + log log n) time. Finally, we prove that any...

  3. Electric vehicles: Driving range

    Science.gov (United States)

    Kempton, Willett

    2016-09-01

    For uptake of electric vehicles to increase, consumers' driving-range needs must be fulfilled. Analysis of the driving patterns of personal vehicles in the US now shows that today's electric vehicles can meet all travel needs on almost 90% of days from a single overnight charge.

  4. Employment of MCNP in the study of TLDS 600 and 700 seeking the implementation of radiation beam characterization of BNCT facility at IEA-R1; Emprego do MCNP no estudo dos TLDS 600 e 700 visando a implementacao da caracterizacao do feixe de irradiacao da instalacao de BNCT do IEA-R1

    Energy Technology Data Exchange (ETDEWEB)

    Cavalieri, Tassio Antonio

    2013-07-01

    Boron Neutron Capture Therapy, BNCT, is a bimodal radiotherapy procedure for cancer treatment. Its useful energy comes from a nuclear reaction driven by impinging thermal neutron upon Boron 10 atoms. A BNCT research facility has been constructed in IPEN at the IEA-R1 reactor, to develop studies in this area. One of its prime experimental parameter is the beam dosimetry which is nowadays made by using activation foils, for neutron measurements, and TLD 400, for gamma dosimetry. For mixed field dosimetry, the International Commission on Radiation Units and Measurements, ICRU, recommends the use of pair of detectors with distinct responses to the field components. The TLD 600/ TLD 700 pair meets this criteria, as the amount of {sup 6}Li, a nuclide with high thermal neutron cross section, greatly differs in their composition. This work presents a series of experiments and simulations performed in order to implement the mixed field dosimetry based on the use of TLD 600/TLD 700 pair. It also intended to compare this mixed field dosimetric methodology to the one so far used by the BNCT research group of IPEN. The response of all TLDs were studied under irradiations in different irradiation fields and simulations, underwent by MCNP, were run in order to evaluate the dose contribution from each field component. Series of repeated irradiations under pure gamma field and mixed field neutron/gamma field showed differences in the TLD individual responses which led to the adoption of a Normalization Factor. It has allowed to overcome TLD selection. TLD responses due to different field components and spectra were studied. It has shown to be possible to evaluate the relative gamma/neutron fluxes from the relative responses observed in the two Regions of Interest, ROIs, from TLD 600 and TLD 700. It has also been possible to observe the TLD 700 response to neutron, which leads to a gamma dose overestimation when one follows the ICRU recommended mixed field dosimetric procedure. Dose

  5. Investigation of the electrical discharge parameters in electrodeless inductive lamps with a re-entrant coupler and magnetic core

    Science.gov (United States)

    Statnic, Eugen; Tanach, Valentin

    2006-08-01

    The inductively coupled fluorescent lamp with a cored induction coil placed in a re-entrant cavity is in fact a coaxial transformer operated in the radiofrequency range between 100 kHz and a few MHz. The magnetic coupling coefficient k between the primary coil and the plasma ring is relatively low because of the open magnetic circuit. The acting mutual inductance M enables us to quantify the interaction between the magnetic field produced by the primary coil current I1 and the opposing magnetic field produced by the powerful plasma current I2. A contra-electromotive force jωMI2 is induced in the induction coil L1, defining the primary voltage V1 = I1(R1 + jω L1) - jωMI2. The current I1 induces in the secondary conductive plasma the driving electromotive force jωMI1 supplying the secondary load consisting of the average plasma resistance R2 and the secondary inductance L2, according to the equation jωMI2 = I2(R2 + jωL2). It is the aim of this paper to find a model to determine k on the basis of the measured primary parameters V1, I1, P1, L1, R1 and finally all electrical inaccessible parameters, such as M, V2, I2, phiv2, L2, R2, in order to optimize the discharge and lamp efficacy. The complex characteristic of plasma inductance for this type of lamp is analysed and clarified. Some reflexive basic relations verifying the correctness of the inferred plasma parameters are also developed. The described experiments are related to a lamp working at about 2.6 MHz.

  6. Long-Range Order in β Brass

    DEFF Research Database (Denmark)

    Norvell, J.C.; Als-Nielsen, Jens Aage

    1970-01-01

    The long-range order parameter M of β brass has been determined from measurements of the intensity of superlattice reflections of Bragg-scattered neutrons. Over the whole temperature range T=300 °K to T=Tc=736 °K, the data are in remarkable agreement with the prediction for the compressible Ising...... bcc lattice with only nearest-neighbor interactions. © 1970 The American Physical Society...

  7. A copper-responsive gene cluster is required for copper homeostasis and contributes to oxidative resistance in Deinococcus radiodurans R1.

    Science.gov (United States)

    Zhao, Zhongchao; Zhou, Zhengfu; Li, Liang; Xian, Xianyi; Ke, Xiubin; Chen, Ming; Zhang, Yuxiu

    2014-10-01

    Excess copper is toxic to organisms, and therefore, copper homeostasis is important for the limitation of its cellular levels. However, copper homeostasis has not been studied to date in the bacteria Deinococcus radiodurans R1, which exhibits extreme resistance to various environmental stresses. We have identified a copper-responsive gene cluster that encodes CopA, which is a copper-transporting P1-type ATPase, CopZ, which is a copper metallochaperone, and CsoR, which is a copper-sensing repressor. Copper induces the transcription of genes in this cluster. Mutants lacking copA exhibited reduced copper resistance and the overaccumulation of copper compared with the wild-type strain. Additionally, both in the absence and presence of copper, the copZ mutation increased the expression of copA and led to the accumulation of lower levels of copper compared with the wild type. The bioinformatic analysis showed that CsoR in D. radiodurans R1 shares high sequence similarity and identity with the CsoR of Mycobacterium tuberculosis and Bacillus subtilis. We also demonstrated through DNase I footprinting and electrophoretic mobility shift assays that CsoR binds to the promoter of the cluster and that copper ions eliminate this interaction. This implies that CsoR is the repressor of this cluster and that CopA, CopZ and CsoR participate in the regulation of copper homeostasis. Our data also indicate that after treatment with H2O2 and cumene hydroperoxide, the viability of the copA mutants was significantly reduced. This suggests that copper homeostasis plays an important role in oxidative resistance in D. radiodurans R1.

  8. Arsenic sulfide promotes apoptosis in retinoid acid resistant human acute promyelocytic leukemic NB4-R1 cells through downregulation of SET protein.

    Directory of Open Access Journals (Sweden)

    Yuwang Tian

    Full Text Available Tetra-arsenic tetra-sulfide (As4S4 is an arsenic compound with anti-tumor activity, especially in acute promyelocytic leukemia (APL that are resistant to retinoic acid (RA. Although recent studies revealed that the therapeutic action of As4S4 is closely associated with the induction of cellular apoptosis, the exact molecular mechanism of action of As4S4 in RA-resistant APL remains to be clarified. In this study, we found that As4S4-induced apoptosis was accompanied by reduced mRNA and protein expression of SET gene in RA-resistant NB4-R1 cells. Moreover, RNAi knockdown of SET gene further promoted As4S4-induced apoptosis, while SET over-expression inhibited it, suggesting that As4S4 induces apoptosis through the reduction of SET protein in NB4-R1 cells. We also demonstrated that the knockdown of SET gene resulted in the upregulation of protein phosphatase 2 (PP2A expression and the downregulation of promyelocytic leukemia and retinoic acid receptor α fusion gene (PML-RARα expression, which were enhanced by As4S4 treatments. By contrast, over-expression of SET gene resulted in PP2A downregulation and PML-RARα upregulation, which were abolished by As4S4 pretreatment. Since PP2A is a pro-apoptotic factor and PMLRARα is an anti-apoptotic factor, our results suggest that As4S4-induced apoptosis in NB4-R1 cells is through the downregulation of SET protein expression, which in turn increases PP2A and reduces PML-RARα expressions to lead to cell apoptosis.

  9. Association of cord blood des-acyl ghrelin with birth weight, and placental GHS-R1 receptor expression in SGA, AGA, and LGA newborns.

    Science.gov (United States)

    González-Domínguez, Martha I; Lazo-de-la-Vega-Monroy, Maria-Luisa; Zaina, Silvio; Sabanero, Myrna; Daza-Benítez, Leonel; Malacara, Juan Manuel; Barbosa-Sabanero, Gloria

    2016-07-01

    Although ghrelin in cord blood has been associated to birth weight, its role in fetal and postnatal growth has not been elucidated. The aim of this study was to analyze total ghrelin, acyl ghrelin (AG), and des-acyl ghrelin (DAG) in cord blood of newborns with idiopathic birth weight alterations, and to evaluate protein expression of placental GHS-R1, in order to investigate their correlation with birth weight and placental weight. We performed a cross-sectional comparative study in umbilical cord blood and placentas from healthy mothers of SGA, AGA, and LGA (small, adequate and large for gestational age) term newborns (n = 20 per group). Cord blood total ghrelin, AG, and DAG were measured by ELISA, and placental GHS-R1 expression was evaluated by Western blot. Cord blood DAG was higher in SGA compared to AGA newborns (902.1 ± 109.1 and 597.4 ± 58.2 pg/ml, respectively, p = 0.01) while LGA and AGA showed similar values (627.2 ± 76.4 pg/ml for LGA, p = 0.80). DAG negatively correlated with birthweight (r = -0.31, p = 0.02) and placental weight (r = -0.33, p = 0.02). No differences in AG or total ghrelin were found. GHS-R1 protein in placenta was not differentially expressed among SGA, AGA, and LGA. Our results suggest a role of DAG in intrauterine growth. Further studies are needed in order to elucidate the mechanisms by which DAG participates in fetal growth.

  10. MRI and biomechanics multidimensional data analysis reveals R2 -R1ρ as an early predictor of cartilage lesion progression in knee osteoarthritis.

    Science.gov (United States)

    Pedoia, Valentina; Haefeli, Jenny; Morioka, Kazuhito; Teng, Hsiang-Ling; Nardo, Lorenzo; Souza, Richard B; Ferguson, Adam R; Majumdar, Sharmila

    2017-05-04

    To couple quantitative compositional MRI, gait analysis, and machine learning multidimensional data analysis to study osteoarthritis (OA). OA is a multifactorial disorder accompanied by biochemical and morphological changes in the articular cartilage, modulated by skeletal biomechanics and gait. While we can now acquire detailed information about the knee joint structure and function, we are not yet able to leverage the multifactorial factors for diagnosis and disease management of knee OA. We mapped 178 subjects in a multidimensional space integrating: demographic, clinical information, gait kinematics and kinetics, cartilage compositional T1ρ and T2 and R2 -R1ρ (1/T2 -1/T1ρ ) acquired at 3T and whole-organ magnetic resonance imaging score morphological grading. Topological data analysis (TDA) and Kolmogorov-Smirnov test were adopted for data integration, analysis, and hypothesis generation. Regression models were used for hypothesis testing. The results of the TDA showed a network composed of three main patient subpopulations, thus potentially identifying new phenotypes. T2 and T1ρ values (T2 lateral femur P = 1.45*10-8 , T1ρ medial tibia P = 1.05*10-5 ), the presence of femoral cartilage defects (P = 0.0013), lesions in the meniscus body (P = 0.0035), and race (P = 2.44*10-4 ) were key markers in the subpopulation classification. Within one of the subpopulations we observed an association between the composite metric R2 -R1ρ and the longitudinal progression of cartilage lesions. The analysis presented demonstrates some of the complex multitissue biochemical and biomechanical interactions that define joint degeneration and OA using a multidimensional approach, and potentially indicates that R2 -R1ρ may be an imaging biomarker for early OA. 3 J. Magn. Reson. Imaging 2017. © 2017 International Society for Magnetic Resonance in Medicine.

  11. Herpes Simplex Virus 1 (HSV-1) and HSV-2 Mediate Species-Specific Modulations of Programmed Necrosis through the Viral Ribonucleotide Reductase Large Subunit R1.

    Science.gov (United States)

    Yu, Xiaoliang; Li, Yun; Chen, Qin; Su, Chenhe; Zhang, Zili; Yang, Chengkui; Hu, Zhilin; Hou, Jue; Zhou, Jinying; Gong, Ling; Jiang, Xuejun; Zheng, Chunfu; He, Sudan

    2015-11-11

    Receptor-interacting protein kinase 3 (RIP3) and its substrate mixed-lineage kinase domain-like protein (MLKL) are core regulators of programmed necrosis. The elimination of pathogen-infected cells by programmed necrosis acts as an important host defense mechanism. Here, we report that human herpes simplex virus 1 (HSV-1) and HSV-2 had opposite impacts on programmed necrosis in human cells versus their impacts in mouse cells. Similar to HSV-1, HSV-2 infection triggered programmed necrosis in mouse cells. However, neither HSV-1 nor HSV-2 infection was able to induce programmed necrosis in human cells. Moreover, HSV-1 or HSV-2 infection in human cells blocked tumor necrosis factor (TNF)-induced necrosis by preventing the induction of an RIP1/RIP3 necrosome. The HSV ribonucleotide reductase large subunit R1 was sufficient to suppress TNF-induced necrosis, and its RIP homotypic interaction motif (RHIM) domain was required to disrupt the RIP1/RIP3 complex in human cells. Therefore, this study provides evidence that HSV has likely evolved strategies to evade the host defense mechanism of programmed necrosis in human cells. This study demonstrated that infection with HSV-1 and HSV-2 blocked TNF-induced necrosis in human cells while these viruses directly activated programmed necrosis in mouse cells. Expression of HSV R1 suppressed TNF-induced necrosis of human cells. The RHIM domain of R1 was essential for its association with human RIP3 and RIP1, leading to disruption of the RIP1/RIP3 complex. This study provides new insights into the species-specific modulation of programmed necrosis by HSV. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  12. IL-1α/IL-1R1 expression in chronic obstructive pulmonary disease and mechanistic relevance to smoke-induced neutrophilia in mice.

    Directory of Open Access Journals (Sweden)

    Fernando M Botelho

    Full Text Available BACKGROUND: Cigarette smoking is the main risk factor for the development of chronic obstructive pulmonary disease (COPD, a major cause of morbidity and mortality worldwide. Despite this, the cellular and molecular mechanisms that contribute to COPD pathogenesis are still poorly understood. METHODOLOGY AND PRINCIPAL FINDINGS: The objective of this study was to assess IL-1 α and β expression in COPD patients and to investigate their respective roles in perpetuating cigarette smoke-induced inflammation. Functional studies were pursued in smoke-exposed mice using gene-deficient animals, as well as blocking antibodies for IL-1α and β. Here, we demonstrate an underappreciated role for IL-1α expression in COPD. While a strong correlation existed between IL-1α and β levels in patients during stable disease and periods of exacerbation, neutrophilic inflammation was shown to be IL-1α-dependent, and IL-1β- and caspase-1-independent in a murine model of cigarette smoke exposure. As IL-1α was predominantly expressed by hematopoietic cells in COPD patients and in mice exposed to cigarette smoke, studies pursued in bone marrow chimeric mice demonstrated that the crosstalk between IL-1α+ hematopoietic cells and the IL-1R1+ epithelial cells regulates smoke-induced inflammation. IL-1α/IL-1R1-dependent activation of the airway epithelium also led to exacerbated inflammatory responses in H1N1 influenza virus infected smoke-exposed mice, a previously reported model of COPD exacerbation. CONCLUSIONS AND SIGNIFICANCE: This study provides compelling evidence that IL-1α is central to the initiation of smoke-induced neutrophilic inflammation and suggests that IL-1α/IL-1R1 targeted therapies may be relevant for limiting inflammation and exacerbations in COPD.

  13. Mild clinical and histopathological features in patients who carry the frequent and causative malignant hyperthermia RyR1 mutation p.Thr2206Met.

    Science.gov (United States)

    Rueffert, H; Wehner, M; Ogunlade, V; Meinecke, Cd; Schober, R

    2009-01-01

    Malignant hyperthermia (MH) is a classically unapparent pharmacogenetic disorder of the skeletal muscles triggered by inhalational anesthetics or depolarizing muscle relaxants. The disposition to MH is inherited in an autosomal-dominant manner and is primarily due to mutations in the gene for the ryanodine receptor type 1 (RyR1). The present study intended to analyze whether mild muscular symptoms (elevation of the resting CK, cramps in the calves, slight calf hypertrophy) may be associated with susceptibility to MH and/or with histopathological changes. A muscle biopsy was taken from 12 out of 44 blood relatives (three generations) of a large family and was investigated with the halothane/caffeine in vitro contracture test (IVCT). Afterwards a histological, histochemical and immunhistological examination was performed. Altogether in 29 persons the DNA was analyzed for mutations in the RyR1-gene. Eight persons were diagnosed as susceptible to MH (MHS) by the IVCT, 4 were MH negative. All MHS persons carried the MH causative c.6617C > T (Thr2206Met) mutation and showed slight clinical signs of a myopathy as well as mild biopsy changes with isolated hypotrophic fibers and disseminated small areas with reduction of oxidative staining (multi-minicore like lesions). The Thr2206Met mutation was identified in another further 9 relatives who also experienced mild myopathological features. Clinical MH incidents were not reported in this large family. The RyR1 Thr2206Met mutation is one of the most frequent mutations in the European MH population but carriers are normally healthy. In this study we could demonstrate that the MH causative Thr2206Met mutation may also be associated both with clinical symptoms of a mild myopathy and histopathological changes in the oxidative inter myofibrillar network.

  14. IL-1α/IL-1R1 Expression in Chronic Obstructive Pulmonary Disease and Mechanistic Relevance to Smoke-Induced Neutrophilia in Mice

    Science.gov (United States)

    Finch, Donna; Nikota, Jake K.; Zavitz, Caleb C. J.; Kelly, Ashling; Lambert, Kristen N.; Piper, Sian; Foster, Martyn L.; Goldring, James J. P.; Wedzicha, Jadwiga A.; Bassett, Jennifer; Bramson, Jonathan; Iwakura, Yoichiro; Sleeman, Matthew; Kolbeck, Roland; Coyle, Anthony J.; Humbles, Alison A.; Stämpfli, Martin R.

    2011-01-01

    Background Cigarette smoking is the main risk factor for the development of chronic obstructive pulmonary disease (COPD), a major cause of morbidity and mortality worldwide. Despite this, the cellular and molecular mechanisms that contribute to COPD pathogenesis are still poorly understood. Methodology and Principal Findings The objective of this study was to assess IL-1 α and β expression in COPD patients and to investigate their respective roles in perpetuating cigarette smoke-induced inflammation. Functional studies were pursued in smoke-exposed mice using gene-deficient animals, as well as blocking antibodies for IL-1α and β. Here, we demonstrate an underappreciated role for IL-1α expression in COPD. While a strong correlation existed between IL-1α and β levels in patients during stable disease and periods of exacerbation, neutrophilic inflammation was shown to be IL-1α-dependent, and IL-1β- and caspase-1-independent in a murine model of cigarette smoke exposure. As IL-1α was predominantly expressed by hematopoietic cells in COPD patients and in mice exposed to cigarette smoke, studies pursued in bone marrow chimeric mice demonstrated that the crosstalk between IL-1α+ hematopoietic cells and the IL-1R1+ epithelial cells regulates smoke-induced inflammation. IL-1α/IL-1R1-dependent activation of the airway epithelium also led to exacerbated inflammatory responses in H1N1 influenza virus infected smoke-exposed mice, a previously reported model of COPD exacerbation. Conclusions and Significance This study provides compelling evidence that IL-1α is central to the initiation of smoke-induced neutrophilic inflammation and suggests that IL-1α/IL-1R1 targeted therapies may be relevant for limiting inflammation and exacerbations in COPD. PMID:22163019

  15. Association of C5aR1genetic polymorphisms with coronary artery disease in a Han population in Xinjiang, China.

    Science.gov (United States)

    Zheng, Ying-Ying; Xie, Xiang; Ma, Yi-Tong; Yang, Yi-Ning; Fu, Zhen-Yan; Li, Xiao-Mei; Pan, Shuo; Adi, Dilare; Chen, Bang-Dang; Liu, Fen

    2015-04-18

    Complement 5a receptor (C5aR) was demonstrated a receptor of complement 5a (C5a) which is involved in many inflammatory diseases. The functional responses attributed to C5a results from its interaction with its receptors C5aR, which stimulates food intake, plays a role in increasing the inflammatory response in adipose tissue as well as the cardiovascular and neural systems. However, There are unknown associations between the SNPs of C5aR1 gene and coronary artery disease (CAD). We examined the role of the tagging single nucleotide polymorphisms (SNPs) of C5aR1 gene for CAD using a case-control design, and determined the prevalence of C5aR1 genotypes in 505 CAD patients and 469 age and sex-matched healthy control subjects of Han population. The rs10853784 was found to be associated with CAD in dominant model (CC vs TT + CT, P = 0.004). The difference remained statistically significant after multivariate adjustment (OR = 1.430, 95% CI: 1.087 ~ 1.882, P = 0.011). There was no significant difference in genotype distributions of rs4577202 and rs7250152 between CAD patients and control subjects. The frequency of the haplotype (A-T-C) was significantly higher in the CAD patients than in the controls (P = 0.035), and the haplotype (A-C-T) was significantly lower in the CAD patients than in the control subjects in Chinese Han population (P = 0.002). The results of this study indicate that rs10853784 of C5aR1 gene are associated with CAD in Han population of China, and A-C-T haplotypes may be protective genetic marker and the A-T-C may be risk genetic marker for CAD in Chinese Han population. The virtual slide(s) for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/2054871241495194 .

  16. Determination of 63Ni and 59Ni in spent ion-exchange resin and activated charcoal from the IEA-R1 nuclear research reactor.

    Science.gov (United States)

    Taddei, M H T; Macacini, J F; Vicente, R; Marumo, J T; Sakata, S K; Terremoto, L A A

    2013-07-01

    A radiochemical method has been adapted to determine (59)Ni and (63)Ni in samples of radioactive wastes from the water cleanup system of the IEA-R1 nuclear research reactor. The process includes extraction chromatographic resin with dimethylglyoxime (DMG) as a functional group. Activity concentrations of (59)Ni and (63)Ni were measured, respectively, by X-ray spectrometry and liquid scintillation counting, whereas the chemical yield was determined by ICP-OES. The average ratio of measured activity concentrations of (63)Ni and (59)Ni agree well with theory. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. Role of tyrosine 131 in the active site of paAzoR1, an azoreductase with specificity for the inflammatory bowel disease prodrug balsalazide.

    Science.gov (United States)

    Wang, Chan-Ju; Laurieri, Nicola; Abuhammad, Areej; Lowe, Edward; Westwood, Isaac; Ryan, Ali; Sim, Edith

    2010-01-01

    Azoreductase 1 from Pseudomonas aeruginosa strain PAO1 (paAzoR1) catalyses the activation of the prodrug balsalazide and reduces the azo dye methyl red using reduced nicotinamide adenine dinucleotide cofactor as an electron donor. To investigate the mechanism of the enzyme, a Y131F mutation was introduced and the enzymic properties of the mutant were compared with those of the wild-type enzyme. The crystallographic structure of the mutant with methyl red bound was solved at 2.1 A resolution and compared with the wild-type structure. Tyr131 is important in the architecture of the active site but is not essential for enzymic activity.

  18. Radiosensitization of the rats' rhabdomyosarcoma R 1 by chloronitroimidazole compound - P sub 40 dependent on radiation dose in fractionated radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Widel, M.; Watras, J. (Radiobiology Div. of Teleradiotherapy Dept., Centre of Oncology, Gliwice (Poland)); Suwinski, J.; Salwinska, E. (Inst. of Organic Chemistry and Technology, Silesian Polytechnical Univ., Gliwice (Poland))

    1990-01-01

    The radiosensitizing effectiveness of 1-/2-hydroxy-3-methoxy-propyl/2-chloro-4-nitromidazole (P{sub 40}) dependent on various fractionated schedules was tested in the rats' solid tumors, rhabdomyosarcoma R 1. P{sub 40} combined conventional fractionation of gamma rays exerted no radiosensitizing effect measured as local control and growth delay as well. In contrary, the significant sensitization has been noticed when nontoxic doses of the nitroimidazole were combined with higher (3.7Gy) doses of radiation. Low toxicity of P{sub 40} is encouraging for further experimental studies. (orig.).

  19. Association of alpha-amylase and the R1 protein with starch granules precedes the initiation of net starch degradation in turions of Spirodela polyrhiza.

    Science.gov (United States)

    Reimann, Rezarta; Ritte, Gerhard; Steup, Martin; Appenroth, Klaus-J

    2002-01-01

    In turions of Spirodela polyrhiza (L.) Schleiden, net degradation of storage starch is controlled by a special low fluence response of phytochrome requiring illumination for several days. This light effect has been used to study protein-starch interactions that occur prior to and during net degradation of starch. Following various pretreatments on S. polyrhiza turions, native starch granules were isolated and two fractions of starch-related proteins were distinguished: proteins enclosed within the starch particles (starch-internalized proteins) and those attached to the surface (starch-associated proteins). The pattern of starch-associated proteins as resolved by SDS-PAGE was more complex than that of starch-internalized proteins and varied depending upon the pretreatment of the turions. Two starch associated proteins were identified immunochemically as alpha-amylase (EC 3.2.1.1) and the R1 protein (Lorberth et al. (1998) Nature Biotechnology 16: 473-477). Dark-pretreatment of non-dormant turions does not induce starch net degradation. Under these conditions, alpha-amylase and R1 were bound to the surface of the starch granules. Continuous illumination with red light induces a rapid degradation of starch. Within the first 24 h of illumination the level of starch-associated alpha-amylase transiently increased and subsequently decreased rapidly. Similarly, the amount of the starch-associated R1 also decreased during illumination. The dissociation of both alpha-amylase and R1 from the starch granules preceded the decrease in starch content. However, binding of the two proteins to starch granules remained unchanged when the turions did not perform net starch degradation (as observed during continuous darkness, orthophosphate deficiency, or dormancy of the turions). Thus, during net starch degradation, so far unidentified changes are postulated to occur at the surface of the starch particles that are relevant for protein binding. This conclusion was supported by in

  20. TRAIL-induced apoptosis and expression of death receptor TRAIL-R1 and TRAIL-R2 in bladder cancer cells.

    Directory of Open Access Journals (Sweden)

    Zenon P Czuba

    2010-05-01

    Full Text Available Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL/Apo2L is a member of TNF superfamily able to induce programmed death in cancer cells with no toxicity against normal tissues. TRAIL mediate apoptosis follows binding to the two death receptors, TRAIL-R1 (DR4 and/or TRAIL-R2 (DR5. In this study we investigated the cytotoxic and apoptotic effect of TRAIL on bladder cancer cells and the expression of death receptor TRAIL-R1 and TRAIL-R2 on the surface of these cancer cells. Three human bladder transitional cancer cell (TCC lines - SW780, 647V and T24 were tested for TRAIL sensitivity. The bladder cancer cells were incubated with human soluble recombinant TRAIL. Cytotoxicity was measured by MTT (3-[4,5-dimethylthiazol-2-yl]-2,5-dimethyltetrazolium bromide and LDH (lactate dyhydrogenase assays. Apoptosis was detected by flow cytometry with annexin V-FITC/propidium iodide and by fluorescence microscopy with Hoechst 33342/annexin V-FITC/Ethidium Homodimer. The cell surface expression of TRAIL death receptors on bladder cancer were determined using flow cytometry with phycoerythrin-conjugated monoclonal anti-human TRAIL-R1 and TRAIL-R2. Our investigations confirmed that SW780 cells were sensitive to TRAIL, and two other bladder cancer cell lines, 647V and T24, were resistant to TRAIL induced apoptosis. We therefore examined the expression of TRAIL death receptors on bladder cancer cell surfaces. We showed decreased expression of TRAIL-R2 receptor in TRAIL-resistant bladder cancer cells and increased expression of this death receptor in TRAIL-sensitive SW780 cells. The expression of TRAILR1 receptor was similar in all bladder cancer cell lines. TRAIL is one of the promising candidates for cancer therapeutics. However, some cancer cells are resistant to TRAIL-mediated apoptosis. It is therefore important to overcome this resistance for the clinical use of TRAIL in cancer therapy. TRAIL death receptors are attractive therapeutic targets in

  1. Long-range antigravity

    Energy Technology Data Exchange (ETDEWEB)

    Macrae, K.I.; Riegert, R.J. (Maryland Univ., College Park (USA). Center for Theoretical Physics)

    1984-10-01

    We consider a theory in which fermionic matter interacts via long-range scalar, vector and tensor fields. In order not to be in conflict with experiment, the scalar and vector couplings for a given fermion must be equal, as is natural in a dimensionally reduced model. Assuming that the Sun is not approximately neutral with respect to these new scalar-vector charges, and if the couplings saturate the experimental bounds, then their strength can be comparable to that of gravity. Scalar-vector fields of this strength can compensate for a solar quadrupole moment contribution to Mercury's anomalous perihelion precession.

  2. Metasurfaces: Simultaneous Stokes parameters

    Science.gov (United States)

    Lepetit, Thomas; Kanté, Boubacar

    2015-11-01

    Techniques for determining Stokes parameters, which fully define the polarization state of a wave, require multiple measurements, thus potentially leading to inaccuracies. Researchers now show how to simultaneously determine the parameters for visible light using periodic metal structures.

  3. Online Sorted Range Reporting

    DEFF Research Database (Denmark)

    Brodal, Gerth Stølting; Fagerberg, Rolf; Greve, Mark

    2009-01-01

    We study the following one-dimensional range reporting problem: On an arrayA of n elements, support queries that given two indices i ≤ j and an integerk report the k smallest elements in the subarray A[i..j] in sorted order. We present a data structure in the RAM model supporting such queries...... in optimal O(k) time. The structure uses O(n) words of space and can be constructed in O(n logn) time. The data structure can be extended to solve the online version of the problem, where the elements in A[i..j] are reported one-by-one in sorted order, in O(1) worst-case time per element. The problem...... is motivated by (and is a generalization of) a problem with applications in search engines: On a tree where leaves have associated rank values, report the highest ranked leaves in a given subtree. Finally, the problem studied generalizes the classic range minimum query (RMQ) problem on arrays....

  4. Eddy current examination of the nuclear fuel elements with aluminum 1100-F cladding of IPR-R1 research reactor: An initial study

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Roger F. da; Silva Júnior, Silvério F. da; Frade, Rangel T. [Centro de Desenvolvimento da Tecnologia Nucelar (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Rodrigues, Juliano S., E-mail: rfs@cdtn.br, E-mail: silvasf@cdtn.br, E-mail: rtf@cdtn.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2017-07-01

    Tubes of aluminum 1100-F as well as tubes of AISI 304 stainless steel are used as cladding of the fuel elements of TRIGA IPR-R1 nuclear research reactor. Usually, these tubes are inspected by means of visual test and sipping test. The visual test allows the detection of changes occurred at the external fuel elements surface, such as those promoted by corrosion processes. However, this test method cannot be used for detection of internal discontinuities at the tube walls. Sipping test allows the detection of fuel elements whose cladding has failed, but it is not able to determine the place where the discontinuity is located. On the other hand, eddy current testing, an electromagnetic nondestructive test method, allows the detection of discontinuities and monitoring their growth. In previous works, the application of eddy current testing to evaluate the AISI 304 cladding fuel elements of TRIGA IPR-R1 was studied. In this paper, it is proposed an initial study about the use of eddy current testing for detection and characterization of discontinuities in the aluminum 1100-F fuel elements cladding. The study includes the development of probes and the design and manufacture of reference standards. (author)

  5. The HIV-1 envelope protein gp120 is captured and displayed for B cell recognition by SIGN-R1(+) lymph node macrophages.

    Science.gov (United States)

    Park, Chung; Arthos, James; Cicala, Claudia; Kehrl, John H

    2015-08-10

    The HIV-1 envelope protein gp120 is both the target of neutralizing antibodies and a major focus of vaccine efforts; however how it is delivered to B cells to elicit an antibody response is unknown. Here, we show that following local gp120 injection lymph node (LN) SIGN-R1(+) sinus macrophages located in interfollicular pockets and underlying SIGN-R1(+) macrophages form a cellular network that rapidly captures gp120 from the afferent lymph. In contrast, two other antigens, phycoerythrin and hen egg lysozyme, were not captured by these cells. Intravital imaging of mouse LNs revealed persistent, but transient interactions between gp120 bearing interfollicular network cells and both trafficking and LN follicle resident gp120 specific B cells. The gp120 specific, but not the control B cells repetitively extracted gp120 from the network cells. Our findings reveal a specialized LN antigen delivery system poised to deliver gp120 and likely other pathogen derived glycoproteins to B cells.

  6. Discovery of Western European R1b1a2 Y chromosome variants in 1000 genomes project data: an online community approach.

    Directory of Open Access Journals (Sweden)

    Richard A Rocca

    Full Text Available The authors have used an online community approach, and tools that were readily available via the Internet, to discover genealogically and therefore phylogenetically relevant Y-chromosome polymorphisms within core haplogroup R1b1a2-L11/S127 (rs9786076. Presented here is the analysis of 135 unrelated L11 derived samples from the 1000 Genomes Project. We were able to discover new variants and build a much more complex phylogenetic relationship for L11 sub-clades. Many of the variants were further validated using PCR amplification and Sanger sequencing. The identification of these new variants will help further the understanding of population history including patrilineal migrations in Western and Central Europe where R1b1a2 is the most frequent haplogroup. The fine-grained phylogenetic tree we present here will also help to refine historical genetic dating studies. Our findings demonstrate the power of citizen science for analysis of whole genome sequence data.

  7. The effects of pprI gene of Deinococcus radiodurans R1 on acute radiation injury of mice exposed to 60Co γ-ray radiation.

    Science.gov (United States)

    Chen, Ting-Ting; Hua, Wei; Zhang, Xi-Zhi; Wang, Bu-Hai; Yang, Zhan-Shan

    2017-01-10

    The role of the pprI gene from Deinococcus radiodurans R1 in therapy of acute radiation injury of a mammalian host was investigated. We injected a plasmid containing the pprI gene into the muscle of mice exposed to total 6Gy of 60Co γ-ray radiation. After injection, we used in vivo gene electroporation technology to transfer the pprI gene into the cell. We found the PprI protein was expressed significantly at 1 d after irradiation, but there was no expression of pprI gene 7 d post-irradiation. The expression of pprI gene evidently decreased the death rate of mice exposed to lethal dose radiation, significantly relieved effects on blood cells in the acute stage, shortened the persistence time of the decrease of lymphocytes, and decreased the apoptotic rates of spleen cells, thymocytes and bone marrow cells. The expression of Rad51 protein in the lungs, livers, and kidneys was significantly higher in the mice treated with the pprI plasmid after irradiation. However, there were no obvious differences for Rad52 protein expression. We conclude that the prokaryotic pprI gene of D. radiodurans R1 first was expressed in mammalian cells. The expressed prokaryotic PprI protein has distinct effects of the prevention and treatment on acute radiation injury of mammal. The effects of radio-resistance may relate to expression of Rad51 protein which is homologous with RecA from D. radiodurans.

  8. Enhancing the Reliability of GPCR Models by Accounting for Flexibility of Their Pro-Containing Helices: the Case of the Human mAChR1 Receptor.

    Science.gov (United States)

    Pedretti, Alessandro; Mazzolari, Angelica; Ricci, Chiara; Vistoli, Giulio

    2015-04-01

    To better investigate the GPCR structures, we have recently proposed to explore their flexibility by simulating the bending of their Pro-containing TM helices so generating a set of models (the so-called chimeras) which exhaustively combine the two conformations (bent and straight) of these helices. The primary objective of the study is to investigate whether such an approach can be exploited to enhance the reliability of the GPCR models generated by distant templates. The study was focused on the human mAChR1 receptor for which a presumably reliable model was generated using the congener mAChR3 as the template along with a second less reliable model based on the distant β2-AR template. The second model was then utilized to produce the chimeras by combining the conformations of its Pro-containing helices (i.e., TM4, TM5, TM6 and TM7 with 16 modeled chimeras). The reliability of such chimeras was assessed by virtual screening campaigns as evaluated using a novel skewness metric where they surpassed the predictive power of the more reliable mAChR1 model. Finally, the virtual screening campaigns emphasize the opportunity of synergistically combining the scores of more chimeras using a specially developed tool which generates highly predictive consensus functions by maximizing the corresponding enrichment factors. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Algunas representaciones de la función hipergeométrica generalizada 2R1 (a, b; c; τ ; z

    Directory of Open Access Journals (Sweden)

    Jaime Castillo Pérez

    2006-01-01

    Full Text Available El campo de las funciones especiales ha tenido un gran desarrollo en los últimos decenios, dado que son muchos campos de aplicación de las mismas, como por ejemplo procesos estocásticos relacionados, investigación de operaciones, teoría cuántica, ecuaciones funcionales, vibración de placas, conducción del calor, elasticidad, radiación. En este trabajo se considera una ampliación de las teorías presentadas por M. Dotsenko en 1991, quien introdujo la generalización de la función hipergeométrica de Gauss denotada τ por 2 R1 (z, y estableció su representación en serie e integral. Es importante notar que en 1999 Nina Virchenko, y luego en el 2003 Leda Galué, consideraron esta función introduciendo un conjunto de fórmulas de recurrencia y de diferenciación. En este trabajo se establecen algunas representaciones para la función 2 R1 (a, b; c; τ ; z, las cuales serán muy útiles puesto que permiten simplificar cálculos a la hora de resolver problemas que involucren esta función.

  10. Tinman/Nkx2-5 acts via miR-1 and upstream of Cdc42 to regulate heart function across species

    Science.gov (United States)

    Wythe, Joshua D.; Liu, Jiandong; Cartry, Jerome; Vogler, Georg; Mohapatra, Bhagyalaxmi; Otway, Robyn T.; Huang, Yu; King, Isabelle N.; Maillet, Marjorie; Zheng, Yi; Crawley, Timothy; Taghli-Lamallem, Ouarda; Semsarian, Christopher; Dunwoodie, Sally; Winlaw, David; Harvey, Richard P.; Fatkin, Diane; Towbin, Jeffrey A.; Molkentin, Jeffery D.; Srivastava, Deepak; Ocorr, Karen; Bruneau, Benoit G.

    2011-01-01

    Unraveling the gene regulatory networks that govern development and function of the mammalian heart is critical for the rational design of therapeutic interventions in human heart disease. Using the Drosophila heart as a platform for identifying novel gene interactions leading to heart disease, we found that the Rho-GTPase Cdc42 cooperates with the cardiac transcription factor Tinman/Nkx2-5. Compound Cdc42, tinman heterozygous mutant flies exhibited impaired cardiac output and altered myofibrillar architecture, and adult heart–specific interference with Cdc42 function is sufficient to cause these same defects. We also identified K+ channels, encoded by dSUR and slowpoke, as potential effectors of the Cdc42–Tinman interaction. To determine whether a Cdc42–Nkx2-5 interaction is conserved in the mammalian heart, we examined compound heterozygous mutant mice and found conduction system and cardiac output defects. In exploring the mechanism of Nkx2-5 interaction with Cdc42, we demonstrated that mouse Cdc42 was a target of, and negatively regulated by miR-1, which itself was negatively regulated by Nkx2-5 in the mouse heart and by Tinman in the fly heart. We conclude that Cdc42 plays a conserved role in regulating heart function and is an indirect target of Tinman/Nkx2-5 via miR-1. PMID:21690310

  11. TRAIL and DcR1 Expressions Are Differentially Regulated in the Pancreatic Islets of STZ- versus CY-Applied NOD Mice

    Directory of Open Access Journals (Sweden)

    Ercument Dirice

    2011-01-01

    Full Text Available TNF-related apoptosis-inducing ligand (TRAIL is an important component of the immune system. Although it is well acknowledged that it also has an important role in Type 1 Diabetes (T1D development, this presumed role has not yet been clearly revealed. Streptozotocin (STZ and Cyclophosphamide (CY are frequently used agents for establishment or acceleration of T1D disease in experimental models, including the non-obese diabetic (NOD mice. Although such disease models are very suitable for diabetes research, different expression patterns for various T1D-related molecules may be expected, depending on the action mechanism of the applied agent. We accelerated diabetes in female NOD mice using STZ or CY and analyzed the expression profiles of TRAIL ligand and receptors throughout disease development. TRAIL ligand expression followed a completely different pattern in STZ- versus CY-accelerated disease, displaying a prominent increase in the former, while appearing at reduced levels in the latter. Decoy receptor 1 (DcR1 expression also increased significantly in the pancreatic islets in STZ-induced disease. Specific increases observed in TRAIL ligand and DcR1 expressions may be part of a defensive strategy of the beta islets against the infiltrating leukocytes, while the immune-suppressive agent CY may partly hold down this defense, contributing further to diabetes development.

  12. The HIV-1 envelope protein gp120 is captured and displayed for B cell recognition by SIGN-R1+ lymph node macrophages

    Science.gov (United States)

    Park, Chung; Arthos, James; Cicala, Claudia; Kehrl, John H

    2015-01-01

    The HIV-1 envelope protein gp120 is both the target of neutralizing antibodies and a major focus of vaccine efforts; however how it is delivered to B cells to elicit an antibody response is unknown. Here, we show that following local gp120 injection lymph node (LN) SIGN-R1+ sinus macrophages located in interfollicular pockets and underlying SIGN-R1+ macrophages form a cellular network that rapidly captures gp120 from the afferent lymph. In contrast, two other antigens, phycoerythrin and hen egg lysozyme, were not captured by these cells. Intravital imaging of mouse LNs revealed persistent, but transient interactions between gp120 bearing interfollicular network cells and both trafficking and LN follicle resident gp120 specific B cells. The gp120 specific, but not the control B cells repetitively extracted gp120 from the network cells. Our findings reveal a specialized LN antigen delivery system poised to deliver gp120 and likely other pathogen derived glycoproteins to B cells. DOI: http://dx.doi.org/10.7554/eLife.06467.001 PMID:26258881

  13. The Production of Benzaldehyde by Rhizopus oligosporus USM R1 in a Solid State Fermentation (SSF System of Soy Bean Meal: Rice Husks

    Directory of Open Access Journals (Sweden)

    Norliza, A. W.

    2005-01-01

    Full Text Available The cultivation of Rhizopus oligosporus USM R1 for the production of benzaldehyde, a bitter cherry almond flavour was performed using soya bean meal and rice husks as the substrates. The identification of R. oligosporus USM R1 was performed based on the observation made under light microscope and scanning electron microscope (SEM. The optimum conditions for the SSF in a 250-ml Erlenmeyer flask system were 40% (v/w water content, substrate particle size of 0.7 mm; inoculum size of 1 x 10^5 spores/g substrate; incubation temperature of 30C; substrate amount of 7 g and the ratio of soy bean meal: rice husks of 50:50%. A maximum benzaldehyde production was obtained when the substrate was agitated after 48 hour for a 96 hour fermentation time. The highest benzaldehyde production obtained after 96 hour cultivation was 5.47 mg g-1 substrate. The supplementation of carbon and nitrogen sources in the substrate mixture revealed an enhancement in the growth and benzyldehyde production. A maximum production of benzaldehyde was obtained with the supplementation of L-phenylalanine, a precursor for benzaldehyde biosynthesis which gave 38.69 mg benzaldehyde/g substrate. This is approximately 6-folds higher compared to the substrates without the supplementation of L-phenylalanine.

  14. GUEI G. R.-1.mdi

    African Journals Online (AJOL)

    lara

    characteristics. Those ones could be exploited for extending present yield levels. ... determine the magnitude of genetic variation in our gene-bank. ..... liais on (D cla/D m ax. *10) et re g rou pem ent de 80 g éno ty p e. s d e riz s u r la base de le u rs attrib u ts m o rp holo g iq ues et phén olo g iq ues M b é. , Cô te d'Iv oire.

  15. Lightning detection and ranging

    Science.gov (United States)

    Lennon, C. L.; Poehler, H. A.

    1982-01-01

    A lightning detector and ranging (LDAR) system developed at the Kennedy Space Center and recently transferred to Wallops Island is described. The system detects pulsed VHF signals due to electrical discharges occurring in a thunderstorm by means of 56-75 MHz receivers located at the hub and at the tips of 8 km radial lines. Incoming signals are transmitted by wideband links to a central computing facility which processes the times of arrival, using two independent calculations to determine position in order to guard against false data. The results are plotted on a CRT display, and an example of a thunderstorm lightning strike detection near Kennedy Space Center is outlined. The LDAR correctly identified potential ground strike zones and additionally provided a high correlation between updrafts and ground strikes.

  16. Lumped-parameter models

    DEFF Research Database (Denmark)

    Ibsen, Lars Bo; Liingaard, Morten

    A lumped-parameter model represents the frequency dependent soil-structure interaction of a massless foundation placed on or embedded into an unbounded soil domain. The lumped-parameter model development have been reported by (Wolf 1991b; Wolf 1991a; Wolf and Paronesso 1991; Wolf and Paronesso 1992......; Wolf 1994; Wolf 1997; Wu and Lee 2002; Wu and Lee 2004). In this technical report the the steps of establishing a lumped-parameter model are presented. Following sections are included in this report: Static and dynamic formulation (Section 1.1), Simple lumped-parameter models (Section 1.2) and Advanced...... lumped-parameter models (Section 1.3)....

  17. mGluR1, but not mGluR5, activates feed-forward inhibition in the medial prefrontal cortex to impair decision making

    Science.gov (United States)

    Sun, Hao

    2011-01-01

    Cognitive flexibility depends on the integrity of the prefrontal cortex (PFC). We showed previously that impaired decision making in pain results from amygdala-driven inhibition of medial PFC neurons, but the underlying mechanisms remain to be determined. Using whole cell patch clamp in rat brain slices and a cognitive behavioral task, we tested the hypothesis that group I metabotropic glutamate receptors (mGluRs) activate feed-forward inhibition to decrease excitability and output function of PFC pyramidal cells, thus impairing decision making. Polysynaptic inhibitory postsynaptic currents (IPSCs) and monosynaptic excitatory postsynaptic currents (EPSCs) were evoked in layer V pyramidal cells by stimulating presumed amygdala afferents. An mGluR1/5 agonist [(S)-3,5-dihydroxyphenylglycine, DHPG] increased synaptic inhibition more strongly than excitatory transmission. The facilitatory effects were blocked by an mGluR1 [(S)-(+)-α-amino-4-carboxy-2-methylbenzeneacetic acid, LY367385], but not mGluR5, antagonist, 3-[(2-methyl-1,3-thiazol-4-yl)ethynyl]pyridine. IPSCs were blocked by bicuculline and decreased by 2,3-dioxo-6-nitro-1,2,3,4-tetrahydrobenzo[f]quinoxaline-7-sulfonamide disodium salt (NBQX). Facilitation of synaptic inhibition by DHPG was glutamate driven because it was blocked by NBQX. DHPG increased frequency but not amplitude of spontaneous IPSCs; consistent with action potential-dependent synaptic inhibition, tetrodotoxin (TTX) prevented the facilitatory effects. DHPG decreased synaptically evoked spikes (E-S coupling) and depolarization-induced spiking [frequency-current (f-I) relationship]. This effect was indirect, resulting from glutamate-driven synaptic inhibition, because it persisted when a G protein blocker was included in the pipette but was blocked by GABAA receptor antagonists and NBQX. In contrast, DHPG increased E-S coupling and f-I relationships in mPFC interneurons through a presynaptic action, further supporting the concept of feed

  18. Efficient anti-Prelog enantioselective reduction of acetyltrimethylsilane to (R-1-trimethylsilylethanol by immobilized Candida parapsilosis CCTCC M203011 cells in ionic liquid-based biphasic systems

    Directory of Open Access Journals (Sweden)

    Zhang Bo-Bo

    2012-08-01

    Full Text Available Abstract Background Biocatalytic asymmetric reductions with whole cells can offer high enantioselectivity, environmentally benign processes and energy-effective operations and thus are of great interest. The application of whole cell-mediated bioreduction is often restricted if substrate and product have low water solubility and/or high toxicity to the biocatalyst. Many studies have shown that a biphasic system is often useful in this instance. Hence, we developed efficient biphasic reaction systems with biocompatible water-immiscible ionic liquids (ILs, to improve the biocatalytic anti-Prelog enantioselective reduction of acetyltrimethylsilane (ATMS to (R-1-trimethylsilylethanol {(R-1-TMSE}, which is key synthon for a large number of silicon-containing drugs, using immobilized Candida parapsilosis CCTCC M203011 cells as the biocatalyst. Results It was found that the substrate ATMS and the product 1-TMSE exerted pronounced toxicity to immobilized Candida parapsilosis CCTCC M203011 cells. The biocompatible water-immiscible ILs can be applied as a substrate reservoir and in situ extractant for the product, thus greatly enhancing the efficiency of the biocatalytic process and the operational stability of the cells as compared to the IL-free aqueous system. Various ILs exerted significant but different effects on the bioreduction and the performances of biocatalysts were closely related to the kinds and combination of cation and anion of ILs. Among all the water-immiscible ILs investigated, the best results were observed in 1-butyl-3-methylimidazolium hexafluorophosphate (C4mim·PF6/buffer biphasic system. Furthermore, it was shown that the optimum substrate concentration, volume ratio of buffer to IL, buffer pH, reaction temperature and shaking rate for the bioreduction were 120 mM, 8/1 (v/v, 6.0, 30°C and 180 r/min, respectively. Under these optimized conditions, the initial reaction rate, the maximum yield and the product e.e. were 8.1

  19. Low-Frequency Synonymous Coding Variation in CYP2R1 Has Large Effects on Vitamin D Levels and Risk of Multiple Sclerosis.

    Science.gov (United States)

    Manousaki, Despoina; Dudding, Tom; Haworth, Simon; Hsu, Yi-Hsiang; Liu, Ching-Ti; Medina-Gómez, Carolina; Voortman, Trudy; van der Velde, Nathalie; Melhus, Håkan; Robinson-Cohen, Cassianne; Cousminer, Diana L; Nethander, Maria; Vandenput, Liesbeth; Noordam, Raymond; Forgetta, Vincenzo; Greenwood, Celia M T; Biggs, Mary L; Psaty, Bruce M; Rotter, Jerome I; Zemel, Babette S; Mitchell, Jonathan A; Taylor, Bruce; Lorentzon, Mattias; Karlsson, Magnus; Jaddoe, Vincent V W; Tiemeier, Henning; Campos-Obando, Natalia; Franco, Oscar H; Utterlinden, Andre G; Broer, Linda; van Schoor, Natasja M; Ham, Annelies C; Ikram, M Arfan; Karasik, David; de Mutsert, Renée; Rosendaal, Frits R; den Heijer, Martin; Wang, Thomas J; Lind, Lars; Orwoll, Eric S; Mook-Kanamori, Dennis O; Michaëlsson, Karl; Kestenbaum, Bryan; Ohlsson, Claes; Mellström, Dan; de Groot, Lisette C P G M; Grant, Struan F A; Kiel, Douglas P; Zillikens, M Carola; Rivadeneira, Fernando; Sawcer, Stephen; Timpson, Nicholas J; Richards, J Brent

    2017-08-03

    Vitamin D insufficiency is common, correctable, and influenced by genetic factors, and it has been associated with risk of several diseases. We sought to identify low-frequency genetic variants that strongly increase the risk of vitamin D insufficiency and tested their effect on risk of multiple sclerosis, a disease influenced by low vitamin D concentrations. We used whole-genome sequencing data from 2,619 individuals through the UK10K program and deep-imputation data from 39,655 individuals genotyped genome-wide. Meta-analysis of the summary statistics from 19 cohorts identified in CYP2R1 the low-frequency (minor allele frequency = 2.5%) synonymous coding variant g.14900931G>A (p.Asp120Asp) (rs117913124[A]), which conferred a large effect on 25-hydroxyvitamin D (25OHD) levels (-0.43 SD of standardized natural log-transformed 25OHD per A allele; p value = 1.5 × 10-88). The effect on 25OHD was four times larger and independent of the effect of a previously described common variant near CYP2R1. By analyzing 8,711 individuals, we showed that heterozygote carriers of this low-frequency variant have an increased risk of vitamin D insufficiency (odds ratio [OR] = 2.2, 95% confidence interval [CI] = 1.78-2.78, p = 1.26 × 10-12). Individuals carrying one copy of this variant also had increased odds of multiple sclerosis (OR = 1.4, 95% CI = 1.19-1.64, p = 2.63 × 10-5) in a sample of 5,927 case and 5,599 control subjects. In conclusion, we describe a low-frequency CYP2R1 coding variant that exerts the largest effect upon 25OHD levels identified to date in the general European population and implicates vitamin D in the etiology of multiple sclerosis. Copyright © 2017 American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  20. [Intra- and intermolecular recombination of test plasmids in K12 Escherichia coli cells carrying an RTF derivative of the R1drd-19 plasmid].

    Science.gov (United States)

    Terent'ev, M A; Chenin, L S

    1989-03-01

    The RTF derivative of the plasmid R1drd-19 was found to stimulate recombination of the tester plasmids in a recB mutant of Escherichia coli K12. The frequency of intramolecular recombination is increased 3.5 and 20-fold, as compared to the one in rec+ and rec- strains, respectively. The frequency of interplasmid recombination is enhanced 4 and 9-fold, respectively. Considerable heterogeneity of the recombination products of the tester plasmid intramolecular recombination in recB-/RTFR1-19 strain has been revealed. It is hypothesized that a "recombinase" encoded by Rldrd-19 plasmid determines a new minor pathway in recB- (Rec P) which differs in activity and, perhaps substrate specificity from the main Rec BCD pathway.

  1. Decoloración de aguas residuales textiles utilizando el hongo ligninolítico anamorfo R1 de Bjerkandera sp.

    OpenAIRE

    Juliana Osorio Echavarría; Ana Isabel Vidal Benavides; Juan Carlos Quintero Díaz

    2011-01-01

    Se evaluó la decoloración de aguas residuales sintéticas y reales de la industria textil empleando el hongo de la pudrición blanca de la madera anamorfo R1 de Bjerkandera sp. Se analizó el efecto de la presencia de las sales NaCl y Na2CO3, de la concentración del agua residual y de la esterilización, sobre el grado de decoloración. También se evaluó el efecto de la decoloración sobre la toxicidad frente a la bacteria bioluminiscente Vibrio fischeri. Los resultados demostraron que la presencia...

  2. Absolute structure determination of (2R,1prime;S)-2-(1prime;-benzyl-2$prime;-hydroxyethylamino)-4-phenylbutanoic acid

    Science.gov (United States)

    Berkeš, D.; Kolarovič, A.; Raptis, R. G.; Baran, P.

    2004-07-01

    Crystallization-induced asymmetric transformation was employed to prepare a labile γ-oxo-α-aminoacid ( 3) with a new stereogenic center in high diastereomeric and enantiomeric purity. Compound 3 was reduced to a stable compound, (2 R,1' S)-2-(1'-benzyl-2'-hydroxyethylamino)-4-phenylbutanoic acid ( 4), which crystallizes in space group P2 1. Upon deprotonation, 4 becomes a tridentate monoanionic chelating ligand, 4-H, which reacts with copper nitrate yielding [Cu( 4-H)(H 2O) 2]NO 3·H 2O ( 5). Complex 5 crystallizes in space group P2 1 and has a rare composition among crystallographically characterized mononuclear five-coordinate transition metal complexes. The absolute structure determination of 5 allowed by inference the assignment of absolute configuration to compound 3.

  3. Neuroprotective effect of β-asarone against Alzheimer’s disease: regulation of synaptic plasticity by increased expression of SYP and GluR1

    Directory of Open Access Journals (Sweden)

    Liu SJ

    2016-04-01

    Full Text Available Si-jun Liu,1,* Cong Yang,2,* Yue Zhang,2,* Ru-yu Su,2 Jun-li Chen,2 Meng-meng Jiao,2 Hui-fang Chen,2 Na Zheng,2 Si Luo,2 Yun-bo Chen,2 Shi-jian Quan,1 Qi Wang21School of Chinese Materia Medica, 2Institute of Clinical Pharmacology, Guangzhou University of Chinese Medicine, Guangzhou, People’s Republic of China*These authors contributed equally to this workAim: β-asarone, an active component of Acori graminei rhizome, has been reported to have neuroprotective effects in Alzheimer’s disease. As the underlying mechanism is not known, we investigated the neuroprotective effects of β-asarone in an APP/PS1 double transgenic mouse model and in NG108 cells.Materials and methods: APPswe/PS1dE9 double transgenic male mice were randomly assigned to a model group, β-asarone treatment groups (21.2, 42.4, or 84.8 mg/kg/d, or donepezil treatment group (2 mg/kg/d. Donepezil treatment was a positive control, and background- and age-matched wild-type B6 mice were an external control group. β-asarone (95.6% purity was dissolved in 0.8% Tween 80 and administered by gavage once daily for 2.5 months. Control and model animals received an equal volume of vehicle. After 2.5 months of treatment, behavior of all animals was evaluated in a Morris water maze. Expression of synaptophysin (SYP and glutamatergic receptor 1 (G1uR1 in the hippocampus and cortex of the double transgenic mice was assayed by Western blotting. The antagonistic effects of β-asarone against amyloid-β peptide (Aβ were investigated in vitro in the NG108-15 cell line. After 24 hours of incubation, cells were treated with 10 µm Aβ with or without β-asarone at different concentrations (6.25, 12.5, or 25 µM for an additional 36 hours. The cytotoxicity of β-asarone was evaluated by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide assay of cell viability, and cell morphology was evaluated by bright-field microscopy after 24 hours of treatment. The expression of SYP and GluR1 in

  4. r-1,t-2,3,c-4-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene in humanurine: A potential biomarker for assessing polycyclic aromatic hydrocarbon metabolic activation

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, S.S.; Chen, M.L.; Yagi, H.; Jerina, D.M.; Carmella, S.G. [University of Minnesota, Minneapolis, MN (United States)

    2003-12-01

    Carcinogen metabolite phenotyping is proposed as a more reliable way to determinethe role of host metabolism in PAH-related cancer. Phenanthrene,is the simplest PAH with a bay region and is metabolized to diol epoxides by the same enzymes and with the same stereochemistry as the prototypic carcinogenic PAH, benzo(a)pyrene. The major end product of this metabolic activation pathway is r-1,t-2,3,c-4-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene (trans, anti-PheT). We have developed a method for the analysis of trans, anti-PheT in human urine. r-1,t-2,4,c-3,-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene (trans,syn-PheT) was used as internal standard. After hydrolysis by beta-glucuronidase and sulfatase, solid phase extraction, and high-performance liquid chromatography collection, the sample was silylated and analyzed by gas chromatography-negative ion chemical ionization-mass spectrometry-selected ion monitoring. Thechromatograms were clean and trans, anti-PheT was detected in all human urine samples. Levels of trans, anti-PheT were 791 {+-} 363 pmol/mg creatinine (n = 20) in psoriasis patients treated with a PAH-containing ointment, 25.7 {+-} 16.8 pmol/mg creatinine (n = 32) in coke oven workers exposed to PAH, 4.58 {+-} 2.95 pmol/mg creatinine (n = 31) in smokers, and 1.51 {+-} 1.15 pmol/mg creatinine (n = 30) in nonsmokers. Levels of trans, anti-PheT correlated with levels of 1-hydroxypyrene in the urine of coke oven workers, smokers, and nonsmokers. Trans, anti-PheT appears to be an excellent biomarker of PAH uptake. Levels of trans, anti-PheT were 8,000-19,000 times higher than those can be detected in human urine.

  5. Glucocorticoid-induced tethered transrepression requires SUMOylation of GR and formation of a SUMO-SMRT/NCoR1-HDAC3 repressing complex.

    Science.gov (United States)

    Hua, Guoqiang; Ganti, Krishna Priya; Chambon, Pierre

    2016-02-02

    Upon binding of a glucocorticoid (GC), the GC receptor (GR) can exert one of three transcriptional regulatory functions. We recently reported that SUMOylation of the GR at position K293 in humans (K310 in mice) within the N-terminal domain is indispensable for GC-induced evolutionary conserved inverted repeated negative GC response element (IR nGRE)-mediated direct transrepression. We now demonstrate that the integrity of this GR SUMOylation site is mandatory for the formation of a GR-small ubiquitin-related modifiers (SUMOs)-SMRT/NCoR1-HDAC3 repressing complex, which is indispensable for NF-κB/AP1-mediated GC-induced tethered indirect transrepression in vitro. Using GR K310R mutant mice or mice containing the N-terminal truncated GR isoform GRα-D3 lacking the K310 SUMOylation site, revealed a more severe skin inflammation than in WT mice. Importantly, cotreatment with dexamethasone (Dex) could not efficiently suppress a 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced skin inflammation in these mutant mice, whereas it was clearly decreased in WT mice. In addition, in mice selectively ablated in skin keratinocytes for either nuclear receptor corepressor 1 (NCoR1)/silencing mediator for retinoid or thyroid-hormone receptors (SMRT) corepressors or histone deacetylase 3 (HDAC3), Dex-induced tethered transrepression and the formation of a repressing complex on DNA-bound NF-κB/AP1 were impaired. We previously suggested that GR ligands that would lack both (+)GRE-mediated transactivation and IR nGRE-mediated direct transrepression activities of GCs may preferentially exert the therapeutically beneficial GC antiinflammatory properties. Interestingly, we now identified a nonsteroidal antiinflammatory selective GR agonist (SEGRA) that selectively lacks both Dex-induced (+)GRE-mediated transactivation and IR nGRE-mediated direct transrepression functions, while still exerting a tethered indirect transrepression activity and could therefore be clinically lesser

  6. DdrA, DdrD, and PprA: components of UV and mitomycin C resistance in Deinococcus radiodurans R1.

    Science.gov (United States)

    Selvam, Kathiresan; Duncan, Jana R; Tanaka, Masashi; Battista, John R

    2013-01-01

    Mutants created by deleting the ddrA, ddrB, ddrC, ddrD, and pprA loci of Deinococcus radiodurans R1alone and in all possible combinations of pairs revealed that the encoded gene products contribute to this species' resistance to UV light and/or mitomycin C. Deleting pprA from an otherwise wild type cell sensitizes the resulting strain to UV irradiation, reducing viability by as much as eight fold relative to R1. If this deletion is introduced into a ΔddrA or ΔddrD background, the resulting strains become profoundly sensitive to the lethal effects of UV light. At a fluence of 1000 Jm⁻², the ΔddrA ΔpprA and ΔddrD ΔpprA strains are 100- and 1000-fold more sensitive to UV relative to the strain that has only lost pprA. Deletion of ddrA results in a 100 fold increase in strain sensitivity to mitomycin C, but in backgrounds that combine a deletion of ddrA with deletions of either ddrC or ddrD, mitomycin resistance is restored to wild type levels. Inactivation of ddrB also increases D. radiodurans sensitivity to mitomycin, but unlike the ddrA mutant deleting ddrC or ddrD from a ΔddrB background further increases that sensitivity. Despite the effect that loss of these gene products has on DNA damage resistance, none appear to directly affect either excision repair or homologous recombination suggesting that they participate in novel processes that facilitate tolerance to UV light and interstrand crosslinks in this species.

  7. Gene Expression in Single Cells Isolated from the CWR-R1 Prostate Cancer Cell Line and Human Prostate Tissue Based on the Side Population Phenotype.

    Science.gov (United States)

    Gangavarapu, Kalyan J; Miller, Austin; Huss, Wendy J

    2016-09-01

    Defining biological signals at the single cell level can identify cancer initiating driver mutations. Techniques to isolate single cells such as microfluidics sorting and magnetic capturing systems have limitations such as: high cost, labor intense, and the requirement of a large number of cells. Therefore, the goal of our current study is to identify a cost and labor effective, reliable, and reproducible technique that allows single cell isolation for analysis to promote regular laboratory use, including standard reverse transcription PCR (RT-PCR). In the current study, we utilized single prostate cells isolated from the CWR-R1 prostate cancer cell line and human prostate clinical specimens, based on the ATP binding cassette (ABC) transporter efflux of dye cycle violet (DCV), side population assay. Expression of four genes: ABCG2; Aldehyde dehydrogenase1A1 (ALDH1A1); androgen receptor (AR); and embryonic stem cell marker, Oct-4, were determined. Results from the current study in the CWR-R1 cell line showed ABCG2 and ALDH1A1 gene expression in 67% of single side population cells and in 17% or 100% of non-side population cells respectively. Studies using single cells isolated from clinical specimens showed that the Oct-4 gene is detected in only 22% of single side population cells and in 78% of single non-side population cells. Whereas, AR gene expression is in 100% single side population and non-side population cells isolated from the same human prostate clinical specimen. These studies show that performing RT-PCR on single cells isolated by FACS can be successfully conducted to determine gene expression in single cells from cell lines and enzymatically digested tissue. While these studies provide a simple yes/no expression readout, the more sensitive quantitative RT-PCR would be able to provide even more information if necessary.

  8. Engineered Deinococcus radiodurans R1 with NiCoT genes for bioremoval of trace cobalt from spent decontamination solutions of nuclear power reactors.

    Science.gov (United States)

    Gogada, Raghu; Singh, Surya Satyanarayana; Lunavat, Shanti Kumari; Pamarthi, Maruthi Mohan; Rodrigue, Agnes; Vadivelu, Balaji; Phanithi, Prakash-Babu; Gopala, Venkateswaran; Apte, Shree Kumar

    2015-11-01

    The aim of the present work was to engineer bacteria for the removal of Co in contaminated effluents. Radioactive cobalt ((60)Co) is known as a major contributor for person-sievert budgetary because of its long half-life and high γ-energy values. Some bacterial Ni/Co transporter (NiCoT) genes were described to have preferential uptake for cobalt. In this study, the NiCoT genes nxiA and nvoA from Rhodopseudomonas palustris CGA009 (RP) and Novosphingobium aromaticivorans F-199 (NA), respectively, were cloned under the control of the groESL promoter. These genes were expressed in Deinococcus radiodurans in reason of its high resistance to radiation as compared to other bacterial strains. Using qualitative real time-PCR, we showed that the expression of NiCoT-RP and NiCoT-NA is induced by cobalt and nickel. The functional expression of these genes in bioengineered D. radiodurans R1 strains resulted in >60 % removal of (60)Co (≥5.1 nM) within 90 min from simulated spent decontamination solution containing 8.5 nM of Co, even in the presence of >10 mM of Fe, Cr, and Ni. D. radiodurans R1 (DR-RP and DR-NA) showed superior survival to recombinant E. coli (ARY023) expressing NiCoT-RP and NA and efficiency in Co remediation up to 6.4 kGy. Thus, the present study reports a remarkable reduction in biomass requirements (2 kg) compared to previous studies using wild-type bacteria (50 kg) or ion-exchanger resins (8000 kg) for treatment of ~10(5)-l spent decontamination solutions (SDS).

  9. GSNOR Deficiency Enhances In Situ Skeletal Muscle Strength, Fatigue Resistance, and RyR1 S-Nitrosylation Without Impacting Mitochondrial Content and Activity

    Science.gov (United States)

    Moon, Younghye; Cao, Yenong; Zhu, Jingjing; Xu, Yuanyuan; Balkan, Wayne; Buys, Emmanuel S.; Diaz, Francisca; Kerrick, W. Glenn; Hare, Joshua M.

    2017-01-01

    Abstract Aim: Nitric oxide (NO) plays important, but incompletely defined roles in skeletal muscle. NO exerts its regulatory effects partly though S-nitrosylation, which is balanced by denitrosylation by enzymes such as S-nitrosoglutathione reductase (GSNOR), whose functions in skeletal muscle remain to be fully deciphered. Results: GSNOR null (GSNOR−/−) tibialis anterior (TA) muscles showed normal growth and were stronger and more fatigue resistant than controls in situ. However, GSNOR−/− lumbrical muscles showed normal contractility and Ca2+ handling in vitro, suggesting important differences in GSNOR function between muscles or between in vitro and in situ environments. GSNOR−/− TA muscles exhibited normal mitochondrial content, and capillary densities, but reduced type IIA fiber content. GSNOR inhibition did not impact mitochondrial respiratory complex I, III, or IV activities. These findings argue that enhanced GSNOR−/− TA contractility is not driven by changes in mitochondrial content or activity, fiber type, or blood vessel density. However, loss of GSNOR led to RyR1 hypernitrosylation, which is believed to increase muscle force output under physiological conditions. cGMP synthesis by soluble guanylate cyclase (sGC) was decreased in resting GSNOR−/− muscle and was more responsive to agonist (DETANO, BAY 41, and BAY 58) stimulation, suggesting that GSNOR modulates cGMP production in skeletal muscle. Innovation: GSNOR may act as a “brake” on skeletal muscle contractile performance under physiological conditions by modulating nitrosylation/denitrosylation balance. Conclusions: GSNOR may play important roles in skeletal muscle contractility, RyR1 S-nitrosylation, fiber type specification, and sGC activity. Antioxid. Redox Signal. 26, 165–181. PMID:27412893

  10. DdrA, DdrD, and PprA: components of UV and mitomycin C resistance in Deinococcus radiodurans R1.

    Directory of Open Access Journals (Sweden)

    Kathiresan Selvam

    Full Text Available Mutants created by deleting the ddrA, ddrB, ddrC, ddrD, and pprA loci of Deinococcus radiodurans R1alone and in all possible combinations of pairs revealed that the encoded gene products contribute to this species' resistance to UV light and/or mitomycin C. Deleting pprA from an otherwise wild type cell sensitizes the resulting strain to UV irradiation, reducing viability by as much as eight fold relative to R1. If this deletion is introduced into a ΔddrA or ΔddrD background, the resulting strains become profoundly sensitive to the lethal effects of UV light. At a fluence of 1000 Jm⁻², the ΔddrA ΔpprA and ΔddrD ΔpprA strains are 100- and 1000-fold more sensitive to UV relative to the strain that has only lost pprA. Deletion of ddrA results in a 100 fold increase in strain sensitivity to mitomycin C, but in backgrounds that combine a deletion of ddrA with deletions of either ddrC or ddrD, mitomycin resistance is restored to wild type levels. Inactivation of ddrB also increases D. radiodurans sensitivity to mitomycin, but unlike the ddrA mutant deleting ddrC or ddrD from a ΔddrB background further increases that sensitivity. Despite the effect that loss of these gene products has on DNA damage resistance, none appear to directly affect either excision repair or homologous recombination suggesting that they participate in novel processes that facilitate tolerance to UV light and interstrand crosslinks in this species.

  11. Fast Range Covariance Estimation using CONRAD

    Energy Technology Data Exchange (ETDEWEB)

    De Saint Jean, C.; Habert, B.; Noguere, G.; Archier, P.; Litaize, O.; Ruggieri, J.M. [CEA-Cadarache, DER/SPRC/LEPh, 13 - St-Paul-Lez-Durance (France)

    2009-07-01

    One of the initial goals of the CONRAD code development was to properly take into account various uncertainties propagations. First developments were performed to treat adequately nuisance parameters (such as experimental parameters), in the resolved and unresolved resonance region by using a marginalization technique. A generalization of these methodologies to higher energy range is presented in this paper. We will first present in detail the mathematics involved in this technique. The interface of CONRAD with ECIS will be presented, especially, the way optical model were parameterized in CONRAD from the classical RIPL database. Then, some applications of CONRAD (wrapping ECIS) will be presented. (authors)

  12. correlations with maternal parameters

    African Journals Online (AJOL)

    hematopoietic stem cell transplant is still far fetched, studies on the haematological parameters of umbilical cord blood are in addition relatively scanty. Several reports from Nigeria have focused mainly on haematological parameters in pregnant Nigerian subjects11, l2 and in healthy newborn neonates 13 14: Reports ...

  13. Absolute parameters of young stars: QZ Carinae

    Science.gov (United States)

    Walker, W. S. G.; Blackford, M.; Butland, R.; Budding, E.

    2017-09-01

    New high-resolution spectroscopy and BVR photometry together with literature data on the complex massive quaternary star QZ Car are collected and analysed. Absolute parameters are found as follows. System A: M1 = 43 (±3), M2 = 19 (+3 -7), R1 = 28 (±2), R2 = 6 (±2), (⊙); T1 ˜ 28 000, T2 ˜ 33 000 K; System B: M1 = 30 (±3), M2 = 20 (±3), R1 = 10 (±0.5), R2 = 20 (±1), (⊙); T1 ˜ 36 000, T2 ˜ 30 000 K (model dependent temperatures). The wide system AB: Period = 49.5 (±1) yr, Epochs, conjunction = 1984.8 (±1), periastron = 2005.3 (±3) yr, mean separation = 65 (±3), (au); orbital inclination = 85 (+5 -15) deg, photometric distance ˜2700 (±300) pc, age = 4 (±1) Myr. Other new contributions concern: (a) analysis of the timing of minima differences (O - C)s for the eclipsing binary (System B); (b) the width of the eclipses, pointing to relatively large effects of radiation pressure; (c) inferences from the rotational widths of lines for both Systems A and B; and (d) implications for theoretical models of early-type stars. While feeling greater confidence on the quaternary's general parametrization, observational complications arising from strong wind interactions or other, unclear, causes still inhibit precision and call for continued multiwavelength observations. Our high-inclination value for the AB system helps to explain failures to resolve the wide binary in the previous years. The derived young age independently confirms membership of QZ Car to the open cluster Collinder 228.

  14. Subsurface Geotechnical Parameters Report

    Energy Technology Data Exchange (ETDEWEB)

    D. Rigby; M. Mrugala; G. Shideler; T. Davidsavor; J. Leem; D. Buesch; Y. Sun; D. Potyondy; M. Christianson

    2003-12-17

    The Yucca Mountain Project is entering a the license application (LA) stage in its mission to develop the nation's first underground nuclear waste repository. After a number of years of gathering data related to site characterization, including activities ranging from laboratory and site investigations, to numerical modeling of processes associated with conditions to be encountered in the future repository, the Project is realigning its activities towards the License Application preparation. At the current stage, the major efforts are directed at translating the results of scientific investigations into sets of data needed to support the design, and to fulfill the licensing requirements and the repository design activities. This document addresses the program need to address specific technical questions so that an assessment can be made about the suitability and adequacy of data to license and construct a repository at the Yucca Mountain Site. In July 2002, the U.S. Nuclear Regulatory Commission (NRC) published an Integrated Issue Resolution Status Report (NRC 2002). Included in this report were the Repository Design and Thermal-Mechanical Effects (RDTME) Key Technical Issues (KTI). Geotechnical agreements were formulated to resolve a number of KTI subissues, in particular, RDTME KTIs 3.04, 3.05, 3.07, and 3.19 relate to the physical, thermal and mechanical properties of the host rock (NRC 2002, pp. 2.1.1-28, 2.1.7-10 to 2.1.7-21, A-17, A-18, and A-20). The purpose of the Subsurface Geotechnical Parameters Report is to present an accounting of current geotechnical information that will help resolve KTI subissues and some other project needs. The report analyzes and summarizes available qualified geotechnical data. It evaluates the sufficiency and quality of existing data to support engineering design and performance assessment. In addition, the corroborative data obtained from tests performed by a number of research organizations is presented to reinforce

  15. Short Rayleigh Range Free Electron Laser Amplifiers

    CERN Document Server

    Yu, L H; Murphy, J B; Rose, J; Shaftan, T V; Wang, X J; Watanabe, T

    2005-01-01

    An important requirement for a high average power laser system is a manageable power density on the first optical element. One possibility to achieve this is a single pass amplifier which generates a short Rayleigh range (SRL) light beam. We present design parameters and calculated performances for several SRL configurations. These include a simulation of the optically guided (pinched) MW class FEL [1], the scalloped beam FEL amplifier [2] and high gain TOK amplifiers we propose to explore at our SDL facility.

  16. 40 CFR 721.4486 - Propanoic acid, 2-methyl-, (1R,2R,4R)-1,7,7-trimethylbicyclo[2.2.1]hept-2-yl ester, rel-.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Propanoic acid, 2-methyl-, (1R,2R,4R...,4R)-1,7,7-trimethylbicyclo hept-2-yl ester, rel-. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substances identified as propanoic acid, 2-methyl-, (1R,2R,4R)-1,7...

  17. Expression of the pyr operon of Lactobacillus plantarum is regulated by inorganic carbon availability through a second regulator, PyrR2, homologous to the pyrimidine-dependent regulator PyrR1

    DEFF Research Database (Denmark)

    Arsène-Ploetze, Florence; Valérie Kugler, Valérie; Martinussen, Jan

    2006-01-01

    -mediated regulation in pyrR1 and pyrR2 mutants suggested that only PyrR2 positively regulates the expression levels of the pyr genes in response to IC levels but had no effect on pyrimidine-mediated repression. A model is proposed for the respective roles of PyrR1 and PyrR2 in the pyr regulon expression....